254780464

254780464

M16 family peptidase

GeneID in NCBI database:8209452Locus tag:CLIBASIA_01745
Protein GI in NCBI database:254780464Protein Accession:YP_003064877.1
Gene range:-(383792, 385066)Protein Length:424aa
Gene description:M16 family peptidase
COG prediction:[R] Predicted Zn-dependent peptidases
KEGG prediction:M16 family peptidase
SEED prediction:Mitochondrial processing peptidase-like protein (EC 3.4.24.64)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420----
MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM
ccEEEEEcccccEEEEEcccccEEEEEEEEEccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHccEEEEEEcccEEEEEEEEcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccHHHHHHccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHcccccccccccccccccccccEEEcccccccEEEEEEEccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccEEEEEEEccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHcccccEEEEEEccHHHcccHHHHHHHHHcHHcc
ccEEEEEcccccEEEEEEccccEEEEEEEEEccHHHcccccccHHHHHHHHcccEEcccEHHHHHHHHHHcccEEEEEEcccEEEEEEEEEHHHHHHHHHHHHHHHHcEcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHccccccHHHHHHccHHHHHHHHHHHccHHHEEEEEEEcccHHHHHHHHHHHHcccccccccccccccccccccEEEcccccccEEEEEEcccccccccHHHHHHHHHHHcccccHHHHHHHHHHcccEEEEEEEccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHcc
mnlrisktssgitvitevmpidSAFVKVNIragsrnerqEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGgdinaytslehTSYHAWVLKEHVPLALEIIGdmlsnssfnpsdieRERNVVLEEigmseddsWDFLDARFSEmvwkdqiigrpilgkpetissftpeKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKikesmkpavyvggeyiqKRDLAEEHMMLgfngcayqsrdFYLTNILASILGDGMSSRLFQEVREKRGLCYSISahhenfsdnGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIfsstptlailgppmdhvpttsELIHALEGFRSM
mnlrisktssgitvitevmpidsaFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLsnssfnpsdIERERNVVLEEIGMSEDDSWDFLDARFSEMVWkdqiigrpilgkpetissftpEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKikesmkpavyVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM
MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM
*NLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYF********************EYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM
********SSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM
*NLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM
MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM
MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target424 M16 family peptidase [Candidatus Liberibacter asiaticus
315122087424 M16 family peptidase [Candidatus Liberibacter solanacea 1 0.0
227821121432 peptidase, family M16 protein [Sinorhizobium fredii NGR 1 1e-109
255601042432 metalloprotease, putative [Ricinus communis] Length = 4 1 1e-108
325292170432 M16 family peptidase [Agrobacterium sp. H13-3] Length = 1 1e-108
159184464432 M16 family peptidase [Agrobacterium tumefaciens str. C5 1 1e-108
222147814434 peptidase family M16 [Agrobacterium vitis S4] Length = 1 1e-107
150395759434 processing peptidase [Sinorhizobium medicae WSM419] Len 1 1e-104
307304251433 processing peptidase [Sinorhizobium meliloti BL225C] Le 1 1e-103
195970190432 putative processing protease protein [Sinorhizobium mel 1 1e-103
190890694432 processing peptidase [Rhizobium etli CIAT 652] Length = 1 1e-103
>gi|315122087|ref|YP_004062576.1| M16 family peptidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 424 Back     alignment and organism information
 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/420 (75%), Positives = 371/420 (88%), Gaps = 1/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           MNLRISKTSSGITVITEVMP + SAFV VNIR+GSR+ER+EEHGMAHFLEHMLFKGT++R
Sbjct: 1   MNLRISKTSSGITVITEVMPHLKSAFVGVNIRSGSRDEREEEHGMAHFLEHMLFKGTSRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T+K+IVEEIEKVGGDINAYTS+EHTSYHA VLK+ VPLAL+IIGDMLSNSSFNPSDIERE
Sbjct: 61  TSKDIVEEIEKVGGDINAYTSVEHTSYHARVLKDDVPLALDIIGDMLSNSSFNPSDIERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+VVLEEIGMSED+ W FL   F E+VWK+QIIGRPILGKP+T++SF  EKIIS++SRNY
Sbjct: 121 RSVVLEEIGMSEDNPWSFLYDHFLEIVWKNQIIGRPILGKPDTVASFGSEKIISYISRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           TA+R+YVVCVG+VDH+ C+ QVE+YFNV      +E++KPAVYVGGEYIQKRDLAEEH+ 
Sbjct: 181 TANRIYVVCVGSVDHDACLRQVENYFNVYPAVTKEENIKPAVYVGGEYIQKRDLAEEHIA 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF GCAYQSRDFY T IL SILG GMSSRLFQEVREKRGLCYSISAHH NFSDNGV  I
Sbjct: 241 LGFKGCAYQSRDFYPTKILTSILGGGMSSRLFQEVREKRGLCYSISAHHNNFSDNGVFCI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           ++ATAKEN++ L S+IVEV+ SLL+ IEQ EI K CAKI A+LI +QE S  RA EISKQ
Sbjct: 301 SAATAKENLVELISAIVEVIHSLLKGIEQSEISKVCAKIRAQLIINQEDSDFRASEISKQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           VMFCG +LC+E+IIDTISAITC DI+ +A++IFSS PT+AILGPP++ +P++SEL+H L+
Sbjct: 361 VMFCGHVLCNEEIIDTISAITCTDIIEIAERIFSSVPTIAILGPPINDIPSSSELMHNLK 420


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821121|ref|YP_002825091.1| peptidase, family M16 protein [Sinorhizobium fredii NGR234] Length = 432 Back     alignment and organism information
>gi|255601042|ref|XP_002537592.1| metalloprotease, putative [Ricinus communis] Length = 432 Back     alignment and organism information
>gi|325292170|ref|YP_004278034.1| M16 family peptidase [Agrobacterium sp. H13-3] Length = 432 Back     alignment and organism information
>gi|159184464|ref|NP_353810.2| M16 family peptidase [Agrobacterium tumefaciens str. C58] Length = 432 Back     alignment and organism information
>gi|222147814|ref|YP_002548771.1| peptidase family M16 [Agrobacterium vitis S4] Length = 434 Back     alignment and organism information
>gi|150395759|ref|YP_001326226.1| processing peptidase [Sinorhizobium medicae WSM419] Length = 434 Back     alignment and organism information
>gi|307304251|ref|ZP_07584003.1| processing peptidase [Sinorhizobium meliloti BL225C] Length = 433 Back     alignment and organism information
>gi|195970190|ref|NP_385026.2| putative processing protease protein [Sinorhizobium meliloti 1021] Length = 432 Back     alignment and organism information
>gi|190890694|ref|YP_001977236.1| processing peptidase [Rhizobium etli CIAT 652] Length = 432 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target424 M16 family peptidase [Candidatus Liberibacter asiaticus
KOG0960467 KOG0960, KOG0960, KOG0960, Mitochondrial processing pep 2e-56
KOG2067472 KOG2067, KOG2067, KOG2067, Mitochondrial processing pep 2e-49
KOG2583429 KOG2583, KOG2583, KOG2583, Ubiquinol cytochrome c reduc 2e-27
COG0612438 COG0612, PqqL, Predicted Zn-dependent peptidases [Gener 5e-81
pfam00675149 pfam00675, Peptidase_M16, Insulinase (Peptidase family 2e-31
PRK15101 961 PRK15101, PRK15101, protease3; Provisional 7e-06
pfam05193182 pfam05193, Peptidase_M16_C, Peptidase M16 inactive doma 3e-26
KOG0959 974 KOG0959, KOG0959, KOG0959, N-arginine dibasic convertas 2e-21
COG1025 937 COG1025, Ptr, Secreted/periplasmic Zn-dependent peptida 5e-20
TIGR02110 696 TIGR02110, PQQ_syn_pqqF, coenzyme PQQ biosynthesis prob 5e-10
COG1026 978 COG1026, COG1026, Predicted Zn-dependent peptidases, in 2e-06
KOG0961 1022 KOG0961, KOG0961, KOG0961, Predicted Zn2+-dependent end 3e-06
>gnl|CDD|36178 KOG0960, KOG0960, KOG0960, Mitochondrial processing peptidase, beta subunit, and related enzymes (insulinase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|37278 KOG2067, KOG2067, KOG2067, Mitochondrial processing peptidase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|37794 KOG2583, KOG2583, KOG2583, Ubiquinol cytochrome c reductase, subunit QCR2 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30957 COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only] Back     alignment and domain information
>gnl|CDD|144319 pfam00675, Peptidase_M16, Insulinase (Peptidase family M16) Back     alignment and domain information
>gnl|CDD|185056 PRK15101, PRK15101, protease3; Provisional Back     alignment and domain information
>gnl|CDD|147402 pfam05193, Peptidase_M16_C, Peptidase M16 inactive domain Back     alignment and domain information
>gnl|CDD|36177 KOG0959, KOG0959, KOG0959, N-arginine dibasic convertase NRD1 and related Zn2+-dependent endopeptidases, insulinase superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31228 COG1025, Ptr, Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162709 TIGR02110, PQQ_syn_pqqF, coenzyme PQQ biosynthesis probable peptidase PqqF Back     alignment and domain information
>gnl|CDD|31229 COG1026, COG1026, Predicted Zn-dependent peptidases, insulinase-like [General function prediction only] Back     alignment and domain information
>gnl|CDD|36179 KOG0961, KOG0961, KOG0961, Predicted Zn2+-dependent endopeptidase, insulinase superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 424 M16 family peptidase [Candidatus Liberibacter asiaticus
KOG0960467 consensus 100.0
COG0612438 PqqL Predicted Zn-dependent peptidases [General functio 100.0
KOG2067472 consensus 100.0
KOG2583429 consensus 100.0
COG1025 937 Ptr Secreted/periplasmic Zn-dependent peptidases, insul 100.0
KOG0959 974 consensus 100.0
COG1026 978 Predicted Zn-dependent peptidases, insulinase-like [Gen 100.0
KOG2019 998 consensus 99.97
KOG0961 1022 consensus 99.97
TIGR02110 737 PQQ_syn_pqqF coenzyme PQQ biosynthesis protein PqqF; In 99.93
COG1026978 Predicted Zn-dependent peptidases, insulinase-like [Gen 99.88
KOG2019998 consensus 99.6
pfam00675149 Peptidase_M16 Insulinase (Peptidase family M16). 100.0
pfam05193182 Peptidase_M16_C Peptidase M16 inactive domain. Peptidas 99.95
COG1025937 Ptr Secreted/periplasmic Zn-dependent peptidases, insul 99.72
KOG0959974 consensus 99.65
KOG09611022 consensus 99.45
pfam03410 590 Peptidase_M44 Protein G1. Protein G1, named after the v 98.55
COG0612 438 PqqL Predicted Zn-dependent peptidases [General functio 98.48
pfam08367248 M16C_assoc Peptidase M16C associated. This domain appea 98.25
pfam00675149 Peptidase_M16 Insulinase (Peptidase family M16). 97.15
KOG0960467 consensus 96.59
KOG2067472 consensus 96.46
TIGR02110737 PQQ_syn_pqqF coenzyme PQQ biosynthesis protein PqqF; In 95.06
pfam05193182 Peptidase_M16_C Peptidase M16 inactive domain. Peptidas 91.47
>KOG0960 consensus Back     alignment and domain information
>COG0612 PqqL Predicted Zn-dependent peptidases [General function prediction only] Back     alignment and domain information
>KOG2067 consensus Back     alignment and domain information
>KOG2583 consensus Back     alignment and domain information
>COG1025 Ptr Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0959 consensus Back     alignment and domain information
>COG1026 Predicted Zn-dependent peptidases, insulinase-like [General function prediction only] Back     alignment and domain information
>KOG2019 consensus Back     alignment and domain information
>KOG0961 consensus Back     alignment and domain information
>TIGR02110 PQQ_syn_pqqF coenzyme PQQ biosynthesis protein PqqF; InterPro: IPR011844 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>COG1026 Predicted Zn-dependent peptidases, insulinase-like [General function prediction only] Back     alignment and domain information
>KOG2019 consensus Back     alignment and domain information
>pfam00675 Peptidase_M16 Insulinase (Peptidase family M16) Back     alignment and domain information
>pfam05193 Peptidase_M16_C Peptidase M16 inactive domain Back     alignment and domain information
>COG1025 Ptr Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0959 consensus Back     alignment and domain information
>KOG0961 consensus Back     alignment and domain information
>pfam03410 Peptidase_M44 Protein G1 Back     alignment and domain information
>COG0612 PqqL Predicted Zn-dependent peptidases [General function prediction only] Back     alignment and domain information
>pfam08367 M16C_assoc Peptidase M16C associated Back     alignment and domain information
>pfam00675 Peptidase_M16 Insulinase (Peptidase family M16) Back     alignment and domain information
>KOG0960 consensus Back     alignment and domain information
>KOG2067 consensus Back     alignment and domain information
>TIGR02110 PQQ_syn_pqqF coenzyme PQQ biosynthesis protein PqqF; InterPro: IPR011844 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>pfam05193 Peptidase_M16_C Peptidase M16 inactive domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target424 M16 family peptidase [Candidatus Liberibacter asiaticus
3hdi_A421 Crystal Structure Of Bacillus Halodurans Metallo Pe 1e-49
3cwb_A446 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 4e-45
1bcc_A446 Cytochrome Bc1 Complex From Chicken Length = 446 2e-44
1qcr_A446 Crystal Structure Of Bovine Mitochondrial Cytochrom 2e-44
1bgy_A446 Cytochrome Bc1 Complex From Bovine Length = 446 2e-44
1sqb_A480 Crystal Structure Analysis Of Bovine Bc1 With Azoxy 2e-44
1hr6_B443 Yeast Mitochondrial Processing Peptidase Length = 4 2e-43
1hr7_B443 Yeast Mitochondrial Processing Peptidase Beta-E73q 4e-42
1hr6_A475 Yeast Mitochondrial Processing Peptidase Length = 4 3e-29
3eoq_A406 The Crystal Structure Of Putative Zinc Protease Bet 3e-27
3bcc_B422 Stigmatellin And Antimycin Bound Cytochrome Bc1 Com 4e-27
1bcc_B422 Cytochrome Bc1 Complex From Chicken Length = 422 6e-27
3cwb_B441 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 2e-26
1sqb_B453 Crystal Structure Analysis Of Bovine Bc1 With Azoxy 4e-26
1qcr_B423 Crystal Structure Of Bovine Mitochondrial Cytochrom 4e-26
1bgy_B439 Cytochrome Bc1 Complex From Bovine Length = 439 4e-26
3amj_B424 The Crystal Structure Of The Heterodimer Of M16b Pe 5e-26
1ezv_A430 Structure Of The Yeast Cytochrome Bc1 Complex Co- C 3e-17
1kb9_A431 Yeast Cytochrome Bc1 Complex Length = 431 8e-16
3gwb_A434 Crystal Structure Of Peptidase M16 Inactive Domain 2e-12
3go9_A492 Predicted Insulinase Family Protease From Yersinia 8e-06
3amj_C437 The Crystal Structure Of The Heterodimer Of M16b Pe 7e-33
3ami_A445 The Crystal Structure Of The M16b Metallopeptidase 7e-33
2jg4_A 990 Substrate-Free Ide Structure In Its Closed Conforma 4e-20
3hgz_A 969 Crystal Structure Of Human Insulin-Degrading Enzyme 7e-19
3e4z_A 990 Crystal Structure Of Human Insulin Degrading Enzyme 7e-19
3e4a_A 1019 Human Ide-Inhibitor Complex At 2.6 Angstrom Resolut 7e-19
2wby_A 990 Crystal Structure Of Human Insulin-Degrading Enzyme 7e-19
3cww_A 990 Crystal Structure Of Ide-Bradykinin Complex Length 7e-19
2g47_A 990 Crystal Structure Of Human Insulin-Degrading Enzyme 8e-19
1q2l_A 939 Crystal Structure Of Pitrilysin Length = 939 4e-16
1ezv_B352 Structure Of The Yeast Cytochrome Bc1 Complex Co- C 1e-06
3d3y_A425 Crystal Structure Of A Conserved Protein From Enter 1e-05
>gi|270346540|pdb|3HDI|A Chain A, Crystal Structure Of Bacillus Halodurans Metallo Peptidase Length = 421 Back     alignment and structure
 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 126/411 (30%), Positives = 227/411 (55%), Gaps = 4/411 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +      +G+ +ITE M  + S  + + +  GSR E  EE+G++HFLEHM FKGT  R+A
Sbjct: 2   INTMTLDNGVRIITEKMSTVRSVSIGIWVGTGSRYESAEENGISHFLEHMFFKGTNTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL +H   A++ + DM  +S+F   ++E+ER 
Sbjct: 62  QEIAEFFDSIGGQVNAFTSKEYTCYYAKVLDDHAGQAIDTLSDMFFHSTFQKEELEKERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M +D   D +    S   +    +G PILG  ET++SF    +  ++ R YT 
Sbjct: 122 VVFEEIKMVDDTPDDIVHDLLSSATYGKHSLGYPILGTVETLNSFNEGMLRHYMDRFYTG 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G   H+  + +++  F+           +  +++    ++K++  + H+ LG
Sbjct: 182 DYVVISVAGN-VHDELIDKIKETFSQVKPTTYNYQGEKPMFLPNRIVRKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G     +D Y   +L ++LG  MSSRLFQ++REKRGLCYS+ ++H +F D+G+L I +
Sbjct: 241 YPGLPIGDKDVYALVLLNNVLGGSMSSRLFQDIREKRGLCYSVFSYHSSFRDSGMLTIYA 300

Query: 302 ATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  SI E       + + ++E++    ++   L+ S E +  R     K  
Sbjct: 301 GTGHDQLDDLVYSIQETTSALAEKGLTEKELENGKEQLKGSLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
           +        +++I+ I+A+  +D+  +AK + S++P+++++    + +P  
Sbjct: 361 LLLKKHRSLDEMIEQINAVQKQDVSRLAKILLSASPSISLINANGE-LPKA 410


>gi|196049775|pdb|3CWB|A Chain A, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-D Length = 446 Back     alignment and structure
>gi|3659967|pdb|1BCC|A Chain A, Cytochrome Bc1 Complex From Chicken Length = 446 Back     alignment and structure
>gi|3891848|pdb|1QCR|A Chain A, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 446 Back     alignment and structure
>gi|4139392|pdb|1BGY|A Chain A, Cytochrome Bc1 Complex From Bovine Length = 446 Back     alignment and structure
gi|55669764|pdb|1SQB|A Chain A, Crystal Structure Analysis Of Bovine Bc1 With Azoxystrobin Length = 480 Back     alignment and structure
>gi|15826320|pdb|1HR6|B Chain B, Yeast Mitochondrial Processing Peptidase Length = 443 Back     alignment and structure
>gi|15826328|pdb|1HR7|B Chain B, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Length = 443 Back     alignment and structure
>gi|15826319|pdb|1HR6|A Chain A, Yeast Mitochondrial Processing Peptidase Length = 475 Back     alignment and structure
>gi|225698041|pdb|3EOQ|A Chain A, The Crystal Structure Of Putative Zinc Protease Beta- Subunit From Thermus Thermophilus Hb8 Length = 406 Back     alignment and structure
>gi|3660377|pdb|3BCC|B Chain B, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex From Chicken Length = 422 Back     alignment and structure
>gi|157838260|pdb|1BCC|B Chain B, Cytochrome Bc1 Complex From Chicken Length = 422 Back     alignment and structure
>gi|196049776|pdb|3CWB|B Chain B, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-D Length = 441 Back     alignment and structure
gi|55669765|pdb|1SQB|B Chain B, Crystal Structure Analysis Of Bovine Bc1 With Azoxystrobin Length = 453 Back     alignment and structure
>gi|3891849|pdb|1QCR|B Chain B, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 423 Back     alignment and structure
>gi|4139393|pdb|1BGY|B Chain B, Cytochrome Bc1 Complex From Bovine Length = 439 Back     alignment and structure
>gi|322812368|pdb|3AMJ|B Chain B, The Crystal Structure Of The Heterodimer Of M16b Peptidase From Sphingomonas Sp. A1 Length = 424 Back     alignment and structure
>gi|14277712|pdb|1EZV|A Chain A, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment Length = 430 Back     alignment and structure
>gi|24158771|pdb|1KB9|A Chain A, Yeast Cytochrome Bc1 Complex Length = 431 Back     alignment and structure
>gi|237640618|pdb|3GWB|A Chain A, Crystal Structure Of Peptidase M16 Inactive Domain From Pseudomonas Fluorescens. Northeast Structural Genomics Target Plr293l Length = 434 Back     alignment and structure
>gi|226438337|pdb|3GO9|A Chain A, Predicted Insulinase Family Protease From Yersinia Pestis Length = 492 Back     alignment and structure
>gi|322812369|pdb|3AMJ|C Chain C, The Crystal Structure Of The Heterodimer Of M16b Peptidase From Sphingomonas Sp. A1 Length = 437 Back     alignment and structure
>gi|321159652|pdb|3AMI|A Chain A, The Crystal Structure Of The M16b Metallopeptidase Subunit From Sphingomonas Sp. A1 Length = 445 Back     alignment and structure
>gi|151567732|pdb|2JG4|A Chain A, Substrate-Free Ide Structure In Its Closed Conformation Length = 990 Back     alignment and structure
>gi|270346544|pdb|3HGZ|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Amylin Length = 969 Back     alignment and structure
>gi|256032525|pdb|3E4Z|A Chain A, Crystal Structure Of Human Insulin Degrading Enzyme In Complex With Insulin-Like Growth Factor Ii Length = 990 Back     alignment and structure
>gi|237823798|pdb|3E4A|A Chain A, Human Ide-Inhibitor Complex At 2.6 Angstrom Resolution Length = 1019 Back     alignment and structure
>gi|225733943|pdb|2WBY|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Insulin Length = 990 Back     alignment and structure
>gi|215261187|pdb|3CWW|A Chain A, Crystal Structure Of Ide-Bradykinin Complex Length = 990 Back     alignment and structure
>gi|118137776|pdb|2G47|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Amyloid-Beta (1-40) Length = 990 Back     alignment and structure
>gi|67464134|pdb|1Q2L|A Chain A, Crystal Structure Of Pitrilysin Length = 939 Back     alignment and structure
>gi|14277713|pdb|1EZV|B Chain B, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment Length = 352 Back     alignment and structure
>gi|194320055|pdb|3D3Y|A Chain A, Crystal Structure Of A Conserved Protein From Enterococcus Faecalis V583 Length = 425 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target424 M16 family peptidase [Candidatus Liberibacter asiaticus
3hdi_A421 Processing protease; CAGE structure, M16B peptidase, me 2e-75
1hr6_A475 Alpha-MPP, mitochondrial processing peptidase alpha sub 4e-74
1pp9_B439 Ubiquinol-cytochrome C reductase complex core protein 2 4e-71
3cx5_A431 Cytochrome B-C1 complex subunit 1, mitochondrial; compl 2e-70
1pp9_A446 Ubiquinol-cytochrome C reductase complex core protein I 9e-70
1q2l_A 939 Protease III; hydrolase; 2.20A {Escherichia coli str} S 5e-64
1hr6_B443 Beta-MPP, mitochondrial processing peptidase beta subun 3e-62
3cww_A990 Insulysin, insulin-degrading enzyme, insulinase; A-beta 2e-21
3cx5_B352 Cytochrome B-C1 complex subunit 2, mitochondrial; compl 1e-55
3d3y_A425 Uncharacterized protein; APC29635, conserved protein, s 3e-55
3go9_A492 Insulinase family protease; IDP00573, structural genomi 5e-48
3eoq_A406 Putative zinc protease; two similar domains of beta(2)- 1e-41
3gwb_A434 Peptidase M16 inactive domain family protein; peptidase 2e-38
1q2l_A939 Protease III; hydrolase; 2.20A {Escherichia coli str} S 3e-19
2fge_A995 Atprep2;, zinc metalloprotease (insulinase family); pep 1e-20
3cww_A 990 Insulysin, insulin-degrading enzyme, insulinase; A-beta 1e-60
2fge_A 995 Atprep2;, zinc metalloprotease (insulinase family); pep 5e-44
3ih6_A197 Putative zinc protease; bordetella pertussis tohama I, 6e-16
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Length = 421 Back     alignment and structure
 Score =  278 bits (711), Expect = 2e-75
 Identities = 131/398 (32%), Positives = 225/398 (56%), Gaps = 3/398 (0%)

Query: 9   SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
            +G+ +ITE M  + S  + + +  GSR E  EE+G++HFLEHM FKGT  R+A+EI E 
Sbjct: 8   DNGVRIITEKMSTVRSVSIGIWVGTGSRYESAEENGISHFLEHMFFKGTNTRSAQEIAEF 67

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
            + +GG +NA+TS E+T Y+A VL +H   A++ + DM  +S+F   ++E+ER VV EEI
Sbjct: 68  FDSIGGQVNAFTSKEYTCYYAKVLDDHAGQAIDTLSDMFFHSTFQKEELEKERKVVFEEI 127

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
            M +D   D +    S   +    +G PILG  ET++SF    +  ++ R YT D + + 
Sbjct: 128 KMVDDTPDDIVHDLLSSATYGKHSLGYPILGTVETLNSFNEGMLRHYMDRFYTGDYVVIS 187

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
             G V  E      E++  V       +  KP +++    ++K++  + H+ LG+ G   
Sbjct: 188 VAGNVHDELIDKIKETFSQVKPTTYNYQGEKP-MFLPNRIVRKKETEQAHLCLGYPGLPI 246

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
             +D Y   +L ++LG  MSSRLFQ++REKRGLCYS+ ++H +F D+G+L I + T  + 
Sbjct: 247 GDKDVYALVLLNNVLGGSMSSRLFQDIREKRGLCYSVFSYHSSFRDSGMLTIYAGTGHDQ 306

Query: 308 IMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +  L  SI E   +L E  + ++E++    ++   L+ S E +  R     K  +     
Sbjct: 307 LDDLVYSIQETTSALAEKGLTEKELENGKEQLKGSLMLSLESTNSRMSRNGKNELLLKKH 366

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
              +++I+ I+A+  +D+  +AK + S++P+++++   
Sbjct: 367 RSLDEMIEQINAVQKQDVSRLAKILLSASPSISLINAN 404


>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* Length = 475 Back     alignment and structure
>1pp9_B Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron sulfur protein, cytochrome B; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* 1bcc_B* ... Length = 439 Back     alignment and structure
>3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* Length = 431 Back     alignment and structure
>1pp9_A Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron sulfur protein, cytochrome B; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* 3bcc_A* ... Length = 446 Back     alignment and structure
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Length = 939 Back     alignment and structure
>1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* Length = 443 Back     alignment and structure
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 2wby_A 2wc0_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A Length = 990 Back     alignment and structure
>3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* Length = 352 Back     alignment and structure
>3d3y_A Uncharacterized protein; APC29635, conserved protein, structural genomics, PSI-2, protein structure initiative; 1.95A {Enterococcus faecalis V583} Length = 425 Back     alignment and structure
>3go9_A Insulinase family protease; IDP00573, structural genomics, center for structural genomics of infectious diseases, csgid, hydrolase; HET: MSE; 1.62A {Yersinia pestis} Length = 492 Back     alignment and structure
>3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Length = 406 Back     alignment and structure
>3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2; 1.90A {Pseudomonas fluorescens pf-5} Length = 434 Back     alignment and structure
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Length = 939 Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Length = 995 Back     alignment and structure
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 2wby_A 2wc0_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A Length = 990 Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Length = 995 Back     alignment and structure
>3ih6_A Putative zinc protease; bordetella pertussis tohama I, structural genomics, PSI-2, protein structure initiative; 2.15A {Bordetella pertussis} Length = 197 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target424 M16 family peptidase [Candidatus Liberibacter asiaticus
1hr6_A475 Alpha-MPP, mitochondrial processing peptidase alpha sub 100.0
1pp9_A446 Ubiquinol-cytochrome C reductase complex core protein I 100.0
1pp9_B439 Ubiquinol-cytochrome C reductase complex core protein 2 100.0
1hr6_B443 Beta-MPP, mitochondrial processing peptidase beta subun 100.0
3hdi_A421 Processing protease; CAGE structure, M16B peptidase, me 100.0
3cx5_A431 Cytochrome B-C1 complex subunit 1, mitochondrial; compl 100.0
3eoq_A406 Putative zinc protease; two similar domains of beta(2)- 100.0
3gwb_A434 Peptidase M16 inactive domain family protein; peptidase 100.0
3d3y_A425 Uncharacterized protein; APC29635, conserved protein, s 100.0
3go9_A492 Insulinase family protease; IDP00573, structural genomi 100.0
3cww_A 990 Insulysin, insulin-degrading enzyme, insulinase; A-beta 100.0
1q2l_A 939 Protease III; hydrolase; 2.20A {Escherichia coli str} S 100.0
3cx5_B352 Cytochrome B-C1 complex subunit 2, mitochondrial; compl 100.0
2fge_A 995 Atprep2;, zinc metalloprotease (insulinase family); pep 100.0
2fge_A995 Atprep2;, zinc metalloprotease (insulinase family); pep 100.0
3cww_A990 Insulysin, insulin-degrading enzyme, insulinase; A-beta 100.0
1q2l_A939 Protease III; hydrolase; 2.20A {Escherichia coli str} S 100.0
3ih6_A197 Putative zinc protease; bordetella pertussis tohama I, 99.95
1pp9_A 446 Ubiquinol-cytochrome C reductase complex core protein I 98.5
1hr6_B 443 Beta-MPP, mitochondrial processing peptidase beta subun 98.43
3hdi_A 421 Processing protease; CAGE structure, M16B peptidase, me 98.31
3gwb_A 434 Peptidase M16 inactive domain family protein; peptidase 98.27
3cx5_B 352 Cytochrome B-C1 complex subunit 2, mitochondrial; compl 98.24
1pp9_B 439 Ubiquinol-cytochrome C reductase complex core protein 2 98.19
3d3y_A 425 Uncharacterized protein; APC29635, conserved protein, s 98.17
1hr6_A475 Alpha-MPP, mitochondrial processing peptidase alpha sub 98.38
3cx5_A 431 Cytochrome B-C1 complex subunit 1, mitochondrial; compl 98.25
3eoq_A 406 Putative zinc protease; two similar domains of beta(2)- 98.04
3ih6_A197 Putative zinc protease; bordetella pertussis tohama I, 98.05
3go9_A492 Insulinase family protease; IDP00573, structural genomi 97.29
>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=567.56  Aligned_cols=415  Identities=21%  Similarity=0.328  Sum_probs=382.3

Q ss_pred             CEEEEECCCCCEEEEECCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCEEEEEECC
Q ss_conf             61899879871999985899879999998331144888898348999989733568889889999999708767997532
Q gi|254780464|r    2 NLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSL   81 (424)
Q Consensus         2 ~~~~~~L~NGl~v~~~~~~~~~~~i~~~~~~Gs~~e~~~~~G~ah~lehl~~~gt~~~~~~~~~~~l~~~G~~~na~t~~   81 (424)
                      +++++||+||+||++++.+.|.+++++++++||++|++++.|+||++|||+|+||++++..++.+.++.+|+.+||+|++
T Consensus         5 ~~~~~~L~NGl~V~~~~~~~~~~~~~l~v~~Gs~~E~~~~~G~ahlleh~~f~GT~~~~~~~l~~~l~~~G~~~na~t~~   84 (475)
T 1hr6_A            5 NFKLSSLANGLKVATSNTPGHFSALGLYIDAGSRFEGRNLKGCTHILDRLAFKSTEHVEGRAMAETLELLGGNYQCTSSR   84 (475)
T ss_dssp             CCEEEECTTSCEEEEESCCCSSEEEEEEESCCGGGCTTTTTTHHHHHHHTTTSCBTTBCHHHHHHHHHHTTSCEEEEECS
T ss_pred             CEEEEECCCCCEEEEEECCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCEEEEEECC
T ss_conf             73799989999899997899989999997400278897986399999999738999999999999999829989999863


Q ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCCCCCCHHH
Q ss_conf             23799961266565210012223221035662001124556766665113321110000001222222222222221034
Q gi|254780464|r   82 EHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPE  161 (424)
Q Consensus        82 d~~~~~~~~~~~~~~~~l~ll~~~~~~p~~~~~~~~~ek~~v~~e~~~~~~~p~~~~~~~~~~~~f~~~~~~~~~~g~~~  161 (424)
                      |+|+|++++++++++.+|+++++++.+|.|++++|+++|+++++|+++..++|...+.+.+.+.+|+++||+++++|+.+
T Consensus        85 d~t~y~~~~~~~~l~~~l~ll~d~~~~p~~~~~~~~~ek~~v~~e~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~g~~~  164 (475)
T 1hr6_A           85 ENLMYQASVFNQDVGKMLQLMSETVRFPKITEQELQEQKLSAEYEIDEVWMKPELVLPELLHTAAYSGETLGSPLICPRG  164 (475)
T ss_dssp             SCEEEEEEECGGGHHHHHHHHHHHHHCBCCCHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTTSGGGSCSSCCGG
T ss_pred             CEEEEEEEECHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHH
T ss_conf             72999999778999999999999975888788999999999999988774184878999988887337876788878988


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEE------ECCCCCC
Q ss_conf             4200016677642011245663000002545512211221101235877778866422332210233------0368432
Q gi|254780464|r  162 TISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYI------QKRDLAE  235 (424)
Q Consensus       162 ~i~~lt~~~l~~f~~~~y~p~n~~l~i~Gd~~~~~~~~~i~~~f~~~~~~~~~~~~~p~~~~~~~~~------~~~~~~~  235 (424)
                      +|++++.++|++||++||+|+|++|+| |++++++++++++++||+|+....+....+..+.+++..      ...+..+
T Consensus       165 ~i~~it~~~l~~~~~~~y~p~n~~lvi-~~~~~~~~~~li~~~fg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  243 (475)
T 1hr6_A          165 LIPSISKYYLLDYRNKFYTPENTVAAF-VGVPHEKALELTGKYLGDWQSTHPPITKKVAQYTGGESCIPPAPVFGNLPEL  243 (475)
T ss_dssp             GGGGCCHHHHHHHHHHHCCGGGEEEEE-ESSCHHHHHHHHHHHHTTCCCCCCCCCCCCCCCCCEEEEECCCCCCSSSCCC
T ss_pred             HHCCCCHHHHHHHHHHHCCCCCCCEEC-CCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             707899999999987403875320004-6677999999999983447667888776654346875444320024676030


Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHCC-----------CCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             102301000013521135689987776248-----------765322220002686210133322210122013444258
Q gi|254780464|r  236 EHMMLGFNGCAYQSRDFYLTNILASILGDG-----------MSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA  304 (424)
Q Consensus       236 ~~i~~~~~~~~~~~~d~~al~ll~~iLg~g-----------~sSrL~~~lRe~~glaY~v~s~~~~~~~~g~~~i~~~~~  304 (424)
                      +++.++|+++++.++|++++.+++.+||++           ++|||++++|+++|++|++++++..+.+.|+|++++.|.
T Consensus       244 ~~v~~~~~~~~~~~~d~~~l~vl~~iLgg~~s~~~~~~~~g~~srL~~~lre~~gl~ys~~s~~~~~~~~g~f~i~~~~~  323 (475)
T 1hr6_A          244 FHIQIGFEGLPIDHPDIYALATLQTLLGGGGSFSAGGPGKGMYSRLYTHVLNQYYFVENCVAFNHSYSDSGIFGISLSCI  323 (475)
T ss_dssp             EEEEEEEECCCTTCTTHHHHHHHHHHHCEEESSCCSSTTSCTTSHHHHHTTTTCSSEEEEEEEEEECSSCEEEEEEEEEC
T ss_pred             EEEEEEECCCCCCCCHHHHHHHHHHHHCCCCHHHHHCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEEC
T ss_conf             35676304565344008999999998668720212013331125999976651474125776303446776346567656


Q ss_pred             CCHHHHHHHHHHHHHHHHC----CCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCC
Q ss_conf             3024777877899998531----489989999999999999985138989999999999996898479899999887279
Q gi|254780464|r  305 KENIMALTSSIVEVVQSLL----ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAIT  380 (424)
Q Consensus       305 ~~~~~~~~~~i~~~i~~l~----~~i~~~el~~ak~~~~~~~~~~~~~~~~~a~~l~~~~~~~~~~~~~~~~~~~i~~vt  380 (424)
                      |++..++++.+.+++.++.    .+++++||++||+.++.++..+.|++..++..++++++.++++.+++++.+.|++||
T Consensus       324 ~~~~~~~v~~i~~el~~~~~~~~~~it~~eL~raK~~l~~~~~~~~e~~~~~~~~i~~~~l~~~~~~~~~~~~~~i~~VT  403 (475)
T 1hr6_A          324 PQAAPQAVEVIAQQMYNTFANKDLRLTEDEVSRAKNQLKSSLLMNLESKLVELEDMGRQVLMHGRKIPVNEMISKIEDLK  403 (475)
T ss_dssp             GGGHHHHHHHHHHHHHTTTTCTTSCCCHHHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHHHSCCCCHHHHHHHHHTCC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCC
T ss_conf             77589999999999999998477899899999999999999998658999999999999996799899999999997879


Q ss_pred             HHHHHHHHHHHCCC----------CCEEEEEECCCCCCCCHHHHHHHH
Q ss_conf             89999999986277----------877999816601089989999988
Q gi|254780464|r  381 CEDIVGVAKKIFSS----------TPTLAILGPPMDHVPTTSELIHAL  418 (424)
Q Consensus       381 ~~di~~~~~~~l~~----------~~~i~~vgp~~~~~P~~~~l~~~l  418 (424)
                      ++||++++++||.+          +++++++| +...+|+.+++....
T Consensus       404 ~~dv~~~a~~~~~~~~~~~~~g~~~~t~~~~g-~~~~~~~~~~~~~~~  450 (475)
T 1hr6_A          404 PDDISRVAEMIFTGNVNNAGNGKGRATVVMQG-DRGSFGDVENVLKAY  450 (475)
T ss_dssp             HHHHHHHHHHHHTTCCCCTTCCCCCCEEEEES-CGGGGCCHHHHHHHT
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCEEEEEC-CCCCCCCHHHHHHHH
T ss_conf             99999999997278973888438874399955-512240499999983



>1pp9_A Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron sulfur protein, cytochrome B; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* 3bcc_A* ... Back     alignment and structure
>1pp9_B Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron sulfur protein, cytochrome B; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* 1bcc_B* ... Back     alignment and structure
>1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* Back     alignment and structure
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Back     alignment and structure
>3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* Back     alignment and structure
>3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Back     alignment and structure
>3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2; 1.90A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3d3y_A Uncharacterized protein; APC29635, conserved protein, structural genomics, PSI-2, protein structure initiative; 1.95A {Enterococcus faecalis V583} Back     alignment and structure
>3go9_A Insulinase family protease; IDP00573, structural genomics, center for structural genomics of infectious diseases, csgid, hydrolase; HET: MSE; 1.62A {Yersinia pestis} Back     alignment and structure
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 2wby_A 2wc0_A 3h44_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A Back     alignment and structure
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 2wby_A 2wc0_A 3h44_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A Back     alignment and structure
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>3ih6_A Putative zinc protease; bordetella pertussis tohama I, structural genomics, PSI-2, protein structure initiative; 2.15A {Bordetella pertussis} PDB: 3ivl_A Back     alignment and structure
>1pp9_A Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron sulfur protein, cytochrome B; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* 3bcc_A* ... Back     alignment and structure
>1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* Back     alignment and structure
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Back     alignment and structure
>3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2; 1.90A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* Back     alignment and structure
>1pp9_B Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron sulfur protein, cytochrome B; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* 1bcc_B* ... Back     alignment and structure
>3d3y_A Uncharacterized protein; APC29635, conserved protein, structural genomics, PSI-2, protein structure initiative; 1.95A {Enterococcus faecalis V583} Back     alignment and structure
>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* Back     alignment and structure
>3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* Back     alignment and structure
>3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Back     alignment and structure
>3ih6_A Putative zinc protease; bordetella pertussis tohama I, structural genomics, PSI-2, protein structure initiative; 2.15A {Bordetella pertussis} PDB: 3ivl_A Back     alignment and structure
>3go9_A Insulinase family protease; IDP00573, structural genomics, center for structural genomics of infectious diseases, csgid, hydrolase; HET: MSE; 1.62A {Yersinia pestis} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 424 M16 family peptidase [Candidatus Liberibacter asiaticus
d1ppjb2204 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Co 1e-29
d1hr6b2217 d.185.1.1 (B:246-462) Mitochondrial processing peptidas 4e-27
d1ppja2209 d.185.1.1 (A:234-442) Cytochrome bc1 core subunit 1 {Co 2e-24
d3cx5a2218 d.185.1.1 (A:240-457) Cytochrome bc1 core subunit 1 {Ba 3e-24
d1hr6a2237 d.185.1.1 (A:234-470) Mitochondrial processing peptidas 3e-24
d3cx5b2150 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Ba 5e-10
d2fgea2196 d.185.1.1 (A:798-993) Presequence protease 1, PREP1 {Th 2e-08
d1ppja1232 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow 2e-26
d1ppjb1219 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow 3e-26
d2fgea4257 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 {Tha 3e-26
d3cx5b1202 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Bak 4e-25
d1hr6a1220 d.185.1.1 (A:14-233) Mitochondrial processing peptidase 3e-24
d1hr6b1222 d.185.1.1 (B:24-245) Mitochondrial processing peptidase 2e-23
d3cx5a1213 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Bak 6e-23
d1q2la4240 d.185.1.1 (A:24-263) Protease III {Escherichia coli [Ta 4e-19
d1q2la2228 d.185.1.1 (A:733-960) Protease III {Escherichia coli [T 8e-09
>d1ppjb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: LuxS/MPP-like metallohydrolase
superfamily: LuxS/MPP-like metallohydrolase
family: MPP-like
domain: Cytochrome bc1 core subunit 2
species: Cow (Bos taurus) [TaxId: 9913]
 Score =  125 bits (313), Expect = 1e-29
 Identities = 46/204 (22%), Positives = 84/204 (41%), Gaps = 10/204 (4%)

Query: 220 AVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDG--------MSSRLF 271
           A Y GGE  ++   +  H  L     A  S +    ++L  +LG G         +S L+
Sbjct: 2   AKYHGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLY 61

Query: 272 QEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIV-EVVQSLLENIEQRE 330
           Q V +     + +SA + ++SD+G+    + +   +   +  +   +V      N+   +
Sbjct: 62  QAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPD 121

Query: 331 IDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK 390
           +     K+ A  + S E S     E+  Q +  GS      ++  I A+   D++  AKK
Sbjct: 122 VQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKK 181

Query: 391 IFSSTPTLAILGPPMDHVPTTSEL 414
             S   ++A  G  + H P   EL
Sbjct: 182 FVSGRKSMAASG-NLGHTPFIDEL 204


>d1hr6b2 d.185.1.1 (B:246-462) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Back     information, alignment and structure
>d1ppja2 d.185.1.1 (A:234-442) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 209 Back     information, alignment and structure
>d3cx5a2 d.185.1.1 (A:240-457) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 Back     information, alignment and structure
>d1hr6a2 d.185.1.1 (A:234-470) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d3cx5b2 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 150 Back     information, alignment and structure
>d2fgea2 d.185.1.1 (A:798-993) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 196 Back     information, alignment and structure
>d1ppja1 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1ppjb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 219 Back     information, alignment and structure