254780484

254780484

GTPase EngB

GeneID in NCBI database:8209473Locus tag:CLIBASIA_01845
Protein GI in NCBI database:254780484Protein Accession:YP_003064897.1
Gene range:+(405517, 406155)Protein Length:212aa
Gene description:GTPase EngB
COG prediction:[R] Predicted GTPase
KEGG prediction:engB; GTPase EngB; K03978 GTP-binding protein
SEED prediction:GTP-binding protein EngB
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Universal GTPases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY
ccccHHHHccccHHHcccccHHHcccccccEEEEEEcccccHHHHHHHHHcccccEEEccccccccccccEEEccccEEcccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHcEEEEEccccccccHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHccc
cccHHcccccccEEEEccccccccccccccEEEEcccccccHHHHHHHHHccHccccccccccccEEEEEEEEccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHcc
mvshtiftKSAWIFLrgvpeigllpkagppeiafsgrsnvgksSLINILVNrknlartsnapgrtqhlnffvpkdfsnlknnlpamalvdmpgygyarapkknvdswGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKidklspttAQETLEKTKYLIRnyptahpeviptssvkrKGIEVLRKAILETINY
mvshtiftksawifLRGVPEIGLLPKAGPPEIAfsgrsnvgksSLINILVNRKNLartsnapgrtqhLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVltkidklspttaqETLEKTKYLIRnyptahpeviptssvkrkgieVLRKAILETINY
MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY
*******TKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTT******KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY
MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY
****TIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY
MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY
MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target212 GTPase EngB [Candidatus Liberibacter asiaticus str. psy
255764471 470 GTP-binding protein EngA [Candidatus Liberibacter 1e-05
254780941 311 GTP-binding protein Era [Candidatus Liberibacter a 0.001
254780809440 tRNA modification GTPase TrmE [Candidatus Liberiba 0.025
>gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Back     alignment
 Score = 41.6 bits (96), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 60/134 (44%), Gaps = 21/134 (15%)

Query: 32  IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDM 91
           IA  G  NVGKS+L N LV +K +A   N PG T+       + +     N     +VD 
Sbjct: 5   IAIVGAPNVGKSTLFNRLVKKK-MAVVGNHPGITRD------RLYGQAIINGVIFNIVDT 57

Query: 92  PGYGYARAPKKNVDSWGGLIVRYLSERSTL-----RCVYLLIDCRHGVKQIDQDVFSFLD 146
            G     A  KN       I + +++++ L       +  LID + G+   D  + SFL 
Sbjct: 58  AGI----ADGKNCS-----IAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLR 108

Query: 147 KKAVSYQIVLTKID 160
           KK +   IV  K+D
Sbjct: 109 KKNIPIIIVSNKMD 122

>gi|254780941|ref|YP_003065354.1| GTP-binding protein Era [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Back     alignment
 Score = 34.7 bits (78), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 65/150 (43%), Gaps = 18/150 (12%)

Query: 32  IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDM 91
           +A  G +N GKS+L+N  V     A+ S    + Q     V    S  ++ +     +D 
Sbjct: 25  VALVGATNAGKSTLVNRFVG----AKVSIVTHKVQTTRSIVRGIVSEKESQI---VFLDT 77

Query: 92  PGYGYARAPKKNVDSWGGLIVRYLSERSTLR---CVYLLIDCRHGVKQIDQDVFSFLDKK 148
           PG   A+      DS+  L++R     ST++    V L++D    +K    D+   + K+
Sbjct: 78  PGIFNAK------DSYHKLMIRL--SWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKR 129

Query: 149 AVSYQIVLTKIDKLSPTTAQETLEKTKYLI 178
           +    ++L KID + P    E  E    L+
Sbjct: 130 SSRLILILNKIDCVKPERLLEQAEIANKLV 159

>gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Back     alignment
 Score = 30.4 bits (67), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 32  IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ 66
           I   G SN GKSSL N L  +K++A  ++ PG T+
Sbjct: 222 IVILGHSNAGKSSLFNALA-KKDVAIVTDIPGTTR 255

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target212 GTPase EngB [Candidatus Liberibacter asiaticus str. psy
315122060192 GTPase EngB [Candidatus Liberibacter solanacearum CLso- 1 4e-82
163868926214 ribosome biogenesis GTP-binding protein YsxC [Bartonell 1 5e-64
222147368219 ribosome biogenesis GTP-binding protein YsxC [Agrobacte 1 1e-63
240850502214 GTP-ase EngB [Bartonella grahamii as4aup] Length = 214 1 1e-63
150395306217 ribosome biogenesis GTP-binding protein YsxC [Sinorhizo 1 3e-63
13474032212 ribosome biogenesis GTP-binding protein YsxC [Mesorhizo 1 3e-63
110632739225 GTPase EngB [Mesorhizobium sp. BNC1] Length = 225 1 3e-63
15964196217 GTPase EngB [Sinorhizobium meliloti 1021] Length = 217 1 3e-63
15887733217 GTPase EngB [Agrobacterium tumefaciens str. C58] Length 1 1e-62
325291816217 ribosome biogenesis GTP-binding protein YsxC [Agrobacte 1 1e-62
>gi|315122060|ref|YP_004062549.1| GTPase EngB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 192 Back     alignment and organism information
 Score =  308 bits (788), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%)

Query: 23  LLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN 82
           LLP+ GPPEIAFSGRSNVGKSSLIN+L+NRKNLARTSN+PGRTQ +NFF+P D S  K+N
Sbjct: 3   LLPEEGPPEIAFSGRSNVGKSSLINMLLNRKNLARTSNSPGRTQEINFFIPSDCSGRKDN 62

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
           LP M LVDMPGYGYA+APKKNV +WG L+VRYL ERSTLRCVYLLIDCRHG+K+IDQDVF
Sbjct: 63  LPTMTLVDMPGYGYAKAPKKNVAAWGNLVVRYLRERSTLRCVYLLIDCRHGIKKIDQDVF 122

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           + LDK+AVSYQ++LTK DKLSP  AQE LE TK L++N+P AH +VI TSS+K  GIE+L
Sbjct: 123 ALLDKEAVSYQVILTKADKLSPAMAQEKLENTKSLLQNHPAAHSDVILTSSIKGNGIEML 182

Query: 203 RKAILETINY 212
           RK+ILETI Y
Sbjct: 183 RKSILETIIY 192


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163868926|ref|YP_001610153.1| ribosome biogenesis GTP-binding protein YsxC [Bartonella tribocorum CIP 105476] Length = 214 Back     alignment and organism information
>gi|222147368|ref|YP_002548325.1| ribosome biogenesis GTP-binding protein YsxC [Agrobacterium vitis S4] Length = 219 Back     alignment and organism information
>gi|240850502|ref|YP_002971901.1| GTP-ase EngB [Bartonella grahamii as4aup] Length = 214 Back     alignment and organism information
>gi|150395306|ref|YP_001325773.1| ribosome biogenesis GTP-binding protein YsxC [Sinorhizobium medicae WSM419] Length = 217 Back     alignment and organism information
>gi|13474032|ref|NP_105600.1| ribosome biogenesis GTP-binding protein YsxC [Mesorhizobium loti MAFF303099] Length = 212 Back     alignment and organism information
>gi|110632739|ref|YP_672947.1| GTPase EngB [Mesorhizobium sp. BNC1] Length = 225 Back     alignment and organism information
>gi|15964196|ref|NP_384549.1| GTPase EngB [Sinorhizobium meliloti 1021] Length = 217 Back     alignment and organism information
>gi|15887733|ref|NP_353414.1| GTPase EngB [Agrobacterium tumefaciens str. C58] Length = 217 Back     alignment and organism information
>gi|325291816|ref|YP_004277680.1| ribosome biogenesis GTP-binding protein YsxC [Agrobacterium sp. H13-3] Length = 217 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target212 GTPase EngB [Candidatus Liberibacter asiaticus str. psy
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 8e-69
TIGR03598179 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding 2e-62
COG0218200 COG0218, COG0218, Predicted GTPase [General function pr 3e-57
KOG2486320 KOG2486, KOG2486, KOG2486, Predicted GTPase [General fu 2e-25
cd00880163 cd00880, Era_like, Era (E 6e-15
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provisional 1e-11
PRK00089 292 PRK00089, era, GTPase Era; Reviewed 1e-10
COG1159 298 COG1159, Era, GTPase [General function prediction only] 7e-09
COG0486454 COG0486, ThdF, Predicted GTPase [General function predi 1e-08
COG1160 444 COG1160, COG1160, Predicted GTPases [General function p 3e-08
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 7e-08
cd04163168 cd04163, Era, Era subfamily 8e-08
cd01881176 cd01881, Obg_like, The Obg-like subfamily consists of f 4e-06
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 4e-06
cd04164157 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain pr 2e-05
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase Trm 4e-05
cd01895174 cd01895, EngA2, EngA2 subfamily 5e-05
COG3276 447 COG3276, SelB, Selenocysteine-specific translation elon 5e-04
KOG1489366 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protei 9e-04
COG0536369 COG0536, Obg, Predicted GTPase [General function predic 0.001
KOG1191531 KOG1191, KOG1191, KOG1191, Mitochondrial GTPase [Transl 0.002
COG2262411 COG2262, HflX, GTPases [General function prediction onl 0.003
COG0532 509 COG0532, InfB, Translation initiation factor 2 (IF-2; G 0.004
cd01876170 cd01876, YihA_EngB, The YihA (EngB) subfamily 2e-58
pfam01926106 pfam01926, MMR_HSR1, GTPase of unknown function 6e-14
COG1161322 COG1161, COG1161, Predicted GTPases [General function p 7e-06
cd01857141 cd01857, HSR1_MMR1, HSR1/MMR1 2e-05
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding 8e-05
KOG1424562 KOG1424, KOG1424, KOG1424, Predicted GTP-binding protei 1e-04
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 1e-04
cd01856171 cd01856, YlqF, YlqF 3e-04
cd01894157 cd01894, EngA1, EngA1 subfamily 9e-04
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 0.001
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Reviewed 0.001
PRK09518712 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPa 6e-05
PRK03003472 PRK03003, PRK03003, GTP-binding protein Der; Reviewed 0.003
cd04171164 cd04171, SelB, SelB subfamily 2e-04
cd01898170 cd01898, Obg, Obg subfamily 3e-04
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 0.004
cd01878204 cd01878, HflX, HflX subfamily 0.003
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 0.003
cd00881189 cd00881, GTP_translation_factor, GTP translation factor 0.003
>gnl|CDD|179035 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|163346 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|30567 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|37697 KOG2486, KOG2486, KOG2486, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133256 cd00880, Era_like, Era (E Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|30833 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133363 cd04163, Era, Era subfamily Back     alignment and domain information
>gnl|CDD|133281 cd01881, Obg_like, The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|133364 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>gnl|CDD|161885 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|133295 cd01895, EngA2, EngA2 subfamily Back     alignment and domain information
>gnl|CDD|33087 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36702 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|30882 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|36405 KOG1191, KOG1191, KOG1191, Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|32443 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|30878 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133278 cd01876, YihA_EngB, The YihA (EngB) subfamily Back     alignment and domain information
>gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function Back     alignment and domain information
>gnl|CDD|31355 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|57928 cd01857, HSR1_MMR1, HSR1/MMR1 Back     alignment and domain information
>gnl|CDD|163345 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|36638 KOG1424, KOG1424, KOG1424, Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>gnl|CDD|181957 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|57927 cd01856, YlqF, YlqF Back     alignment and domain information
>gnl|CDD|133294 cd01894, EngA1, EngA1 subfamily Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|181925 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|133371 cd04171, SelB, SelB subfamily Back     alignment and domain information
>gnl|CDD|133298 cd01898, Obg, Obg subfamily Back     alignment and domain information
>gnl|CDD|163162 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|133279 cd01878, HflX, HflX subfamily Back     alignment and domain information
>gnl|CDD|183417 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|133257 cd00881, GTP_translation_factor, GTP translation factor family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 212 GTPase EngB [Candidatus Liberibacter asiaticus str. psy
PRK00454196 engB GTPase EngB; Reviewed 100.0
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 100.0
COG0218200 Predicted GTPase [General function prediction only] 100.0
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 100.0
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 100.0
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 100.0
PRK03003 474 engA GTP-binding protein EngA; Reviewed 99.98
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 99.98
PRK00089 296 era GTP-binding protein Era; Reviewed 99.97
PRK00093438 engA GTP-binding protein EngA; Reviewed 99.97
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 99.97
COG1160 444 Predicted GTPases [General function prediction only] 99.97
PRK03003474 engA GTP-binding protein EngA; Reviewed 99.97
PRK00093 438 engA GTP-binding protein EngA; Reviewed 99.97
PRK04213195 GTP-binding protein; Provisional 99.97
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.97
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 99.97
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 99.97
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 99.97
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 99.97
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 99.96
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 99.96
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 99.96
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 99.96
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 99.96
COG1159 298 Era GTPase [General function prediction only] 99.96
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 99.96
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 99.95
COG1160444 Predicted GTPases [General function prediction only] 99.95
COG0486454 ThdF Predicted GTPase [General function prediction only 99.95
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 99.95
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 99.94
cd01896233 DRG The developmentally regulated GTP-binding protein ( 99.94
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 99.94
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein family 99.94
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 99.93
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.93
cd00881189 GTP_translation_factor GTP translation factor family. T 99.92
PRK11058426 putative GTPase HflX; Provisional 99.92
PRK12299334 obgE GTPase ObgE; Reviewed 99.91
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic ion tra 99.91
PRK12298380 obgE GTPase ObgE; Reviewed 99.91
COG1084346 Predicted GTPase [General function prediction only] 99.9
COG2262411 HflX GTPases [General function prediction only] 99.9
KOG1191531 consensus 99.88
PRK12296 495 obgE GTPase ObgE; Reviewed 99.88
PRK12312 610 infB translation initiation factor IF-2; Provisional 99.87
PRK12297429 obgE GTPase ObgE; Reviewed 99.86
KOG1423 379 consensus 99.86
CHL00189 770 infB translation initiation factor 2; Provisional 99.86
PRK05306 839 infB translation initiation factor IF-2; Validated 99.84
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 99.83
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 99.83
PRK04004 592 translation initiation factor IF-2; Validated 99.83
COG0536369 Obg Predicted GTPase [General function prediction only] 99.82
TIGR00475 627 selB selenocysteine-specific translation elongation fac 99.82
KOG1489366 consensus 99.81
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 99.8
COG1163365 DRG Predicted GTPase [General function prediction only] 99.8
PRK10512 615 selenocysteinyl-tRNA-specific translation factor; Provi 99.8
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 99.8
KOG2486320 consensus 99.79
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase) [Tr 99.79
KOG1145 683 consensus 99.75
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 99.74
PRK04000 410 translation initiation factor IF-2 subunit gamma; Valid 99.73
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 99.73
TIGR01393 598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 99.73
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 99.73
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 99.73
KOG1490 620 consensus 99.73
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 99.72
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 99.71
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 99.7
PTZ00327 460 eukaryotic translation initiation factor 2 gamma subuni 99.69
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 99.66
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 99.66
KOG0462 650 consensus 99.65
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primari 99.64
PRK12317 426 elongation factor 1-alpha; Reviewed 99.63
COG3596296 Predicted GTPase [General function prediction only] 99.63
PRK12736 394 elongation factor Tu; Reviewed 99.63
PRK12735 396 elongation factor Tu; Reviewed 99.62
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 99.62
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) protein 99.62
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 99.62
KOG0410410 consensus 99.62
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 99.62
PRK00049 397 elongation factor Tu; Reviewed 99.62
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 99.62
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 99.62
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 99.61
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 99.61
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 99.6
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 99.6
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 99.6
PRK05433 601 GTP-binding protein LepA; Provisional 99.6
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 99.59
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 99.59
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 99.59
PTZ00132209 GTP-binding nuclear protein; Provisional 99.58
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily consists 99.58
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, t 99.58
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 99.58
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 99.58
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 99.58
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 99.58
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein on ch 99.58
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 99.57
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 99.57
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 99.57
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 99.57
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ra 99.57
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 99.57
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap s 99.57
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.57
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subfamily 99.57
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 99.57
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 99.57
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 99.57
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 99.56
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 99.56
cd04123162 Rab21 Rab21 subfamily. The localization and function of 99.56
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 99.56
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 99.55
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 99.55
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 99.55
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 99.55
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 99.55
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 99.55
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 99.55
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Ra 99.55
PTZ00141 443 elongation factor 1 alpha; Provisional 99.55
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from other Rab 99.55
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 99.55
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab prot 99.55
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 99.55
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 99.55
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 99.54
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 99.54
PTZ00133182 ADP-ribosylation factor; Provisional 99.54
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 99.54
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 99.54
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-li 99.54
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 99.54
CHL00071 409 tufA elongation factor Tu 99.54
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 99.54
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 99.54
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab prot 99.53
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 99.53
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase that re 99.53
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in many p 99.53
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 99.53
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member of th 99.53
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 99.53
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related protein fr 99.53
cd00157171 Rho Rho (Ras homology) family. Members of the Rho famil 99.52
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 99.52
TIGR01394 609 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298 99.51
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small GTPa 99.51
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfamily 99.51
PTZ00336 449 elongation factor 1-alpha; Provisional 99.5
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) protein 99.5
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 99.49
PRK05506 613 bifunctional sulfate adenylyltransferase subunit 1/aden 99.49
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 99.49
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiqui 99.49
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 99.49
PRK10218 607 GTP-binding protein; Provisional 99.48
PRK05124 475 cysN sulfate adenylyltransferase subunit 1; Provisional 99.48
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) 99.48
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (alpha, 99.48
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 99.47
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 99.47
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras- 99.46
cd04109215 Rab28 Rab28 subfamily. First identified in maize, Rab28 99.46
COG3276 447 SelB Selenocysteine-specific translation elongation fac 99.45
COG5257 415 GCD11 Translation initiation factor 2, gamma subunit (e 99.45
cd04143247 Rhes_like Rhes_like subfamily. This subfamily includes 99.45
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 99.45
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 99.44
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPase tha 99.44
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that plays 99.4
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 99.4
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesis, ou 99.4
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPase) [ 99.4
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1/Rho6 99.39
pfam05049 375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 99.39
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 99.38
KOG0394210 consensus 99.37
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of 99.36
KOG0092200 consensus 99.36
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a member of 99.35
COG1217 603 TypA Predicted membrane GTPase involved in stress respo 99.34
KOG1144 1064 consensus 99.32
KOG0461 522 consensus 99.3
PRK13768253 GTPase; Provisional 99.29
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 99.26
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 99.23
KOG0094221 consensus 99.22
COG1100219 GTPase SAR1 and related small G proteins [General funct 99.22
KOG0078207 consensus 99.21
pfam04548200 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to b 99.2
COG2229187 Predicted GTPase [General function prediction only] 99.2
TIGR00436 278 era GTP-binding protein Era; InterPro: IPR005662 Era is 99.18
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB subfamil 99.17
TIGR00487 594 IF-2 translation initiation factor IF-2; InterPro: IPR0 99.16
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represents Ara 99.13
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 99.12
cd04105203 SR_beta Signal recognition particle receptor, beta subu 99.11
COG4917148 EutP Ethanolamine utilization protein [Amino acid trans 99.06
TIGR00231186 small_GTP small GTP-binding protein domain; InterPro: I 99.05
COG2895 431 CysN GTPases - Sulfate adenylate transferase subunit 1 99.03
KOG0098216 consensus 99.03
COG0050 394 TufB GTPases - translation elongation factors [Translat 99.03
KOG1487358 consensus 99.03
KOG1486364 consensus 99.02
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 99.02
KOG0084205 consensus 99.02
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 98.98
COG5258 527 GTPBP1 GTPase [General function prediction only] 98.97
KOG0395196 consensus 98.95
KOG0080209 consensus 98.95
KOG0075186 consensus 98.92
KOG0458 603 consensus 98.91
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 98.9
KOG0448 749 consensus 98.89
KOG0087222 consensus 98.89
TIGR00483 445 EF-1_alpha translation elongation factor EF-1, subunit 98.85
KOG0467 887 consensus 98.79
KOG0073185 consensus 98.79
COG5019 373 CDC3 Septin family protein [Cell division and chromosom 98.79
KOG0095213 consensus 98.75
KOG0090238 consensus 98.69
KOG1532 366 consensus 98.68
KOG0466 466 consensus 98.67
KOG0076197 consensus 98.63
KOG0079198 consensus 98.6
KOG0093193 consensus 98.6
KOG0091213 consensus 98.6
pfam04670230 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 wa 98.56
KOG0460 449 consensus 98.48
KOG1143 591 consensus 98.36
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 98.35
KOG0088218 consensus 98.35
KOG0081219 consensus 98.31
KOG1707 625 consensus 98.28
KOG0070181 consensus 98.27
KOG0463 641 consensus 98.24
KOG0086214 consensus 98.22
KOG0097215 consensus 98.22
KOG0468 971 consensus 98.19
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 98.17
KOG4252246 consensus 98.14
TIGR00485 394 EF-Tu translation elongation factor Tu; InterPro: IPR00 97.83
KOG0083192 consensus 97.7
KOG0077193 consensus 97.64
KOG0447 980 consensus 97.62
KOG0071180 consensus 97.55
KOG0393198 consensus 97.54
COG0523 323 Putative GTPases (G3E family) [General function predict 97.46
KOG3883198 consensus 97.46
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.2
KOG3886 295 consensus 97.09
KOG0074185 consensus 96.94
KOG0459 501 consensus 96.91
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 99.91
TIGR00491 1145 aIF-2 translation initiation factor aIF-2; InterPro: IP 99.44
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.42
TIGR02034 411 CysN sulfate adenylyltransferase, large subunit; InterP 99.09
TIGR00450473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 99.9
TIGR02729296 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014 99.78
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 99.53
pfam01926106 MMR_HSR1 GTPase of unknown function. 99.5
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.5
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 99.49
PRK12739 693 elongation factor G; Reviewed 99.49
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 99.49
PRK13351 687 elongation factor G; Reviewed 99.48
PRK00007 693 elongation factor G; Reviewed 99.43
PRK12740 670 elongation factor G; Reviewed 99.31
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 99.02
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 99.02
PRK07560 730 elongation factor EF-2; Reviewed 98.95
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 98.9
COG4108 528 PrfC Peptide chain release factor RF-3 [Translation, ri 98.89
COG0480 697 FusA Translation elongation factors (GTPases) [Translat 98.88
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 98.64
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate vesicl 98.64
KOG1547336 consensus 98.63
KOG2655 366 consensus 98.57
TIGR00503 530 prfC peptide chain release factor 3; InterPro: IPR00454 98.48
KOG1954 532 consensus 98.35
TIGR00484 705 EF-G translation elongation factor G; InterPro: IPR0045 98.19
KOG0465 721 consensus 98.1
KOG0464 753 consensus 97.96
KOG3859 406 consensus 97.59
KOG0446 657 consensus 97.56
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.3
PRK11537 317 putative GTP-binding protein YjiA; Provisional 97.3
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 97.21
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.12
KOG2743 391 consensus 96.97
KOG0469 842 consensus 96.92
COG3523 1188 IcmF Type VI protein secretion system component VasK [I 96.85
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.72
PTZ00258 392 GTP-binding protein; Provisional 99.59
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protein gen 99.57
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These protein 99.54
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 99.54
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all sequ 99.54
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to the hu 99.52
PRK09601 364 translation-associated GTPase; Reviewed 99.5
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin (NS) 99.5
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protein Ylq 99.5
PRK09563282 rbgA ribosomal biogenesis GTPase; Reviewed 99.5
COG0012 372 Predicted GTPase, probable translation factor [Translat 99.48
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg-like 99.47
KOG1424562 consensus 99.43
PRK09602 396 translation-associated GTPase; Reviewed 99.38
COG1161322 Predicted GTPases [General function prediction only] 99.36
TIGR00092 390 TIGR00092 GTP-binding protein YchF; InterPro: IPR004396 99.25
cd01900274 YchF YchF subfamily. YchF is a member of the Obg family 99.24
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protein. De 99.16
PRK13796367 GTP-binding protein YqeH; Provisional 99.08
KOG1491 391 consensus 99.07
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This famil 99.07
KOG2485335 consensus 98.93
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-envelope 98.91
KOG2484435 consensus 98.84
PRK01889353 ribosome-associated GTPase; Reviewed 98.81
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 98.7
pfam03193161 DUF258 Protein of unknown function, DUF258. 98.66
KOG2423572 consensus 98.65
PRK00098298 ribosome-associated GTPase; Reviewed 98.63
COG1162301 Predicted GTPases [General function prediction only] 98.61
PRK12288344 ribosome-associated GTPase; Reviewed 98.51
TIGR00993 772 3a0901s04IAP86 chloroplast protein import component Toc 98.01
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal domain. 97.5
TIGR00991 328 3a0901s02IAP34 GTP-binding protein; InterPro: IPR005688 97.1
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 97.09
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 96.87
PRK00300208 gmk guanylate kinase; Provisional 96.71
pfam02263264 GBP Guanylate-binding protein, N-terminal domain. Trans 96.67
pfam00625182 Guanylate_kin Guanylate kinase. 96.66
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 99.23
PRK09435325 arginine/ornithine transport system ATPase; Provisional 99.21
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 99.1
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 99.06
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 98.45
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 98.4
PRK13796 367 GTP-binding protein YqeH; Provisional 98.37
pfam05783 490 DLIC Dynein light intermediate chain (DLIC). This famil 98.07
PRK12288 344 ribosome-associated GTPase; Reviewed 97.94
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These protein 97.93
KOG3905 473 consensus 97.67
PRK00098 298 ribosome-associated GTPase; Reviewed 97.62
PRK12289 351 ribosome-associated GTPase; Reviewed 97.61
cd01854 287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 97.41
PRK01889 353 ribosome-associated GTPase; Reviewed 97.32
COG1162 301 Predicted GTPases [General function prediction only] 97.03
pfam00350168 Dynamin_N Dynamin family. 99.03
TIGR00650123 MG442 GTP-binding conserved hypothetical protein; Inter 98.74
KOG00541381 consensus 97.82
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 97.75
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 97.63
PRK09866 742 hypothetical protein; Provisional 97.58
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 97.55
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 97.5
PTZ00243 1560 ABC transporter; Provisional 97.45
TIGR01184230 ntrCD nitrate ABC transporter, ATP-binding proteins C a 97.44
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 97.44
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 97.38
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 97.31
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 97.3
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 97.28
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 97.28
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 97.19
COG4988559 CydD ABC-type transport system involved in cytochrome b 97.19
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 97.18
PRK10522547 multidrug transporter membrane component/ATP-binding co 97.18
cd03114148 ArgK-like The function of this protein family is unkown 97.15
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.14
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 97.13
PRK10789569 putative multidrug transporter membrane\ATP-binding com 97.12
PRK10790593 putative multidrug transporter membrane\ATP-binding com 97.11
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 97.11
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 97.11
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 97.09
cd03234226 ABCG_White The White subfamily represents ABC transport 97.08
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 97.07
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 97.07
TIGR01192592 chvA glucan exporter ATP-binding protein; InterPro: IPR 97.06
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.06
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 97.05
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 97.04
cd03246173 ABCC_Protease_Secretion This family represents the ABC 97.04
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 97.03
TIGR02142 361 modC_ABC molybdate ABC transporter, ATP-binding protein 97.03
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 97.02
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 97.01
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 97.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 96.99
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 96.99
KOG0054 1381 consensus 96.98
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 96.97
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 96.97
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 96.96
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 96.96
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 96.96
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 96.96
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 96.95
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 96.94
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 96.94
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 96.92
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 96.91
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 96.91
COG0419 908 SbcC ATPase involved in DNA repair [DNA replication, re 96.91
PTZ002651467 multidrug resistance protein (mdr1); Provisional 96.91
COG4987573 CydC ABC-type transport system involved in cytochrome b 96.9
PTZ002431560 ABC transporter; Provisional 96.9
KOG0057591 consensus 96.89
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 96.89
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.88
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 96.88
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 96.86
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 96.85
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 96.84
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 96.82
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 96.82
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 96.82
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 96.82
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 96.81
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 96.8
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.8
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 96.79
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 96.79
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 96.78
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 96.78
PRK09984262 phosphonate/organophosphate ester transporter subunit; 96.78
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 96.77
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 96.77
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.77
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.76
PRK11147 632 ABC transporter ATPase component; Reviewed 96.76
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 96.76
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 96.75
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 96.74
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 96.73
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.73
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 96.72
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.72
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 96.72
KOG0061 613 consensus 96.71
COG4148 352 ModC ABC-type molybdate transport system, ATPase compon 96.71
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.7
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.69
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 96.69
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 96.67
PRK03695245 vitamin B12-transporter ATPase; Provisional 96.67
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.67
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 96.66
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.65
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.64
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.64
PRK10744257 phosphate transporter subunit; Provisional 96.64
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 96.64
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.64
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 96.63
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 96.63
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 96.63
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 96.63
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 96.63
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 96.62
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 96.62
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 96.61
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 96.61
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 96.61
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 96.6
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.6
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 96.6
TIGR012711534 CFTR_protein cystic fibrosis transmembrane conductor re 96.6
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 96.6
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 96.6
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 96.6
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 96.59
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.58
TIGR00957 1542 MRP_assoc_pro multi drug resistance-associated protein 96.58
PRK12289351 ribosome-associated GTPase; Reviewed 98.66
pfam05879 741 RHD3 Root hair defective 3 GTP-binding protein (RHD3). 97.26
PTZ00099176 rab6; Provisional 98.61
KOG0072182 consensus 97.5
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This famil 98.4
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 98.38
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all sequ 98.32
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protein. De 98.21
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protein Ylq 98.02
PRK09563 282 rbgA ribosomal biogenesis GTPase; Reviewed 97.95
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protein gen 97.04
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 97.43
>PRK00454 engB GTPase EngB; Reviewed Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information