254780463

254780463

putative peptidoglycan binding protein

GeneID in NCBI database:8209451Locus tag:CLIBASIA_01740
Protein GI in NCBI database:254780463Protein Accession:YP_003064876.1
Gene range:+(381619, 383640)Protein Length:673aa
Gene description:putative peptidoglycan binding protein
COG prediction:[L] Helicase subunit of the DNA excision repair complex
KEGG prediction:putative peptidoglycan binding protein
SEED prediction:putative hemagglutinin protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670---
MSGLTPLKDHSSCAVSKKSELENPSGMTDIHRIKNWIQKVIGEEKNKPLSQEQKEKIKILWSSLRKIAGSNEEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIESKTEQNGGIDPNLQSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIISIPGIKKSHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGTLTEEGRRLPYSTSNDLSPNHQASHKYSELFKNLCSDNTPSVNQTRVESNTYNEQYPILSSNNSLDQHNHPHDISETQGDSVYDQKKREKEFNSPHDIQHMLERVSLIQQGILEDDNTIPTYISAVRRATSTSTMRSNDLKEKNIGKKIWNFTKYITSNQWVTSIMLVATLLVSSFLLSPALLVRETFFFKS
cccccccccccccccccHHccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHEEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHcccccccccHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccccEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccc
ccccccccccccccEEccccccccccccHHHHHHHHHHHHHcHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEccHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccccccccEEcHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccHHcccHHHHHHHcccHcHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccHHHHHcHHHHHHcHHHHHcccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHccccccccccccEEEcccccccccEEccccccccccccccccccccccHHcHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccEEHHHEEEcccccccccccHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccc
msgltplkdhsscavskkselenpsgmtdiHRIKNWIQKVIgeeknkplsqEQKEKIKILWSSLRKiagsneevsdpnlnspiqreddcnvvrtndDTKQIFNLLRKklsnphlqqhieskteqnggidpnlqseslptipgtairedddidifHSDMAKLSKSITELCRIisipgikksHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMqctfdknnngfaasgiDEKLVSIVNSTHNLLSLLKLLNEKistkgvlsfDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVreqqkpakpRLDLIEKIGERLGNLESHVANIMLKLEerqntsedpAILRNLENQLLNIKDlvtndlkdnrtlrepdqhvfgLEDYIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGtlteegrrlpystsndlspnhqashKYSELFKNlcsdntpsvnqtrvesntyneqypilssnnsldqhnhphdisetqgdsvydqkkrekefnsphdIQHMLERVSLIQQgileddntipTYISAVRRatststmrsndlkeknigKKIWNFTKYITSNQWVTSIMLVATLLVSSFllspallvretfffks
msgltplkdhsscavskkselenpsgmtdiHRIKNWIQKVIGeeknkplsqeqKEKIKILWSSLRKIagsneevsdpnlnspiqreddcnvvRTNDDTKQIFNLLRKKLSNPHLQQHIEskteqnggidpnLQSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIIsipgikkshSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKIstkgvlsfdtklsEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSdvreqqkpakprLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLvtndlkdnrtlrepdqhvfgLEDYIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGTLTEEGRRLPystsndlspnhQASHKYSELFKNLCSDNTPSVNQTRVESNTYNEQYPILSSNNSLDQHNHPHDISETQGDSVYDQKKREKEFNSPHDIQHMLERVSLIQQGILEDDNTIPTYISAVrratststmrsndlkeknigkkiwNFTKYITSNQWVTSIMLVATLLVSSFLLSPALLVRETFFFKS
MSGLTPLKDHSSCAVSKKSELENPSGMTDIHRIKNWIQKVIGEEKNKPLSQEQKEKIKILWSSLRKIAGSNEEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIESKTEQNGGIDPNLQSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIISIPGIKKSHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNllsllkllNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGTLTEEGRRLPYSTSNDLSPNHQASHKYSELFKNLCSDNTPSVNQTRVESNTYNEQYPILSSNNSLDQHNHPHDISETQGDSVYDQKKREKEFNSPHDIQHMLERVSLIQQGILEDDNTIPTYISAVRRATSTSTMRSNDLKEKNIGKKIWNFTKYITSNQWVTSIMLVATLLVSSFLLSPALLVRETFFFKS
***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************TLYDMLVKIF*********************************************************************************************************************************************************WNFTKYITSNQWVTSIMLVATLLVSSFLLSPALLVRETFFFK*
************************SGMTDIHRIKNWIQKVIGEEKNKPLSQEQKEKIKILWSSLRKIAGSNEEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIESKTEQNGGIDPNLQSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIISIPGIKKSHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGTLTEEGRRLPYSTSNDLSPNHQASHKYSELFKNLCSDNTPSVNQTRVESNTYNEQYPILSSNNSLDQHNHPHDISETQGDSVYDQKKREKEFNSPHDIQHMLERVSLIQQGILEDDNTIPTYISAVRRATSTSTMRSNDLKEKNIGKKIWNFTKYITSNQWVTSIMLVATLLVSSFLLSPALLVRETFFFKS
***********SCAVSKKS*L*NPSGMTDIHRIKNWIQKVIGEEKNKPLSQEQKEKIKILWSSLRKIAGS*EEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIES*****GGIDPNLQSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIISIPGIKKSHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGTLTEEGRRLPYSTSNDLSPNHQASHKYSELFKNLCSDNTPSVNQTRVESNTYNEQYPILSSN****************GDSVYDQKKREKEFNSPHDIQHMLERVSLIQQGILEDDNTIPTYISAVRRAT**STMRSNDLKEKNIGKKIWNFTKYITSNQWVTSIMLVATLLVSSFLLSPALLVRETFFFKS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGLTPLKDHSSCAVSKKSELENPSGMTDIHRIKNWIQKVIGEEKNKPLSQEQKEKIKILWSSLRKIAGSNEEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIESKTEQNGGIDPNLQSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIISIPGIKKSHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGTLTEEGRRLPYSTSNDLSPNHQASHKYSELFKNLCSDNTPSVNQTRVESNTYNEQYPILSSNNSLDQHNHPHDISETQGDSVYDQKKREKEFNSPHDIQHMLERVSLIQQGILEDDNTIPTYISAVRRATSTSTMRSNDLKEKNIGKKIWNFTKYITSNQWVTSIMLVATLLVSSFLLSPALLVRETFFFKS
MSGLTPLKDHSSCAVSKKSELENPSGMTDIHRIKNWIQKVIGEEKNKPLSQEQKEKIKILWSSLRKIAGSNEEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIESKTEQNGGIDPNLQSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIISIPGIKKSHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGTLTEEGRRLPYSTSNDLSPNHQASHKYSELFKNLCSDNTPSVNQTRVESNTYNEQYPILSSNNSLDQHNHPHDISETQGDSVYDQKKREKEFNSPHDIQHMLERVSLIQQGILEDDNTIPTYISAVRRATSTSTMRSNDLKEKNIGKKIWNFTKYITSNQWVTSIMLVATLLVSSFLLSPALLVRETFFFKS
MSGLTPLKDHSSCAVSKKSELENPSGMTDIHRIKNWIQKVIGEEKNKPLSQEQKEKIKILWSSLRKIAGSNEEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIESKTEQNGGIDPNLQSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIISIPGIKKSHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGTLTEEGRRLPYSTSNDLSPNHQASHKYSELFKNLCSDNTPSVNQTRVESNTYNEQYPILSSNNSLDQHNHPHDISETQGDSVYDQKKREKEFNSPHDIQHMLERVSLIQQGILEDDNTIPTYISAVRRATSTSTMRSNDLKEKNIGKKIWNFTKYITSNQWVTSIMLVATLLVSSFLLSPALLVRETFFFKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target673 putative peptidoglycan binding protein [Candidatus Libe
315122088667 putative peptidoglycan binding protein [Candidatus Libe 1 1e-163
241202992 1263 peptidoglycan-binding domain 1 protein [Rhizobium legum 1 3e-11
241202992 1263 peptidoglycan-binding domain 1 protein [Rhizobium legum 1 6e-04
116250359 1267 peptidoglycan binding protein [Rhizobium leguminosarum 1 5e-11
86356208 1249 putative hemagglutinin protein [Rhizobium etli CFN 42] 1 3e-10
307307025 1220 Peptidoglycan-binding domain 1 protein [Sinorhizobium m 1 4e-08
15964288 960 hypothetical protein SMc02230 [Sinorhizobium meliloti 1 1 5e-08
209547818 1260 peptidoglycan-binding protein [Rhizobium leguminosarum 1 5e-08
209547818 1260 peptidoglycan-binding protein [Rhizobium leguminosarum 1 0.002
150395374 1226 peptidoglycan binding domain-containing protein [Sinorh 1 6e-08
>gi|315122088|ref|YP_004062577.1| putative peptidoglycan binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 667 Back     alignment and organism information
 Score =  581 bits (1497), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 345/681 (50%), Positives = 470/681 (69%), Gaps = 22/681 (3%)

Query: 1   MSGLTPLKDHSSCAVSKKSELENPSGMTDIHRIKNWIQKVIGEEKNKPLSQEQKEKIKIL 60
           MSGL P K+HS+  VSK S LE+  GMTDI  IKNWIQ+  G+++  PLSQE+KEKI++L
Sbjct: 1   MSGLRPKKNHSNDTVSKNSRLESALGMTDIQNIKNWIQEAAGKDQKNPLSQEKKEKIQLL 60

Query: 61  WSSLRKIAGSNEEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIES 120
           WSSLRKI+G N E+S+ NL++  Q + + N  +  +DT Q+FN LR+K SNP LQ+    
Sbjct: 61  WSSLRKISGDNTEISNLNLDTFPQDKSNPNKEKEANDTNQVFNFLRQKSSNPPLQKQQTF 120

Query: 121 KTEQNG---GIDPNLQSESLPTIPGTAIRE-DDDIDIFHSDMAKLSKSITELCRIISIPG 176
           + + N    GID +L++ +L +     I E + +   FH DM KL+KSI+ELCRIIS+ G
Sbjct: 121 QEKNNSAYQGIDQSLKN-TLKSKSSYEITEHNANFKNFHCDMDKLAKSISELCRIISLSG 179

Query: 177 IKKSHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVM 236
           I+ S+S   K L K+ENIAKE SLQ+V + WK ALQ+ KKLDF+NLHEKIN LSCQM+ M
Sbjct: 180 IQGSYSSFGKTLLKIENIAKEYSLQNVGDTWKVALQYLKKLDFQNLHEKINALSCQMDSM 239

Query: 237 QCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAV 296
           +C  D+ N       +DEK++SI+N+THNLLSLLKLLNEKIS K  LS +TKLS+IK  V
Sbjct: 240 KCVLDQKNCS-KEPVLDEKILSILNNTHNLLSLLKLLNEKISAKEALSINTKLSDIKAIV 298

Query: 297 EKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNL 356
           EKN ++ +SYTQKFV+K ++  E+IG ++Q+I ++V  Q+K  + +L  +E + +RL NL
Sbjct: 299 EKNEQFTESYTQKFVKKCDESFENIGTKIQNIQNEVLSQKKSTEQKLQSLESLDQRLQNL 358

Query: 357 ESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLED 416
           ++HV NI  +LEE+QNT ++  +LRNLE Q+ +IK++VT + +D +  +E  + +F LED
Sbjct: 359 DTHVQNITRQLEEKQNTPQNNVLLRNLERQITSIKEVVTTNTRDQKLSQEVAKKIFHLED 418

Query: 417 YIVKTAHKTARSMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKI 476
           +IV+TA+KTA+SMLNS++  Q +E IL+ NMHEY K+ Q+V AEQTIKNFTTLYDMLVKI
Sbjct: 419 FIVQTANKTAKSMLNSLDGRQALETILKNNMHEYLKKAQQVQAEQTIKNFTTLYDMLVKI 478

Query: 477 FQKLGTLTEEGRRLPYSTSNDLSPNHQASHKYSELFKNLCSDNTPSVNQTRVESN--TYN 534
            QKL    EE R+ P S   + SPN Q+S  ++        D T   +QT++ESN  +  
Sbjct: 479 IQKLENPLEENRK-PSSVPTNFSPNFQSSLPFANTSHTGKVDGT---SQTKLESNKLSIK 534

Query: 535 EQYPILSSNNSL--DQHNHPHDISETQGDSVYDQKKREKEFNSPHDIQHMLERVSLIQQG 592
           E  P+L ++  L   + N  HD  +T  +S  D   RE+E + P DIQ +LERVS IQ G
Sbjct: 535 ENLPLLFASKHLFNGKPNKLHDNPKTYKESFDD---REEELDIPRDIQQILERVSSIQNG 591

Query: 593 ILEDDNTIPTYISAVRRATSTSTMRSNDLKEKNIGKKIWNFTKYITSNQWVTSIMLVATL 652
            LEDD TIP YISAVRRA S S + +  LK+K   K+     K +  N+WVTS+ML ATL
Sbjct: 592 NLEDD-TIPHYISAVRRAASKSVIGNETLKKK---KERRGKIKSMIFNKWVTSMMLAATL 647

Query: 653 LVSSFLLSPALLVRETFFFKS 673
           + SSFLL+P+ LV  TFFF+ 
Sbjct: 648 IASSFLLAPS-LVGTTFFFRG 667


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241202992|ref|YP_002974088.1| peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1263 Back     alignment and organism information
>gi|241202992|ref|YP_002974088.1| peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1263 Back     alignment and organism information
>gi|116250359|ref|YP_766197.1| peptidoglycan binding protein [Rhizobium leguminosarum bv. viciae 3841] Length = 1267 Back     alignment and organism information
>gi|86356208|ref|YP_468100.1| putative hemagglutinin protein [Rhizobium etli CFN 42] Length = 1249 Back     alignment and organism information
>gi|307307025|ref|ZP_07586764.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti BL225C] Length = 1220 Back     alignment and organism information
>gi|15964288|ref|NP_384641.1| hypothetical protein SMc02230 [Sinorhizobium meliloti 1021] Length = 960 Back     alignment and organism information
>gi|209547818|ref|YP_002279735.1| peptidoglycan-binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 1260 Back     alignment and organism information
>gi|209547818|ref|YP_002279735.1| peptidoglycan-binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 1260 Back     alignment and organism information
>gi|150395374|ref|YP_001325841.1| peptidoglycan binding domain-containing protein [Sinorhizobium medicae WSM419] Length = 1226 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 673 putative peptidoglycan binding protein [Candidatus Libe
KOG0161 1930 consensus 98.7
TIGR02169 1202 SMC_prok_A chromosome segregation protein SMC; InterPro 95.58
KOG0976 1265 consensus 90.74
pfam01576 859 Myosin_tail_1 Myosin tail. The myosin molecule is a mul 97.88
KOG4674 1822 consensus 96.31
pfam10174774 Cast RIM-binding protein of the cytomatrix active zone. 97.77
pfam05622713 HOOK HOOK protein. This family consists of several HOOK 93.59
>KOG0161 consensus Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>KOG0976 consensus Back     alignment and domain information
>pfam01576 Myosin_tail_1 Myosin tail Back     alignment and domain information
>KOG4674 consensus Back     alignment and domain information
>pfam10174 Cast RIM-binding protein of the cytomatrix active zone Back     alignment and domain information
>pfam05622 HOOK HOOK protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target673 putative peptidoglycan binding protein [Candidatus Libe
1i84_S1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 1e-06
1i84_S1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 8e-04
>gi|13786876|pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
 Score = 60.3 bits (143), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 37/331 (11%), Positives = 95/331 (28%), Gaps = 7/331 (2%)

Query: 18   KSELENPSGMTDIHRIKNWIQKVIGE-EKNKPLSQEQKEKIKILWSSLRKIAGSNEEVSD 76
            + E E  +   ++ R K   QK   E ++ +    +  E+  +L   L+       E  +
Sbjct: 854  RQEEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEE 913

Query: 77   PNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIE----SKTEQNGGIDPNL 132
              +    ++++   ++   +   +      ++L     +   +     +  +        
Sbjct: 914  MRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQK 973

Query: 133  QSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIISIPGIKKSHSQLEKILSKME 192
                  T  G   + +DDI I      KL+K    L   +S      +  + +       
Sbjct: 974  LQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKL 1033

Query: 193  NIAKECSLQSVENNWKGALQ--HFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAAS 250
                E  +  +E   K   +     +   + L  + + L  Q+  +Q    +     A  
Sbjct: 1034 KNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKK 1093

Query: 251  GIDEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKF 310
              + +                L   +     +      L   K A  K  K  +  +++ 
Sbjct: 1094 EEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEEL 1153

Query: 311  VEKFEKHLESIGAQVQDIHSDVREQQKPAKP 341
                 +  +++            + +     
Sbjct: 1154 EALKTELEDTLDTTATQQELRGSDYKDDDDK 1184


>gi|13786876|pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target673 putative peptidoglycan binding protein [Candidatus Libe
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, myosi 97.66
2bsg_A487 Fibritin; viral protein, attachment protein, bacterioph 95.19
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3dtp_B 3dtp_A Back     alignment and structure
Probab=97.66  E-value=0.0016  Score=37.10  Aligned_cols=324  Identities=9%  Similarity=0.007  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254780463|r   52 EQKEKIKILWSSLRKIAGSNEEVSDPNLNSPIQREDDCNVVRTNDDTKQIFNLLRKKLSNPHLQQHIESKTEQNGGIDPN  131 (673)
Q Consensus        52 ~~~e~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  131 (673)
                      ...+.+..+...+........++......+......+...........................+...............
T Consensus       861 ~~~eel~qlkeklek~~~elqele~~~~~L~~E~~~Lq~~l~~~~~~~~~~~e~~~~~~~~~~ele~~l~~l~~~l~~~~  940 (1184)
T 1i84_S          861 AKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEE  940 (1184)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999998899999998888999999999888899988888778999999997566655788899874479


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999888889999999999999999998888753123348999999
Q gi|254780463|r  132 LQSESLPTIPGTAIREDDDIDIFHSDMAKLSKSITELCRIISIPGIKKSHSQLEKILSKMENIAKECSLQSVENNWKGAL  211 (673)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  211 (673)
                      .....+......+......+.............+....... ....................+.................
T Consensus       941 ~~~~eL~~e~~~Le~ei~eLk~qlee~e~~~~~Le~e~~~~-e~~l~~L~~el~~le~~~~~L~~e~~~Lee~l~~l~~~ 1019 (1184)
T 1i84_S          941 ERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKLQLEKVTA-DGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTN 1019 (1184)
T ss_dssp             ------------------------HHHH-------------------------------------HC-------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999-99999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99864212447999999999999999999998988999999999999999999999999999999999999987865567
Q gi|254780463|r  212 QHFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSE  291 (673)
Q Consensus       212 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  291 (673)
                      ..........+......+...+..+...+................+........................+.....++..
T Consensus      1020 l~~~ee~~~~L~~~~~kle~~i~eLe~~le~~e~~~~ele~~~~~Le~el~~lqe~l~ele~ei~~l~~~l~~~e~El~~ 1099 (1184)
T 1i84_S         1020 LAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQA 1099 (1184)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999988677678643211467999985210025788765787886332334458888876877999888888642
Q gi|254780463|r  292 IKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQ  371 (673)
Q Consensus       292 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  371 (673)
                      ....+........... .....+...+..+...+................+......+...+..................
T Consensus      1100 l~~~lee~~~~~~~l~-kei~eLe~ei~eLeeeLe~~~~~~~~lekq~~eL~~eLeeLk~eLee~~d~~~~q~ELr~s~~ 1178 (1184)
T 1i84_S         1100 ALARLEDETSQKNNAL-KKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSDY 1178 (1184)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999-999999999999999999999999999999999999999999999999989999999999998


Q ss_pred             HCCHHH
Q ss_conf             100068
Q gi|254780463|r  372 NTSEDP  377 (673)
Q Consensus       372 ~~~~~~  377 (673)
                      ....+.
T Consensus      1179 kekeDK 1184 (1184)
T 1i84_S         1179 KDDDDK 1184 (1184)
T ss_dssp             ------
T ss_pred             HHHHCC
T ss_conf             887069




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 673 putative peptidoglycan binding protein [Candidatus Libe
d1h2vc3310 a.118.1.14 (C:481-790) CBP80, 80KDa nuclear cap-binding 8e-04
>d1h2vc3 a.118.1.14 (C:481-790) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 310 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: MIF4G domain-like
domain: CBP80, 80KDa nuclear cap-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 39.5 bits (92), Expect = 8e-04
 Identities = 30/219 (13%), Positives = 69/219 (31%), Gaps = 20/219 (9%)

Query: 99  KQIFNLLRKKLSNPHLQQHIESKTEQNGGIDPNLQSESLPTIPGTAIREDDDIDIFHSDM 158
             +    + K +N  +   ++     N   D +      P            I++F   +
Sbjct: 22  LCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFNPLK----------IEVFVQTL 71

Query: 159 AKL-SKSITELCRIISIPGIKKSHSQLEKILSKMENIAKECSLQSVENNWKGALQHFKKL 217
             L +KS +     ++     K H   + +    E   K   L+ +   W+   Q    L
Sbjct: 72  LHLAAKSFSHSFSALA-----KFHEVFKTLAESDE--GKLHVLRVMFEVWRNHPQMIAVL 124

Query: 218 DFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLVSIVNSTHNLLSLLKLLNEKI 277
             K +  +I  + C          + +  F    + E L S +   +  +  ++   E+ 
Sbjct: 125 VDKMIRTQI--VDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELEEA 182

Query: 278 STKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEK 316
             K       +  +   + ++     +   ++  EK E 
Sbjct: 183 KEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVES 221


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00