254780462

254780462

enoyl-(acyl carrier protein) reductase

GeneID in NCBI database:8209450Locus tag:CLIBASIA_01735
Protein GI in NCBI database:254780462Protein Accession:YP_003064875.1
Gene range:+(380351, 381154)Protein Length:267aa
Gene description:enoyl-(acyl carrier protein) reductase
COG prediction:[I] Enoyl-[acyl-carrier-protein] reductase (NADH)
KEGG prediction:fabI; enoyl-(acyl carrier protein) reductase (EC:1.3.1.9); K00208 enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9]
SEED prediction:Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9)
Pathway involved in KEGG:Fatty acid biosynthesis [PATH:las00061]
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MINILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGVTGEIHYVDCGYNIVAMPSYNKNKVIEN
ccccccccEEEEEcccccccHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEccHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHcHHHHcccccHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEcccccccccccccccccccc
ccccccccEEEEccccccccHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHcccccEEEEEEccccccHHHHcccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHEEEEEEEEEEEcHHHccEcccccHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEcccccccHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHccccccEEEEcccHHHEccccccccccccc
minilkgkrGLIMGVANDHSIAWGIAKVLHSAGAQLafsyqgesigkrlkplaltvdsdfmipcnvedpssmDLLFERIKERWETLDFVVHSIAfsdknelrgpyyntsrdNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMItltyggsmrvvpnynamapaksaLESSTKYLAcdyggmnirinaisagpvrtlagasisngrdiaawskensplkrtvSLEDIGNSALYLLSYLsngvtgeihyvdcgynivampsynknkvien
minilkgkrGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSiafsdknelrgpyyNTSRDNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIaawskensplkRTVSLEDIGNSALYLLSYLSNGVTGEIHYVDCGYNIVampsynknkvien
MINILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSAlyllsylsNGVTGEIHYVDCGYNIVAMPSYNKNKVIEN
*****KGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGVTGEIHYVDCGYNIVAM***********
MINILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGVTGEIHYVDCGYNIVAMPSYNKNKVIEN
****LKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGVTGEIHYVDCGYNIVAMPSYN*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGVTGEIHYVDCGYNIVAMPSYNKNKVIEN
MINILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGVTGEIHYVDCGYNIVAMPSYNKNKVIEN
MINILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGVTGEIHYVDCGYNIVAMPSYNKNKVIEN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target267 enoyl-(acyl carrier protein) reductase [Candidatus Libe
254781166284 enoyl-(acyl carrier protein) reductase [Candidatus 7e-77
254780535247 3-ketoacyl-(acyl-carrier-protein) reductase [Candi 2e-13
254780337257 oxidoreductase protein [Candidatus Liberibacter as 6e-05
>gi|254781166|ref|YP_003065579.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 284 Back     alignment
 Score =  278 bits (711), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 131/257 (50%), Positives = 191/257 (74%), Gaps = 1/257 (0%)

Query: 3   NILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMI 62
           N++K KRG+++GVAN+ S+AW IAK+ H+AGA++A ++QG++  KR++ L   +D     
Sbjct: 6   NLMKDKRGIVLGVANNRSLAWSIAKMCHAAGAKVALTWQGDATKKRIEGLVEGMDFFMAG 65

Query: 63  PCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVSCF 122
            CNV +  ++D +F  +++ W T+DF+VH+IAFSDK EL GPY NT+R+NF+ TM VS +
Sbjct: 66  HCNVSNSETIDDVFRNLEKEWGTIDFLVHAIAFSDKAELTGPYINTTRENFLNTMDVSVY 125

Query: 123 SFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMN- 181
           SFT +  RA+ LM  GG+M+TLTY G+ +V+P+YN M PAK+AL+S+ +YLA D G  + 
Sbjct: 126 SFTALAARASSLMNKGGSMLTLTYLGADKVMPHYNCMGPAKAALQSAVRYLAMDLGRQSG 185

Query: 182 IRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGVT 241
           IR+NA+SAGP +TLA + IS+ R I  W++ NSPL R ++ +++  SALYLLS  S+GVT
Sbjct: 186 IRVNALSAGPAKTLASSGISDFRYILKWNEYNSPLGRNITHDEVAKSALYLLSDFSSGVT 245

Query: 242 GEIHYVDCGYNIVAMPS 258
           GE HYVD GY+IV M +
Sbjct: 246 GECHYVDAGYHIVGMKA 262

>gi|254780535|ref|YP_003064948.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 247 Back     alignment
 Score = 67.4 bits (163), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 121/260 (46%), Gaps = 26/260 (10%)

Query: 5   LKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPC 64
           L GK+ L+ G +   SI   IAK+L+  GA +      +   +++      VD   + P 
Sbjct: 4   LTGKKALVTGASG--SIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPA 61

Query: 65  NVEDPSSMDLLFERIKERWETLDFVVHSIAF-SDKNELRGPYYNTSRDNFIQTMLVSCFS 123
           N  D  S++ L +R+ E    +D +V++     D   +R  Y +   D+ +   L S F 
Sbjct: 62  NFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDW--DDVLSVNLTSAFL 119

Query: 124 FTEIVRRAAQLMP-----HGGAMITLT----YGGSMRVVPNYNAMAPAKSALESSTKYLA 174
            T       QL+P       G +I +T    + G+   V NY A   AKS L   TK LA
Sbjct: 120 LTR------QLVPLMIRNRFGRVINITSVVGFTGNAGQV-NYCA---AKSGLTGFTKALA 169

Query: 175 CDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLS 234
            + G  N+ +N ++ G + +    +++   D       + P+KR  +++DI  + LYL S
Sbjct: 170 QETGRRNVTVNCVAPGFIGSDMTVNLT--EDQKGKIISSIPMKRMGAVDDIAAAVLYLSS 227

Query: 235 YLSNGVTGEIHYVDCGYNIV 254
             ++ VTG+  +V+ G  ++
Sbjct: 228 LEASYVTGQTIHVNGGMAMI 247

>gi|254780337|ref|YP_003064750.1| oxidoreductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 39.7 bits (91), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 68/156 (43%), Gaps = 8/156 (5%)

Query: 41  QGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNE 100
           Q E +   L+ +   +D   +   ++ D ++++L    I +RW  LD ++ +        
Sbjct: 54  QLEKLKNALQKINKKID---IFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGS-- 108

Query: 101 LRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMP--HGGAMITLTYGGSMRVVPNYNA 158
              P +     +F   + V+  +   I+R     +   H G  I L+ G + +  P + A
Sbjct: 109 -ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA 167

Query: 159 MAPAKSALESSTKYLACDYGGMNIRINAISAGPVRT 194
            + +K+A+E+  +  + +     +R+  I  GP RT
Sbjct: 168 YSASKAAIEALARTWSKETVNTALRVINIDPGPTRT 203

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target267 enoyl-(acyl carrier protein) reductase [Candidatus Libe
315122089265 enoyl-(acyl carrier protein) reductase [Candidatus Libe 1 1e-124
227824078281 enoyl-(acyl carrier protein) reductase [Sinorhizobium f 1 1e-104
15963999268 enoyl-(acyl carrier protein) reductase [Sinorhizobium m 1 1e-104
150398634268 enoyl-(acyl carrier protein) reductase [Sinorhizobium m 1 1e-103
325291591268 enoyl-acyl carrier protein reductase [Agrobacterium sp. 1 1e-102
254505113270 oxidoreductase, short chain dehydrogenase/reductase fam 1 1e-101
307943428270 enoyl-[acyl-carrier-protein] reductase [NADH] 2 [Roseib 1 1e-101
328541688270 oxidoreductase, short chain dehydrogenase/reductase fam 1 1e-101
222147155264 enoyl-(acyl carrier protein) reductase [Agrobacterium v 1 1e-101
118591455270 enoyl-(acyl carrier protein) reductase [Stappia aggrega 1 1e-100
>gi|315122089|ref|YP_004062578.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 265 Back     alignment and organism information
 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 207/264 (78%), Positives = 241/264 (91%)

Query: 1   MINILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDF 60
           M++ILKGKRGLIMG+AN+HSIAWGIAKVL S GAQL+FSYQGE+IGKRLKPLA  ++SDF
Sbjct: 1   MVDILKGKRGLIMGIANNHSIAWGIAKVLQSEGAQLSFSYQGEAIGKRLKPLASELNSDF 60

Query: 61  MIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVS 120
            IPCNVED +S+D LF +I++RW +L+F+VHSI FSDKNEL+GPY NTSRDNFI+TML+S
Sbjct: 61  TIPCNVEDSASIDSLFAQIQDRWGSLNFIVHSIGFSDKNELKGPYVNTSRDNFIRTMLIS 120

Query: 121 CFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGM 180
           CFSFTE+ +RAA+LMPHGGAMITLTYGGS RVVPNYN M  AK+ALESS KYLACDYG M
Sbjct: 121 CFSFTEVAKRAAKLMPHGGAMITLTYGGSTRVVPNYNVMGIAKAALESSVKYLACDYGHM 180

Query: 181 NIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGV 240
           NIR+NAISAGP+RTLAGASI++GRDIA+WS++NSPL+RTVSLEDIGNSALYLLS +SNGV
Sbjct: 181 NIRVNAISAGPIRTLAGASIAHGRDIASWSRDNSPLQRTVSLEDIGNSALYLLSNMSNGV 240

Query: 241 TGEIHYVDCGYNIVAMPSYNKNKV 264
           TGEIHYVDCGYNI AMP +NK  +
Sbjct: 241 TGEIHYVDCGYNITAMPLHNKKNI 264


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227824078|ref|YP_002828051.1| enoyl-(acyl carrier protein) reductase [Sinorhizobium fredii NGR234] Length = 281 Back     alignment and organism information
>gi|15963999|ref|NP_384352.1| enoyl-(acyl carrier protein) reductase [Sinorhizobium meliloti 1021] Length = 268 Back     alignment and organism information
>gi|150398634|ref|YP_001329101.1| enoyl-(acyl carrier protein) reductase [Sinorhizobium medicae WSM419] Length = 268 Back     alignment and organism information
>gi|325291591|ref|YP_004277455.1| enoyl-acyl carrier protein reductase [Agrobacterium sp. H13-3] Length = 268 Back     alignment and organism information
>gi|254505113|ref|ZP_05117264.1| oxidoreductase, short chain dehydrogenase/reductase family [Labrenzia alexandrii DFL-11] Length = 270 Back     alignment and organism information
>gi|307943428|ref|ZP_07658772.1| enoyl-[acyl-carrier-protein] reductase [NADH] 2 [Roseibium sp. TrichSKD4] Length = 270 Back     alignment and organism information
>gi|328541688|ref|YP_004301797.1| oxidoreductase, short chain dehydrogenase/reductase family [polymorphum gilvum SL003B-26A1] Length = 270 Back     alignment and organism information
>gi|222147155|ref|YP_002548112.1| enoyl-(acyl carrier protein) reductase [Agrobacterium vitis S4] Length = 264 Back     alignment and organism information
>gi|118591455|ref|ZP_01548853.1| enoyl-(acyl carrier protein) reductase [Stappia aggregata IAM 12614] Length = 270 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target267 enoyl-(acyl carrier protein) reductase [Candidatus Libe
PRK06505271 PRK06505, PRK06505, enoyl-(acyl carrier protein) reduct 1e-124
PRK08159272 PRK08159, PRK08159, enoyl-(acyl carrier protein) reduct 1e-103
PRK08415274 PRK08415, PRK08415, enoyl-(acyl carrier protein) reduct 4e-85
PRK07533258 PRK07533, PRK07533, enoyl-(acyl carrier protein) reduct 6e-80
PRK08594257 PRK08594, PRK08594, enoyl-(acyl carrier protein) reduct 9e-76
PRK07370258 PRK07370, PRK07370, enoyl-(acyl carrier protein) reduct 2e-75
PRK06603260 PRK06603, PRK06603, enoyl-(acyl carrier protein) reduct 2e-75
PRK06079252 PRK06079, PRK06079, enoyl-(acyl carrier protein) reduct 3e-64
PRK06997260 PRK06997, PRK06997, enoyl-(acyl carrier protein) reduct 7e-64
PRK07984262 PRK07984, PRK07984, enoyl-(acyl carrier protein) reduct 3e-60
PRK08690261 PRK08690, PRK08690, enoyl-(acyl carrier protein) reduct 7e-54
PRK07889256 PRK07889, PRK07889, enoyl-(acyl carrier protein) reduct 1e-43
PRK06300299 PRK06300, PRK06300, enoyl-(acyl carrier protein) reduct 1e-38
PLN02730303 PLN02730, PLN02730, enoyl-[acyl-carrier-protein] reduct 1e-35
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) reduct 2e-23
PRK08416260 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenas 2e-20
COG1028251 COG1028, FabG, Dehydrogenases with different specificit 2e-19
KOG0725270 KOG0725, KOG0725, KOG0725, Reductases with broad range 3e-17
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 2e-16
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Validate 1e-14
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Provisio 1e-14
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Validate 3e-14
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisio 3e-14
PRK07856252 PRK07856, PRK07856, short chain dehydrogenase; Provisio 3e-14
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-13
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Provisio 1e-13
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Provisio 2e-13
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-prot 6e-12
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) r 6e-12
KOG1207245 KOG1207, KOG1207, KOG1207, Diacetyl reductase/L-xylulos 7e-12
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenas 8e-12
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase 8e-12
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Provisio 1e-11
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-11
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Provisio 2e-10
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Pr 2e-10
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Provisio 3e-10
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Provisio 3e-10
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Pr 4e-10
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Provisio 7e-10
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 8e-09
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-08
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisio 2e-08
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Provisio 3e-08
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 4e-08
KOG1200256 KOG1200, KOG1200, KOG1200, Mitochondrial/plastidial bet 7e-08
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenase of 9e-08
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 1e-07
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisio 1e-07
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provisional 2e-07
PRK12747252 PRK12747, PRK12747, short chain dehydrogenase; Provisio 4e-07
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Provisio 6e-07
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Provisio 6e-07
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 6e-07
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase 8e-07
PRK09186256 PRK09186, PRK09186, flagellin modification protein A; P 2e-06
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Provisio 3e-06
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisio 3e-06
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Provisio 6e-06
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Provisio 8e-06
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) r 2e-05
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Provisio 4e-05
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase 9e-05
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Provisio 1e-04
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provisional 2e-04
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Provisio 4e-04
PRK05786238 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 5e-04
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Provisio 0.001
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydroge 0.001
COG0623259 COG0623, FabI, Enoyl-[acyl-carrier-protein] 1e-101
PRK05875276 PRK05875, PRK05875, short chain dehydrogenase; Provisio 1e-11
PRK07814263 PRK07814, PRK07814, short chain dehydrogenase; Provisio 9e-10
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Validate 1e-09
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 6e-09
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-07
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Provisio 5e-06
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 7e-06
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validated 1e-05
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Provisio 7e-05
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase 9e-05
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisio 4e-04
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Provisio 1e-11
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 4e-09
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Provisio 2e-08
PRK07576264 PRK07576, PRK07576, short chain dehydrogenase; Provisio 3e-08
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Provisio 3e-07
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Validate 4e-07
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 3e-06
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 1e-05
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldol 6e-05
PRK07041230 PRK07041, PRK07041, short chain dehydrogenase; Provisio 7e-05
PRK09134258 PRK09134, PRK09134, short chain dehydrogenase; Provisio 7e-05
PRK07677252 PRK07677, PRK07677, short chain dehydrogenase; Provisio 1e-04
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Provisio 1e-04
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Validate 2e-04
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisiona 3e-04
PRK06500249 PRK06500, PRK06500, short chain dehydrogenase; Provisio 0.001
PRK12859256 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) r 9e-08
COG0300265 COG0300, DltE, Short-chain dehydrogenases of various su 6e-07
PRK12748256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) r 3e-06
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Provisio 0.001
>gnl|CDD|180596 PRK06505, PRK06505, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181260 PRK08159, PRK08159, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181416 PRK08415, PRK08415, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181020 PRK07533, PRK07533, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181494 PRK08594, PRK08594, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180949 PRK07370, PRK07370, enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|168626 PRK06603, PRK06603, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180388 PRK06079, PRK06079, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180789 PRK06997, PRK06997, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181187 PRK07984, PRK07984, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|169553 PRK08690, PRK08690, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181158 PRK07889, PRK07889, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180521 PRK06300, PRK06300, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|178331 PLN02730, PLN02730, enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>gnl|CDD|181217 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|31231 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|35944 KOG0725, KOG0725, KOG0725, Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|180897 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180412 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181148 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180126 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162551 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|36421 KOG1207, KOG1207, KOG1207, Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130891 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180183 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|181112 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181336 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183525 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180133 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180836 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|36414 KOG1200, KOG1200, KOG1200, Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33946 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|102201 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162628 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169699 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|180661 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168990 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|180819 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180258 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183777 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181299 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|30968 COG0623, FabI, Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181389 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183774 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183776 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168382 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180553 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181043 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|180804 PRK07041, PRK07041, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181667 PRK09134, PRK09134, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180593 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|30648 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|183720 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 267 enoyl-(acyl carrier protein) reductase [Candidatus Libe
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07063259 short chain dehydrogenase; Provisional 100.0
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
PRK08226263 short chain dehydrogenase; Provisional 100.0
PRK06172253 short chain dehydrogenase; Provisional 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK06128300 oxidoreductase; Provisional 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK06841255 short chain dehydrogenase; Provisional 100.0
PRK12829264 short chain dehydrogenase; Provisional 100.0
PRK06138252 short chain dehydrogenase; Provisional 100.0
PRK05875277 short chain dehydrogenase; Provisional 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07523251 gluconate 5-dehydrogenase; Provisional 100.0
PRK08277278 D-mannonate oxidoreductase; Provisional 100.0
PRK07576260 short chain dehydrogenase; Provisional 100.0
PRK12827251 short chain dehydrogenase; Provisional 100.0
PRK06124259 gluconate 5-dehydrogenase; Provisional 100.0
PRK08936261 glucose-1-dehydrogenase; Provisional 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK08213259 gluconate 5-dehydrogenase; Provisional 100.0
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK08085254 gluconate 5-dehydrogenase; Provisional 100.0
PRK06227256 consensus 100.0
PRK12939250 short chain dehydrogenase; Provisional 100.0
PRK06500249 short chain dehydrogenase; Provisional 100.0
PRK06484 530 short chain dehydrogenase; Validated 100.0
PRK12935247 acetoacetyl-CoA reductase; Provisional 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 100.0
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 100.0
PRK06701289 short chain dehydrogenase; Provisional 100.0
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
PRK09242258 tropinone reductase; Provisional 100.0
PRK12746254 short chain dehydrogenase; Provisional 100.0
PRK06484530 short chain dehydrogenase; Validated 100.0
PRK07814263 short chain dehydrogenase; Provisional 100.0
PRK06114262 short chain dehydrogenase; Provisional 100.0
PRK06057255 short chain dehydrogenase; Provisional 100.0
PRK12937245 short chain dehydrogenase; Provisional 100.0
PRK07985294 oxidoreductase; Provisional 100.0
PRK07067256 sorbitol dehydrogenase; Provisional 100.0
PRK07831261 short chain dehydrogenase; Provisional 100.0
PRK08265261 short chain dehydrogenase; Provisional 100.0
PRK07097265 gluconate 5-dehydrogenase; Provisional 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK06949258 short chain dehydrogenase; Provisional 100.0
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 100.0
PRK06198268 short chain dehydrogenase; Provisional 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07774250 short chain dehydrogenase; Provisional 100.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK07776252 consensus 100.0
PRK07035252 short chain dehydrogenase; Provisional 100.0
PRK06346251 consensus 100.0
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 100.0
PRK07479252 consensus 100.0
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK06398256 aldose dehydrogenase; Validated 100.0
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 100.0
PRK06300298 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07890258 short chain dehydrogenase; Provisional 100.0
PRK12747252 short chain dehydrogenase; Provisional 100.0
PRK08628258 short chain dehydrogenase; Provisional 100.0
PRK12938246 acetyacetyl-CoA reductase; Provisional 100.0
PRK07677254 short chain dehydrogenase; Provisional 100.0
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK08643256 acetoin reductase; Validated 100.0
PRK12743253 acetoin dehydrogenase; Provisional 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 100.0
PRK12824245 acetoacetyl-CoA reductase; Provisional 100.0
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK09135249 pteridine reductase; Provisional 100.0
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 100.0
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 100.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 100.0
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 100.0
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07060245 short chain dehydrogenase; Provisional 100.0
PRK07856254 short chain dehydrogenase; Provisional 100.0
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 100.0
PRK05717255 oxidoreductase; Validated 100.0
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
TIGR01963258 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 100.0
PRK06947252 glucose-1-dehydrogenase; Provisional 100.0
PRK06123249 short chain dehydrogenase; Provisional 100.0
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 100.0
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 100.0
PRK07791285 short chain dehydrogenase; Provisional 100.0
PRK06125259 short chain dehydrogenase; Provisional 100.0
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 100.0
PRK12828239 short chain dehydrogenase; Provisional 100.0
PRK07069251 short chain dehydrogenase; Validated 100.0
PRK12744257 short chain dehydrogenase; Provisional 100.0
PRK09730247 hypothetical protein; Provisional 100.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 100.0
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 100.0
PRK07074256 short chain dehydrogenase; Provisional 100.0
PRK12742237 oxidoreductase; Provisional 100.0
PRK06523260 short chain dehydrogenase; Provisional 100.0
PRK09134256 short chain dehydrogenase; Provisional 100.0
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK09186255 flagellin modification protein A; Provisional 100.0
PRK08278273 short chain dehydrogenase; Provisional 100.0
PRK08324676 short chain dehydrogenase; Validated 100.0
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
PRK07577234 short chain dehydrogenase; Provisional 100.0
PRK07707239 consensus 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
PRK07806248 short chain dehydrogenase; Provisional 100.0
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07041240 short chain dehydrogenase; Provisional 100.0
TIGR02415258 23BDH acetoin reductases; InterPro: IPR014007 One membe 100.0
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07454241 short chain dehydrogenase; Provisional 100.0
PRK08945245 short chain dehydrogenase; Provisional 100.0
PRK07775275 short chain dehydrogenase; Provisional 100.0
TIGR01832249 kduD 2-deoxy-D-gluconate 3-dehydrogenase; InterPro: IPR 100.0
COG0623259 FabI Enoyl-[acyl-carrier-protein] 100.0
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK06483236 short chain dehydrogenase; Provisional 100.0
KOG1200256 consensus 100.0
PRK08703239 short chain dehydrogenase; Provisional 100.0
KOG0725270 consensus 100.0
PRK06940277 short chain dehydrogenase; Provisional 100.0
PRK06924251 short chain dehydrogenase; Provisional 100.0
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 100.0
PRK07326235 short chain dehydrogenase; Provisional 100.0
PRK05872296 short chain dehydrogenase; Provisional 100.0
PRK07023243 short chain dehydrogenase; Provisional 100.0
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK05866290 short chain dehydrogenase; Provisional 100.0
PRK06139324 short chain dehydrogenase; Provisional 100.0
PRK05855582 short chain dehydrogenase; Validated 100.0
PRK07825273 short chain dehydrogenase; Provisional 100.0
PRK06181263 short chain dehydrogenase; Provisional 100.0
PRK06194301 hypothetical protein; Provisional 100.0
PRK08263275 short chain dehydrogenase; Provisional 100.0
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 100.0
PRK05876275 short chain dehydrogenase; Provisional 100.0
PRK06180277 short chain dehydrogenase; Provisional 100.0
PRK06914280 short chain dehydrogenase; Provisional 100.0
PRK06182273 short chain dehydrogenase; Validated 100.0
PRK07201663 short chain dehydrogenase; Provisional 100.0
PRK05650270 short chain dehydrogenase; Provisional 100.0
PRK08219226 short chain dehydrogenase; Provisional 100.0
PRK08862227 short chain dehydrogenase; Provisional 100.0
PRK06179270 short chain dehydrogenase; Provisional 100.0
PRK05884223 short chain dehydrogenase; Provisional 100.0
PRK08267258 short chain dehydrogenase; Provisional 100.0
PRK09009235 C factor cell-cell signaling protein; Provisional 100.0
PRK07109338 short chain dehydrogenase; Provisional 100.0
PRK07832272 short chain dehydrogenase; Provisional 100.0
PRK09291257 short chain dehydrogenase; Provisional 100.0
PRK07578199 short chain dehydrogenase; Provisional 100.0
PRK09072262 short chain dehydrogenase; Provisional 100.0
PRK08264235 short chain dehydrogenase; Validated 100.0
PRK06482276 short chain dehydrogenase; Provisional 100.0
PRK05693274 short chain dehydrogenase; Provisional 100.0
PRK05993277 short chain dehydrogenase; Provisional 100.0
PRK07024256 short chain dehydrogenase; Provisional 100.0
PRK08251248 short chain dehydrogenase; Provisional 100.0
PRK08017256 short chain dehydrogenase; Provisional 100.0
KOG1207245 consensus 100.0
TIGR02685283 pter_reduc_Leis pteridine reductase; InterPro: IPR01405 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 100.0
COG1028251 FabG Dehydrogenases with different specificities (relat 100.0
PRK07102243 short chain dehydrogenase; Provisional 100.0
PRK06101241 short chain dehydrogenase; Provisional 100.0
PRK05599246 hypothetical protein; Provisional 100.0
PRK08177225 short chain dehydrogenase; Provisional 100.0
KOG1205282 consensus 100.0
PRK07904253 short chain dehydrogenase; Provisional 100.0
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 100.0
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, pu 100.0
PRK06953222 short chain dehydrogenase; Provisional 100.0
KOG1199260 consensus 100.0
PRK06196316 oxidoreductase; Provisional 100.0
KOG4169261 consensus 100.0
PRK05854314 short chain dehydrogenase; Provisional 100.0
PRK06197306 short chain dehydrogenase; Provisional 100.0
KOG1209289 consensus 100.0
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.97
KOG1208314 consensus 99.97
KOG1204253 consensus 99.97
KOG1210331 consensus 99.96
pfam08643296 DUF1776 Fungal family of unknown function (DUF1776). Th 99.94
TIGR01500267 sepiapter_red sepiapterin reductase; InterPro: IPR00639 99.88
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 99.72
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 99.69
COG1086588 Predicted nucleoside-diphosphate sugar epimerases [Cell 99.65
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 99.65
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.58
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.57
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 99.55
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 99.52
KOG1502327 consensus 99.52
PRK12367250 short chain dehydrogenase; Provisional 99.51
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 99.51
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 99.5
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 99.42
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 99.34
KOG4022236 consensus 99.29
TIGR01181340 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: 99.15
CHL00194319 ycf39 Ycf39; Provisional 99.13
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biog 99.12
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.1
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisio 99.01
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 99.01
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 98.93
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase 98.92
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 98.9
PRK07201 663 short chain dehydrogenase; Provisional 98.78
COG4982 866 3-oxoacyl-[acyl-carrier protein] 98.76
KOG1430361 consensus 98.61
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis 98.55
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 98.54
TIGR01746405 Thioester-redct thioester reductase domain; InterPro: I 98.42
TIGR01777307 yfcH conserved hypothetical protein TIGR01777; InterPro 98.16
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [Gener 98.08
KOG1431315 consensus 97.99
TIGR02197353 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; 97.85
TIGR01472365 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 Th 97.82
KOG1429350 consensus 97.66
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 97.65
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 97.54
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.44
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.22
PRK13771332 putative alcohol dehydrogenase; Provisional 97.21
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 97.03
PRK08268 503 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.93
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 96.79
PRK11730 715 fadB multifunctional fatty acid oxidation complex subun 96.67
COG3007398 Uncharacterized paraquat-inducible protein B [Function 96.62
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 96.32
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 96.16
KOG1372376 consensus 96.15
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 95.96
PRK09422338 alcohol dehydrogenase; Provisional 94.96
TIGR02823330 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP f 94.55
PRK10083339 putative dehydrogenase; Provisional 94.53
TIGR01085 494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 93.39
KOG1196343 consensus 92.44
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 100.0
KOG1201300 consensus 100.0
pfam00106167 adh_short short chain dehydrogenase. This family contai 100.0
smart00822180 PKS_KR This enzymatic domain is part of bacterial polyk 100.0
KOG1610322 consensus 99.97
COG3967245 DltE Short-chain dehydrogenase involved in D-alanine es 99.96
KOG1014312 consensus 99.96
KOG1611249 consensus 99.94
KOG1478341 consensus 99.66
TIGR01289321 LPOR light-dependent protochlorophyllide reductase; Int 99.58
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.52
TIGR01179341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 99.2
pfam07993245 NAD_binding_4 Male sterility protein. This family repre 99.12
KOG1371343 consensus 99.08
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 99.06
TIGR02622361 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: I 99.04
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 98.63
KOG1202 2376 consensus 98.34
COG3320 382 Putative dehydrogenase domain of multifunctional non-ri 98.27
PRK13656400 trans-2-enoyl-CoA reductase; Provisional 98.27
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.47
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.47
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.47
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 97.17
PRK07660283 consensus 97.16
KOG1203411 consensus 97.16
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.07
KOG0747331 consensus 96.88
PRK09117282 consensus 96.86
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 96.76
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.04
TIGR01139312 cysK cysteine synthase A; InterPro: IPR005859 This mode 95.64
KOG2774366 consensus 95.62
PRK08269311 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.71
PRK11154 706 fadJ multifunctional fatty acid oxidation complex subun 94.46
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 93.99
KOG4039238 consensus 93.62
PRK06720169 hypothetical protein; Provisional 100.0
KOG1221 467 consensus 97.97
KOG2865391 consensus 97.29
PRK12320 699 hypothetical protein; Provisional 97.16
PRK09880343 L-idonate 5-dehydrogenase; Provisional 97.14
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 96.78
PRK05865 854 hypothetical protein; Provisional 96.77
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.6
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 96.57
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 96.29
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 96.06
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 95.83
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 95.64
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 95.52
pfam00107131 ADH_zinc_N Zinc-binding dehydrogenase. 95.17
PTZ00082322 L-lactate dehydrogenase; Provisional 94.74
PRK08181269 transposase; Validated 94.48
PRK09183258 transposase/IS protein; Provisional 94.29
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 94.24
KOG0023360 consensus 93.83
PRK06526254 transposase; Provisional 93.16
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 91.83
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 90.74
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 90.63
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 90.46
PRK08261 447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.98
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 98.64
COG1748 389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.06
PRK08309182 short chain dehydrogenase; Provisional 97.86
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 97.69
PRK05579392 bifunctional phosphopantothenoylcysteine decarboxylase/ 97.44
pfam03435 384 Saccharop_dh Saccharopine dehydrogenase. This family co 97.43
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 97.41
KOG2733 423 consensus 97.36
PRK09620229 hypothetical protein; Provisional 97.34
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.34
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 97.28
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 97.23
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 97.21
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketide syn 97.21
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.09
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.06
pfam04127197 DFP DNA / pantothenate metabolism flavoprotein. The DNA 97.02
PRK06849 387 hypothetical protein; Provisional 96.97
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 96.79
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 96.69
KOG1198347 consensus 96.66
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 96.65
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.63
PRK09496 455 trkA potassium transporter peripheral membrane componen 96.48
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 96.48
PRK13265157 glycine/sarcosine/betaine reductase complex protein A; 96.31
PRK13982476 bifunctional SbtC-like/phosphopantothenoylcysteine deca 96.3
PRK09496455 trkA potassium transporter peripheral membrane componen 96.16
PRK13940414 glutamyl-tRNA reductase; Provisional 96.13
PRK06719157 precorrin-2 dehydrogenase; Validated 96.04
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.95
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 95.91
TIGR02114253 coaB_strep phosphopantothenate--cysteine ligase; InterP 95.85
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 95.69
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 95.47
TIGR02824334 quinone_pig3 putative NAD(P)H quinone oxidoreductase, P 95.47
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 95.31
COG3268 382 Uncharacterized conserved protein [Function unknown] 95.24
PRK06732228 phosphopantothenate--cysteine ligase; Validated 95.21
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.13
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 94.88
pfam04723150 GRDA Glycine reductase complex selenoprotein A. Found i 94.83
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 94.53
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 94.3
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 93.91
COG0027 394 PurT Formate-dependent phosphoribosylglycinamide formyl 93.12
KOG0024354 consensus 92.94
COG2085211 Predicted dinucleotide-binding enzymes [General functio 92.85
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabol 92.64
pfam00148 398 Oxidored_nitro Nitrogenase component 1 type Oxidoreduct 92.56
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 92.22
TIGR01915233 npdG NADPH-dependent F420 reductase; InterPro: IPR01018 91.55
PRK11559295 garR tartronate semialdehyde reductase; Provisional 91.47
PRK05476427 S-adenosyl-L-homocysteine hydrolase; Provisional 91.17
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.16
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 91.05
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.97
KOG2250514 consensus 90.93
pfam05221430 AdoHcyase S-adenosyl-L-homocysteine hydrolase. 90.74
PTZ00075476 S-adenosyl-L-homocysteine hydrolase; Provisional 90.57
COG2910211 Putative NADH-flavin reductase [General function predic 90.46
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycas 90.24
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 97.18
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 96.51
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.31
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 94.57
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 93.05
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 96.77
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.62
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.56
PRK01390 457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.55
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.47
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.36
KOG0069336 consensus 96.29
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 96.03
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.86
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of amino a 95.32
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 95.22
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelat 95.14
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 95.05
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 94.97
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.85
PRK06718202 precorrin-2 dehydrogenase; Reviewed 94.84
PRK13243333 glyoxylate reductase; Reviewed 94.77
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 94.64
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 94.62
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.55
PRK07574385 formate dehydrogenase; Provisional 94.08
PTZ00079469 NADP-specific glutamate dehydrogenase; Provisional 94.01
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o 93.98
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Ami 93.94
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 93.88
PRK06436303 glycerate dehydrogenase; Provisional 93.86
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.8
PRK06487317 glycerate dehydrogenase; Provisional 93.76
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 93.69
PRK08655 441 prephenate dehydrogenase; Provisional 93.61
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 93.53
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] 93.45
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methy 93.33
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 93.13
PRK12550272 shikimate 5-dehydrogenase; Reviewed 93.13
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 92.93
TIGR02352 357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 92.51
PRK12480330 D-lactate dehydrogenase; Provisional 92.47
PRK06932314 glycerate dehydrogenase; Provisional 92.47
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 92.4
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 92.34
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisional 92.26
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 92.09
PRK09414446 glutamate dehydrogenase; Provisional 91.83
PRK00421 459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 91.79
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 91.56
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.09
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 91.05
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 90.74
KOG1370434 consensus 90.53
PRK01368 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.53
PRK06019 377 phosphoribosylaminoimidazole carboxylase ATPase subunit 90.35
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 90.2
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 90.17
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 90.15
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 90.08
TIGR01283 470 nifE nitrogenase MoFe cofactor biosynthesis protein Nif 94.86
cd01976421 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitro 91.89
cd01968 410 Nitrogenase_NifE_I Nitrogenase_NifE_I: a subgroup of th 93.5
PRK10792288 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 90.67
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Meth 92.78
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284 This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information