peg_393

peg_393

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(406271, 406723)Protein Length:150aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:Acetylglutamate kinase (EC 2.7.2.8)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Arginine Biosynthesis extended
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARHSLRLSPNTKKT
ccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcHHHHccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHcccccEEEccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEEEEEcccccccccccccc
cccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHcccccHHccccEcccHHHHHHHHHHHHcHHHHHHHHHHHHccccEEEEEcccccEEEEEEcccccccEEEEEEc
MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGghvmnctdlsKDFVNDIAllkksnitpvivhgggpqIGAVLEKMGIkskfenglritdQQTAEVVEMVLAGSINKKIVSLINQTGTqaigicgkdgnmvFAEKARhslrlspntkkt
MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKksnitpvivhgggPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEkarhslrlspntkkt
MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARHSLRLSPNTKKT
**********EILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFA****************
MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARHSL*********
**EKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARHSLRLSPNTKKT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARHSLRLSPNTKKT
MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARHSLRLSPNTKKT
MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARHSLRLSPNTKKT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target150
315122059 292 acetylglutamate kinase [Candidatus Liberibacter solanac 1 2e-62
218674519 295 acetylglutamate kinase [Rhizobium etli GR56] Length = 2 1 1e-52
190890099 295 acetylglutamate kinase protein [Rhizobium etli CIAT 652 1 1e-52
229260089 295 acetylglutamate kinase [Rhizobium etli CFN 42] Length = 1 2e-52
86280187 362 acetylglutamate kinase protein [Rhizobium etli CFN 42] 1 3e-52
209547683 295 acetylglutamate kinase [Rhizobium leguminosarum bv. tri 1 4e-52
241202840 295 acetylglutamate kinase [Rhizobium leguminosarum bv. tri 1 4e-52
218678771 295 acetylglutamate kinase [Rhizobium etli CIAT 894] Length 1 4e-52
116250214 295 acetylglutamate kinase [Rhizobium leguminosarum bv. vic 1 5e-52
222084721 295 acetylglutamate kinase protein [Agrobacterium radiobact 1 3e-51
>gi|315122059|ref|YP_004062548.1| acetylglutamate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 292 Back     alignment and organism information
 Score =  241 bits (616), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/149 (77%), Positives = 132/149 (88%), Gaps = 2/149 (1%)

Query: 1   MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITP 60
           MTE IYQF  +ILEQ LPFVQFYENETIV+KYGGHVM+C +LSK F +DIALLKK+NI P
Sbjct: 1   MTENIYQFHTDILEQALPFVQFYENETIVIKYGGHVMDCVELSKGFADDIALLKKANIIP 60

Query: 61  VIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQ 120
           +IVHGGGPQIGAVLE+MG++SKF+NGLRITDQ+TAE+VEMVLAGSINKKIVSLINQTGT 
Sbjct: 61  IIVHGGGPQIGAVLEEMGMESKFKNGLRITDQKTAEIVEMVLAGSINKKIVSLINQTGTW 120

Query: 121 AIGICGKDGNMVFAEKARHSLRLSPNTKK 149
           AIGICGKDGN+VFA+K  H +    NT K
Sbjct: 121 AIGICGKDGNLVFAKK--HLIDSLSNTNK 147


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218674519|ref|ZP_03524188.1| acetylglutamate kinase [Rhizobium etli GR56] Length = 295 Back     alignment and organism information
>gi|190890099|ref|YP_001976641.1| acetylglutamate kinase protein [Rhizobium etli CIAT 652] Length = 295 Back     alignment and organism information
>gi|229260089|ref|YP_467977.2| acetylglutamate kinase [Rhizobium etli CFN 42] Length = 295 Back     alignment and organism information
>gi|86280187|gb|ABC89250.1| acetylglutamate kinase protein [Rhizobium etli CFN 42] Length = 362 Back     alignment and organism information
>gi|209547683|ref|YP_002279600.1| acetylglutamate kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 295 Back     alignment and organism information
>gi|241202840|ref|YP_002973936.1| acetylglutamate kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 295 Back     alignment and organism information
>gi|218678771|ref|ZP_03526668.1| acetylglutamate kinase [Rhizobium etli CIAT 894] Length = 295 Back     alignment and organism information
>gi|116250214|ref|YP_766052.1| acetylglutamate kinase [Rhizobium leguminosarum bv. viciae 3841] Length = 295 Back     alignment and organism information
>gi|222084721|ref|YP_002543250.1| acetylglutamate kinase protein [Agrobacterium radiobacter K84] Length = 295 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target150
PRK00942 283 PRK00942, PRK00942, acetylglutamate kinase; Provisional 2e-51
PLN02512 309 PLN02512, PLN02512, acetylglutamate kinase 3e-42
cd04238 256 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-gluta 1e-39
COG0548 265 COG0548, ArgB, Acetylglutamate kinase [Amino acid trans 1e-37
CHL00202 284 CHL00202, argB, acetylglutamate kinase; Provisional 7e-34
TIGR00761 231 TIGR00761, argB, acetylglutamate kinase 7e-32
KOG2436 520 KOG2436, KOG2436, KOG2436, Acetylglutamate kinase/acety 2e-20
pfam00696 230 pfam00696, AA_kinase, Amino acid kinase family 3e-16
PRK14058 268 PRK14058, PRK14058, acetylglutamate/acetylaminoadipate 8e-14
cd04249 252 cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glutamate 9e-14
cd04252 248 cd04252, AAK_NAGK-fArgBP, AAK_NAGK-fArgBP: N-Acetyl-L-g 3e-13
cd02115 248 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, cat 3e-13
cd04237 280 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate 2e-12
cd04251 257 cd04251, AAK_NAGK-UC, AAK_NAGK-UC: N-Acetyl-L-glutamate 2e-12
TIGR01890 429 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransfera 5e-10
PLN02825 515 PLN02825, PLN02825, amino-acid N-acetyltransferase 0.001
cd04250 279 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate k 3e-45
PRK05279 441 PRK05279, PRK05279, N-acetylglutamate synthase; Validat 3e-12
PRK04531 398 PRK04531, PRK04531, acetylglutamate kinase; Provisional 4e-08
>gnl|CDD|179175 PRK00942, PRK00942, acetylglutamate kinase; Provisional Back     alignment and domain information
>gnl|CDD|178128 PLN02512, PLN02512, acetylglutamate kinase Back     alignment and domain information
>gnl|CDD|58604 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>gnl|CDD|30894 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|133644 CHL00202, argB, acetylglutamate kinase; Provisional Back     alignment and domain information
>gnl|CDD|162026 TIGR00761, argB, acetylglutamate kinase Back     alignment and domain information
>gnl|CDD|37647 KOG2436, KOG2436, KOG2436, Acetylglutamate kinase/acetylglutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|144336 pfam00696, AA_kinase, Amino acid kinase family Back     alignment and domain information
>gnl|CDD|184481 PRK14058, PRK14058, acetylglutamate/acetylaminoadipate kinase; Provisional Back     alignment and domain information
>gnl|CDD|58615 cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>gnl|CDD|58618 cd04252, AAK_NAGK-fArgBP, AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>gnl|CDD|58599 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>gnl|CDD|58603 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>gnl|CDD|58617 cd04251, AAK_NAGK-UC, AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>gnl|CDD|162583 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase Back     alignment and domain information
>gnl|CDD|178420 PLN02825, PLN02825, amino-acid N-acetyltransferase Back     alignment and domain information
>gnl|CDD|58616 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>gnl|CDD|179989 PRK05279, PRK05279, N-acetylglutamate synthase; Validated Back     alignment and domain information
>gnl|CDD|179860 PRK04531, PRK04531, acetylglutamate kinase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 150
CHL00202 284 argB acetylglutamate kinase; Provisional 100.0
cd04250 279 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cy 100.0
PRK05279 441 N-acetylglutamate synthase; Validated 100.0
cd04237 280 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kina 100.0
COG0548 265 ArgB Acetylglutamate kinase [Amino acid transport and m 100.0
TIGR00761 254 argB acetylglutamate kinase; InterPro: IPR004662 N -Ace 100.0
TIGR01890 439 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro 100.0
cd04249 252 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - 100.0
PRK00942 262 acetylglutamate kinase; Provisional 100.0
PRK04531 421 acetylglutamate kinase; Provisional 100.0
cd04238 256 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinas 99.98
cd04252 248 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate k 99.97
cd04251 257 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - 99.96
KOG2436 520 consensus 99.91
cd04236 271 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) ki 99.86
cd02115 248 AAK Amino Acid Kinases (AAK) superfamily, catalytic dom 99.77
pfam00696 230 AA_kinase Amino acid kinase family. This family include 99.6
cd04241 252 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomy 99.01
cd04235 308 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the 98.68
cd04254 231 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/ch 98.12
PRK00358 231 pyrH uridylate kinase; Provisional 98.11
cd04239 229 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, th 98.0
COG1608 252 Predicted archaeal kinase [General function prediction 97.82
TIGR00746 321 arcC carbamate kinase; InterPro: IPR003964 The arginine 97.63
cd04261 239 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Su 97.46
cd04246 239 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Su 97.16
COG0528 238 PyrH Uridylate kinase [Nucleotide transport and metabol 97.0
PRK08841 392 aspartate kinase; Validated 96.73
PRK07431 594 aspartate kinase; Provisional 96.43
PRK08210 405 aspartate kinase I; Reviewed 96.43
cd04260 244 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Supe 96.35
PRK12443 247 uridylate kinase; Reviewed 95.94
PRK06635 402 aspartate kinase; Reviewed 95.87
TIGR02075 236 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridyla 95.76
COG0527 447 LysC Aspartokinases [Amino acid transport and metabolis 95.64
COG5630 495 ARG2 Acetylglutamate synthase [Amino acid transport and 95.35
KOG1154 285 consensus 94.2
PRK12353 312 carbamate kinase; Reviewed 99.34
PRK12686 313 carbamate kinase; Reviewed 98.73
PRK12454 313 carbamate kinase-like carbamoyl phosphate synthetase; R 98.27
PRK12352 316 putative carbamate kinase; Reviewed 97.73
PRK09411 297 carbamate kinase; Reviewed 97.67
COG0549 312 ArcC Carbamate kinase [Amino acid transport and metabol 97.52
PRK12354 302 carbamate kinase; Reviewed 97.25
TIGR02076 232 pyrH_arch uridylate kinase, putative; InterPro: IPR0118 96.17
COG0263 369 ProB Glutamate 5-kinase [Amino acid transport and metab 96.05
TIGR01027 379 proB glutamate 5-kinase; InterPro: IPR005715 L-glutamat 95.92
cd04256 284 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) 98.04
PRK12314 265 gamma-glutamyl kinase; Provisional 97.85
cd04242 251 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) cat 97.72
cd04253221 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf 97.16
cd04240203 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-l 96.36
PRK05429 372 gamma-glutamyl kinase; Provisional 96.15
PRK13402 363 gamma-glutamyl kinase; Provisional 96.1
cd04234 227 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Asp 95.34
cd07041109 STAS_RsbR_RsbS_like Sulphate Transporter and Anti-Sigma 95.01
PRK06291 466 aspartate kinase; Provisional 92.59
>CHL00202 argB acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00761 argB acetylglutamate kinase; InterPro: IPR004662 N -Acetylglutamate (NAG) fulfils distinct biological roles in lower and higher organisms Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro: IPR010167 This entry represents a clade of amino-acid N-acetyltransferases, or N-acetylglutamate synthase, which is the product of the argA gene and the first enzyme in arginine biosynthesis Back     alignment and domain information
>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>PRK00942 acetylglutamate kinase; Provisional Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>KOG2436 consensus Back     alignment and domain information
>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals Back     alignment and domain information
>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>pfam00696 AA_kinase Amino acid kinase family Back     alignment and domain information
>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP Back     alignment and domain information
>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>PRK00358 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>COG1608 Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>TIGR00746 arcC carbamate kinase; InterPro: IPR003964 The arginine dihydrolase (AD) pathway is found in many prokaryotes and some primitive eukaryotes Back     alignment and domain information
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08841 aspartate kinase; Validated Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>PRK12443 uridylate kinase; Reviewed Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>TIGR02075 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1154 consensus Back     alignment and domain information
>PRK12353 carbamate kinase; Reviewed Back     alignment and domain information
>PRK12686 carbamate kinase; Reviewed Back     alignment and domain information
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed Back     alignment and domain information
>PRK12352 putative carbamate kinase; Reviewed Back     alignment and domain information
>PRK09411 carbamate kinase; Reviewed Back     alignment and domain information
>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12354 carbamate kinase; Reviewed Back     alignment and domain information
>TIGR02076 pyrH_arch uridylate kinase, putative; InterPro: IPR011818 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates Back     alignment and domain information
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01027 proB glutamate 5-kinase; InterPro: IPR005715 L-glutamate 5-phosphotransferase, (gamma-glutamyl kinase, proB, 2 Back     alignment and domain information
>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>PRK12314 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria Back     alignment and domain information
>PRK05429 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK13402 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>cd07041 STAS_RsbR_RsbS_like Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target150
2jj4_A 321 The Complex Of Pii And Acetylglutamate Kinase From 3e-36
2buf_A 300 Arginine Feed-Back Inhibitable Acetylglutamate Kina 2e-35
2rd5_B 284 Structural Basis For The Regulation Of N-Acetylglut 1e-34
2bty_A 282 Acetylglutamate Kinase From Thermotoga Maritima Com 1e-34
2rd5_A 282 Structural Basis For The Regulation Of N-Acetylglut 2e-34
2ap9_A 299 Crystal Structure Of Acetylglutamate Kinase From My 2e-32
2egx_A 269 Crystal Structure Of The Putative Acetylglutamate K 8e-14
1gsj_A 258 Selenomethionine Substituted N-Acetyl-L-Glutamate K 9e-14
1gs5_A 258 N-Acetyl-L-Glutamate Kinase From Escherichia Coli C 1e-13
2r8v_A 456 Native Structure Of N-Acetylglutamate Synthase From 2e-13
2r98_A 456 Crystal Structure Of N-Acetylglutamate Synthase (Se 2e-13
3l86_A 279 The Crystal Structure Of Smu.665 From Streptococcus 7e-10
>gi|158429027|pdb|2JJ4|A Chain A, The Complex Of Pii And Acetylglutamate Kinase From Synechococcus Elongatus Pcc7942 Length = 321 Back     alignment and structure
 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 64/152 (42%), Positives = 89/152 (58%), Gaps = 5/152 (3%)

Query: 1   MTEKIYQ----FQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKS 56
           M+ +  +     +  IL + LP++Q +   T+VVKYGG  M   +L +  + DI  L   
Sbjct: 21  MSSEFIEAGAADRVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACV 80

Query: 57  NITPVIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQ 116
            + PV+VHGGGP+I A L ++GI+ +F NGLR+TD  T EVVEMVL G +NK IVS IN 
Sbjct: 81  GMRPVVVHGGGPEINAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINT 140

Query: 117 TGTQAIGICGKDGNMVFAEKARHS-LRLSPNT 147
           TG +A+G CG DG +V A       +      
Sbjct: 141 TGGRAVGFCGTDGRLVLARPHDQEGIGFVGEV 172


>gi|85544321|pdb|2BUF|A Chain A, Arginine Feed-Back Inhibitable Acetylglutamate Kinase Length = 300 Back     alignment and structure
gi|313507214|pdb|2BTY|A Chain A, Acetylglutamate Kinase From Thermotoga Maritima Complexed With Its Inhibitor Arginine Length = 282 Back     alignment and structure
>gi|75766294|pdb|2AP9|A Chain A, Crystal Structure Of Acetylglutamate Kinase From Mycobacterium Tuberculosis Cdc1551 Length = 299 Back     alignment and structure
gi|158428337|pdb|2EGX|A Chain A, Crystal Structure Of The Putative Acetylglutamate Kinase From Thermus Thermophilus Length = 269 Back     alignment and structure
>gi|21465504|pdb|1GSJ|A Chain A, Selenomethionine Substituted N-Acetyl-L-Glutamate Kinase From Escherichia Coli Complexed With Its Substrate N- Acetyl-L-Glutamate And Its Substrate Analog Amppnp Length = 258 Back     alignment and structure
gi|21465503|pdb|1GS5|A Chain A, N-Acetyl-L-Glutamate Kinase From Escherichia Coli Complexed With Its Substrate N-Acetylglutamate And Its Substrate Analog Amppnp Length = 258 Back     alignment and structure
>gi|165761077|pdb|2R8V|A Chain A, Native Structure Of N-Acetylglutamate Synthase From Neisseria Gonorrhoeae Length = 456 Back     alignment and structure
>gi|316983219|pdb|3L86|A Chain A, The Crystal Structure Of Smu.665 From Streptococcus Mutans Ua159 Length = 279 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target150
3d2m_A 456 Putative acetylglutamate synthase; protein-COA-Glu tern 8e-34
2buf_A 300 Acetylglutamate kinase; acetyglutamate kinase, ADP, arg 5e-32
2v5h_A 321 Acetylglutamate kinase; amino-acid biosynthesis, transc 2e-30
2bty_A 282 Acetylglutamate kinase; N-acetyl-L-glutamate kinase, am 7e-29
2rd5_A 298 Acetylglutamate kinase-like protein; protein-protein co 1e-25
2ap9_A 299 NAG kinase, acetylglutamate kinase, AGK; structural gen 4e-24
2egx_A 269 Putative acetylglutamate kinase; structural genomics, N 3e-20
2e9y_A 316 Carbamate kinase; transferase, structural genomics, NPP 8e-20
3kzf_A 317 Carbamate kinase; arginine dihydrolase pathway, drug ta 5e-19
1gs5_A 258 Acetylglutamate kinase; carbamate kinase, amino acid ki 2e-18
2we5_A 310 Carbamate kinase 1; arginine catabolism, arginine metab 5e-18
1e19_A 314 Carbamate kinase-like carbamoylphosphate synthetase; tr 6e-17
3ll9_A 269 Isopentenyl phosphate kinase; mevalonate biosynthesis i 8e-14
1b7b_A 310 Carbamate kinase; phosphotransferase, arginine cataboli 6e-13
3k4o_A 266 Isopentenyl phosphate kinase; small molecule kinase, AT 8e-12
3d40_A 286 FOMA protein; fosfomycin, antibiotic resistance, kinase 3e-11
3ll5_A 249 Gamma-glutamyl kinase related protein; alternate mevalo 8e-11
2ogx_B 270 Molybdenum storage protein subunit beta; open alpha/bet 1e-06
2ogx_A 276 Molybdenum storage protein subunit alpha; open alpha/be 5e-05
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 Back     alignment and structure
 Score =  137 bits (347), Expect = 8e-34
 Identities = 24/129 (18%), Positives = 47/129 (36%), Gaps = 3/129 (2%)

Query: 10  AEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQ 69
                +  P+++     T+V    G ++    L      DI LL +  I  V++HG    
Sbjct: 28  VAHFREAAPYIRQMRGTTLVAGIDGRLLEGGTL-NKLAADIGLLSQLGIRLVLIHGAYHF 86

Query: 70  IGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQ--TGTQAIGICGK 127
           +  +    G    +  GLR+TD+ +    +       ++   +L        +A  +   
Sbjct: 87  LDRLAAAQGRTPHYCRGLRVTDETSLGQAQQFAGTVRSRFEAALCGSVSGFARAPSVPLV 146

Query: 128 DGNMVFAEK 136
            GN + A  
Sbjct: 147 SGNFLTARP 155


>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Length = 300 Back     alignment and structure
>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transferase, cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Length = 321 Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Length = 282 Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis, nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Length = 298 Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis CDC1551} SCOP: c.73.1.2 Length = 299 Back     alignment and structure
>2egx_A Putative acetylglutamate kinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.92A {Thermus thermophilus HB8} Length = 269 Back     alignment and structure
>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1} Length = 316 Back     alignment and structure
>3kzf_A Carbamate kinase; arginine dihydrolase pathway, drug target, transferase; 3.00A {Giardia lamblia atcc 50803} Length = 317 Back     alignment and structure
>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* Length = 258 Back     alignment and structure
>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Length = 310 Back     alignment and structure
>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Length = 314 Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 269 Back     alignment and structure
>1b7b_A Carbamate kinase; phosphotransferase, arginine catabolism, ATP synthesys, acylphosphate-making enzymes, open alpha/beta sheet; 2.80A {Enterococcus faecium} SCOP: c.73.1.1 Length = 310 Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Length = 266 Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* Length = 286 Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Length = 249 Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 270 Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 276 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target150
2buf_A 300 Acetylglutamate kinase; acetyglutamate kinase, ADP, arg 100.0
2v5h_A 321 Acetylglutamate kinase; amino-acid biosynthesis, transc 100.0
2ap9_A 299 NAG kinase, acetylglutamate kinase, AGK; structural gen 100.0
3d2m_A 456 Putative acetylglutamate synthase; protein-COA-Glu tern 99.98
2bty_A 282 Acetylglutamate kinase; N-acetyl-L-glutamate kinase, am 99.98
2rd5_A 298 Acetylglutamate kinase-like protein; protein-protein co 99.97
2e9y_A 316 Carbamate kinase; transferase, structural genomics, NPP 99.81
1e19_A 314 Carbamate kinase-like carbamoylphosphate synthetase; tr 99.79
1gs5_A 258 Acetylglutamate kinase; carbamate kinase, amino acid ki 99.79
3kzf_A 317 Carbamate kinase; arginine dihydrolase pathway, drug ta 99.67
2we5_A 310 Carbamate kinase 1; arginine catabolism, arginine metab 99.67
3k4o_A 266 Isopentenyl phosphate kinase; small molecule kinase, AT 99.23
3d40_A 286 FOMA protein; fosfomycin, antibiotic resistance, kinase 99.22
3ll9_A 269 Isopentenyl phosphate kinase; mevalonate biosynthesis i 99.18
3ll5_A 249 Gamma-glutamyl kinase related protein; alternate mevalo 99.0
2ogx_A 276 Molybdenum storage protein subunit alpha; open alpha/be 98.82
2ogx_B 270 Molybdenum storage protein subunit beta; open alpha/bet 98.64
3ek6_A 243 Uridylate kinase; UMPK unique GTP binding site, alloste 98.11
1z9d_A 252 Uridylate kinase, UK, UMP kinase; structural genomics, 98.0
1ybd_A 239 Uridylate kinase; alpha/beta/alpha fold, hexamer, struc 97.98
3ab4_A 421 Aspartokinase; aspartate kinase, concerted inhibition, 95.84
3l76_A 600 Aspartokinase; allostery, ACT domains, kinase transfera 95.81
2egx_A 269 Putative acetylglutamate kinase; structural genomics, N 99.86
2brx_A 244 Uridylate kinase; UMP kinase, amino acid kinase, phosph 98.34
2ako_A 251 Glutamate 5-kinase; structural genomics, PSI, protein s 98.28
3nwy_A281 Uridylate kinase; allosterically activated form, AAK fo 98.23
2jjx_A 255 Uridylate kinase, UMP kinase; structural genomics, pyri 98.19
2va1_A256 Uridylate kinase; UMPK, transferase, pyrimidine biosynt 97.85
2j4j_A226 Uridylate kinase; transferase, nucleoside monophosphate 97.81
2a1f_A 247 Uridylate kinase; PYRH, structural genomics, PSI, prote 97.65
2ij9_A219 Uridylate kinase; structural genomics, protein structur 97.17
2j5v_A 367 Glutamate 5-kinase; proline biosynthesis, gamma glutamy 97.09
2vy9_A123 Anti-sigma-factor antagonist; gene regulation, RSBS, st 91.42
1h4x_A117 SPOIIAA, anti-sigma F factor antagonist; cell different 91.48
>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Back     alignment and structure
Probab=100.00  E-value=1.7e-36  Score=253.69  Aligned_cols=149  Identities=40%  Similarity=0.739  Sum_probs=138.0

Q ss_pred             CCCHHHHHCCCHHHHHHHHHHHHCCCEEEEEECHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHCCCC
Q ss_conf             96002322062289999999987598899986756724746899999999998518971799845724578899970898
Q 537021.9.peg.3    1 MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIK   80 (150)
Q Consensus         1 ~~~~~~~~~a~~l~ea~pYi~~~r~ktiVIK~GG~~l~d~~l~~~~~~dI~ll~~~G~k~ViVHGgg~qI~~~l~~~gi~   80 (150)
                      |++.-+...|++||||+|||++|||||||||+||+++.|++++.++++||++|+.+|+++|||||||||+++.++++|++
T Consensus         2 ~~~~~~~~~~~~l~~a~pYi~~~r~ktiVIKlGGs~l~~~~~~~~~~~dIa~L~~~G~~vViVhGgg~~i~~~l~~~g~~   81 (300)
T 2buf_A            2 LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQIGDLLKRLSIE   81 (300)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHTTCEEEEEECCTTTTSSHHHHHHHHHHHHHHHTTCEEEEEECCCHHHHHHHHHTTCC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCC
T ss_conf             87678999999999977999997899899998944416867999999999999987994999938837879999975997


Q ss_pred             CEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEEEEECCC-------------CCCCCCCC
Q ss_conf             11557834661248999999974166899999998289976877865589899997475-------------21117995
Q 537021.9.peg.3   81 SKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARH-------------SLRLSPNT  147 (150)
Q Consensus        81 ~~~v~G~RVTd~~tl~iv~~vL~G~vn~~lv~~L~~~g~~avglsg~dg~li~a~~~~~-------------~lg~vg~~  147 (150)
                      ++|++|+|+||+++++++++++.|++|+.|++.|+++|++|+++++.|++++.+++...             ++|++|++
T Consensus        82 ~~~~~g~r~t~~~~~~~~~~~~~g~in~~lv~~L~~~g~~a~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~id~g~~g~v  161 (300)
T 2buf_A           82 SHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGHVGEV  161 (300)
T ss_dssp             CCBSSSSBCBCHHHHHHHHHHHHHTHHHHHHHHHHHTTCCEEEEEETGGGCEEEEECCCCCC--------CCCCBSBEEE
T ss_pred             CEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             42017865787889999999999889999999998668630215666663257531353113652233223225654445


Q ss_pred             CC
Q ss_conf             10
Q 537021.9.peg.3  148 KK  149 (150)
Q Consensus       148 ~k  149 (150)
                      ++
T Consensus       162 ~~  163 (300)
T 2buf_A          162 TG  163 (300)
T ss_dssp             EE
T ss_pred             CC
T ss_conf             65



>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transferase, cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Back     alignment and structure
>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis CDC1551} SCOP: c.73.1.2 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis, nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Back     alignment and structure
>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1} Back     alignment and structure
>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Back     alignment and structure
>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* Back     alignment and structure
>3kzf_A Carbamate kinase; arginine dihydrolase pathway, drug target, transferase; 3.00A {Giardia lamblia atcc 50803} Back     alignment and structure
>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Back     alignment and structure
>3ek6_A Uridylate kinase; UMPK unique GTP binding site, allosteric regulation, ATP-binding, cytoplasm kinase, nucleotide-binding; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_A Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Back     alignment and structure
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, protein structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>2egx_A Putative acetylglutamate kinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.92A {Thermus thermophilus HB8} Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Back     alignment and structure
>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Back     alignment and structure
>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, PSI, nysgxrc; 2.90A {Archaeoglobus fulgidus dsm 4304} SCOP: c.73.1.3 Back     alignment and structure
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Back     alignment and structure
>2vy9_A Anti-sigma-factor antagonist; gene regulation, RSBS, stressosome, STAS domain, bacillus subtilis; 2.3A {Moorella thermoacetica} Back     alignment and structure
>1h4x_A SPOIIAA, anti-sigma F factor antagonist; cell differentiation, crystallography, phosphorylation, sigma factor, sporulation; HET: SEP; 1.16A {Bacillus sphaericus} SCOP: c.13.2.1 PDB: 1h4z_A 1h4y_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 150
d2bufa1 300 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudom 2e-32
d2btya1 282 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermot 1e-28
d2ap9a1 291 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobac 5e-24
d1e19a_ 313 c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus fur 5e-20
d1gs5a_ 258 c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia 7e-16
d1b7ba_ 307 c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [T 3e-15
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Length = 300 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: N-acetyl-l-glutamate kinase
domain: N-acetyl-l-glutamate kinase
species: Pseudomonas aeruginosa [TaxId: 287]
 Score =  131 bits (331), Expect = 2e-32
 Identities = 60/139 (43%), Positives = 93/139 (66%)

Query: 1   MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITP 60
           ++       A++L + LP+++ +  +T+V+KYGG+ M   +L   F  D+ L+K   I P
Sbjct: 2   LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINP 61

Query: 61  VIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQ 120
           V+VHGGGPQIG +L+++ I+S F +G+R+TD  T +VVEMVL G +NK IV+LIN+ G  
Sbjct: 62  VVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGS 121

Query: 121 AIGICGKDGNMVFAEKARH 139
           AIG+ GKD  ++ A+K   
Sbjct: 122 AIGLTGKDAELIRAKKLTV 140


>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Length = 282 Back     information, alignment and structure
>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 291 Back     information, alignment and structure
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 313 Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Length = 307 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target150
d2bufa1 300 N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [Ta 100.0
d2ap9a1 291 N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis 100.0
d2btya1 282 N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId 99.98
d1e19a_ 313 Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 99.82
d1gs5a_ 258 N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 5 99.81
d2akoa1 250 Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} 98.31
d1z9da1 238 Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1 97.76
d1b7ba_ 307 Carbamate kinase {Enterococcus faecium [TaxId: 1352]} 99.69
d2brxa1 225 Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261 98.0
d1ybda1236 Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 4 97.84
d2a1fa1236 Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 7 97.36
d2ij9a1219 Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2 97.23
d2hmfa1 302 Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} 91.81
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: N-acetyl-l-glutamate kinase
domain: N-acetyl-l-glutamate kinase
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=100.00  E-value=1.2e-39  Score=272.24  Aligned_cols=149  Identities=40%  Similarity=0.739  Sum_probs=140.0

Q ss_pred             CCCHHHHHCCCHHHHHHHHHHHHCCCEEEEEECHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHCCCC
Q ss_conf             96002322062289999999987598899986756724746899999999998518971799845724578899970898
Q 537021.9.peg.3    1 MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIK   80 (150)
Q Consensus         1 ~~~~~~~~~a~~l~ea~pYi~~~r~ktiVIK~GG~~l~d~~l~~~~~~dI~ll~~~G~k~ViVHGgg~qI~~~l~~~gi~   80 (150)
                      |.+..+.++|.+||||+|||++|||||||||+||+++.|++++.+|++||++|+.+|+++|||||||||++++|+++|++
T Consensus         2 ~~~~~~~~~~~~l~~a~PYi~~~r~ktiVIKlGG~~l~~~~~~~~~~~dIa~L~~~G~~vViVhGgg~~i~~~l~~~gi~   81 (300)
T d2bufa1           2 LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQIGDLLKRLSIE   81 (300)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHTTCEEEEEECCTTTTSSHHHHHHHHHHHHHHHTTCEEEEEECCCHHHHHHHHHTTCC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHCCCC
T ss_conf             87678999999999978999997899899998917847865899999999999975992799667378899998744467


Q ss_pred             CEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEEEEECCC-------------CCCCCCCC
Q ss_conf             11557834661248999999974166899999998289976877865589899997475-------------21117995
Q 537021.9.peg.3   81 SKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARH-------------SLRLSPNT  147 (150)
Q Consensus        81 ~~~v~G~RVTd~~tl~iv~~vL~G~vn~~lv~~L~~~g~~avglsg~dg~li~a~~~~~-------------~lg~vg~~  147 (150)
                      ++|++|+|+||+++|++++++++|++|++|++.|+++|++|+|+++.|++++.+++...             ++|++|++
T Consensus        82 ~~~~~g~RvT~~~~l~~~~~~~~g~vn~~lv~~l~~~g~~a~~l~~~d~~~i~~~~~~~~~~~~~~~~~~~id~g~~G~v  161 (300)
T d2bufa1          82 SHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGHVGEV  161 (300)
T ss_dssp             CCBSSSSBCBCHHHHHHHHHHHHHTHHHHHHHHHHHTTCCEEEEEETGGGCEEEEECCCCCC--------CCCCBSBEEE
T ss_pred             CEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             61037845466113899999998677899999998669854225777665688521565556753244323345765110


Q ss_pred             CC
Q ss_conf             10
Q 537021.9.peg.3  148 KK  149 (150)
Q Consensus       148 ~k  149 (150)
                      ++
T Consensus       162 ~~  163 (300)
T d2bufa1         162 TG  163 (300)
T ss_dssp             EE
T ss_pred             EE
T ss_conf             30



>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 150
1e19_A_1-124_169-314 270 (A:1-124,A:169-314) Carbamate kinase-like carbamoy 8e-20
2v5h_A_ 321 (A:) Acetylglutamate kinase; amino-acid biosynthes 6e-19
2bty_A_ 284 (A:) Acetylglutamate kinase; N-acetyl-L-glutamate 3e-16
2rd5_A_16-282 267 (A:16-282) Acetylglutamate kinase-like protein; pr 3e-16
2ap9_A_ 299 (A:) NAG kinase, acetylglutamate kinase, AGK; stru 1e-15
3d40_A_ 286 (A:) FOMA protein; fosfomycin, antibiotic resistan 4e-15
1gs5_A_ 258 (A:) Acetylglutamate kinase; carbamate kinase, ami 1e-14
2buf_A_22-300 279 (A:22-300) Acetylglutamate kinase; acetyglutamate 4e-14
3d2m_A_1-305 305 (A:1-305) Putative acetylglutamate synthase; prote 2e-13
3ek6_A_ 243 (A:) Uridylate kinase; UMPK unique GTP binding sit 8e-13
2egx_A_ 269 (A:) Putative acetylglutamate kinase; structural g 2e-12
1b7b_A_ 310 (A:) Carbamate kinase; phosphotransferase, arginin 8e-12
2j4j_A_ 226 (A:) Uridylate kinase; transferase, nucleoside mon 3e-11
2jjx_A_ 255 (A:) Uridylate kinase, UMP kinase; structural geno 3e-11
2ogx_B_32-270 239 (B:32-270) Molybdenum storage protein subunit beta 6e-11
2j0w_A_1-292 292 (A:1-292) Lysine-sensitive aspartokinase 3; feedba 2e-10
2j5v_A_1-266 266 (A:1-266) Glutamate 5-kinase; proline biosynthesis 3e-10
1z9d_A_ 252 (A:) Uridylate kinase, UK, UMP kinase; structural 4e-10
2a1f_A_ 247 (A:) Uridylate kinase; PYRH, structural genomics, 3e-09
2ako_A_ 251 (A:) Glutamate 5-kinase; structural genomics, PSI, 4e-09
2ogx_A_ 276 (A:) Molybdenum storage protein subunit alpha; ope 5e-09
2brx_A_ 244 (A:) Uridylate kinase; UMP kinase, amino acid kina 7e-09
2va1_A_ 256 (A:) Uridylate kinase; UMPK, transferase, pyrimidi 1e-05
1ybd_A_ 239 (A:) Uridylate kinase; alpha/beta/alpha fold, hexa 9e-05
3c1m_A_1-304 304 (A:1-304) Probable aspartokinase; allosteric inhib 4e-10
2ij9_A_219 (A:) Uridylate kinase; structural genomics, protei 7e-05
>1e19_A (A:1-124,A:169-314) Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus}Length = 270 Back     alignment and structure
 Score = 90.8 bits (225), Expect = 8e-20
 Identities = 22/122 (18%), Positives = 39/122 (31%), Gaps = 15/122 (12%)

Query: 25  NETIVVKYGGHVMNCTDLSKDF----------VNDIALLKKSNITPVIVHGGGPQIGAVL 74
            + +V+  GG+ +        +             IA +       VI HG GPQ+G++L
Sbjct: 2   GKRVVIALGGNALQQRGQKGSYEEMMDNVRKTARQIAEIIARGYEVVITHGNGPQVGSLL 61

Query: 75  EKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFA 134
             M               Q  +V   +  G I   I   +     +  G+  K   ++  
Sbjct: 62  LHMD----AGQATYGIPAQPMDVAGAMSQGWIGYMIQQALKN-ELRKRGMEKKVVTIITQ 116

Query: 135 EK 136
             
Sbjct: 117 TI 118


>2v5h_A (A:) Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transferase, cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A*Length = 321 Back     alignment and structure
>2bty_A (A:) Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima}Length = 284 Back     alignment and structure
>2ap9_A (A:) NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis CDC1551}Length = 299 Back     alignment and structure
>3d40_A (A:) FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A*Length = 286 Back     alignment and structure
>1gs5_A (A:) Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli}Length = 258 Back     alignment and structure
>2buf_A (A:22-300) Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa}Length = 279 Back     alignment and structure
>3d2m_A (A:1-305) Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A*Length = 305 Back     alignment and structure
>3ek6_A (A:) Uridylate kinase; UMPK unique GTP binding site, allosteric regulation, ATP-binding, cytoplasm kinase, nucleotide-binding; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_ALength = 243 Back     alignment and structure
>2egx_A (A:) Putative acetylglutamate kinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.92A {Thermus thermophilus HB8}Length = 269 Back     alignment and structure
>1b7b_A (A:) Carbamate kinase; phosphotransferase, arginine catabolism, ATP synthesys, acylphosphate-making enzymes, open alpha/beta sheet; 2.80A {Enterococcus faecium}Length = 310 Back     alignment and structure
>2j4j_A (A:) Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A*Length = 226 Back     alignment and structure
>2jjx_A (A:) Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis}Length = 255 Back     alignment and structure
>2ogx_B (B:32-270) Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii}Length = 239 Back     alignment and structure
>2j5v_A (A:1-266) Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A*Length = 266 Back     alignment and structure
>1z9d_A (A:) Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes}Length = 252 Back     alignment and structure
>2a1f_A (A:) Uridylate kinase; PYRH, structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Haemophilus influenzae}Length = 247 Back     alignment and structure
>2ako_A (A:) Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni}Length = 251 Back     alignment and structure
>2ogx_A (A:) Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii}Length = 276 Back     alignment and structure
>2brx_A (A:) Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus}Length = 244 Back     alignment and structure
>2va1_A (A:) Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum}Length = 256 Back     alignment and structure
>1ybd_A (A:) Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, protein structure initiative, PSI; 2.60A {Neisseria meningitidis}Length = 239 Back     alignment and structure
>3c1m_A (A:1-304) Probable aspartokinase; allosteric inhibition, threonine-sensitive, ACT domain, amino-acid biosynthesis, threonine biosynthesis; HET: ANP; 2.30A {Methanocaldococcus jannaschii} PDB: 3c1n_A 3c20_A 2hmf_A*Length = 304 Back     alignment and structure
>2ij9_A (A:) Uridylate kinase; structural genomics, protein structure initiative, PSI, nysgxrc; 2.90A {Archaeoglobus fulgidus dsm 4304}Length = 219 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target150
2bty_A_ 282 Acetylglutamate kinase; N-acetyl-L-glutamate kinas 99.98
2ap9_A_ 299 NAG kinase, acetylglutamate kinase, AGK; structura 99.9
2v5h_A_ 321 Acetylglutamate kinase; amino-acid biosynthesis, t 99.9
1e19_A_1-124_169-314 270 Carbamate kinase-like carbamoylphosphate synthetas 99.87
3d2m_A_1-305 305 Putative acetylglutamate synthase; protein-COA-Glu 99.77
1gs5_A_ 258 Acetylglutamate kinase; carbamate kinase, amino ac 99.73
2buf_A_22-300 279 Acetylglutamate kinase; acetyglutamate kinase, ADP 99.68
2egx_A_ 269 Putative acetylglutamate kinase; structural genomi 99.49
2j5v_A_1-266 266 Glutamate 5-kinase; proline biosynthesis, gamma gl 99.45
2ogx_B_32-270 239 Molybdenum storage protein subunit beta; open alph 99.32
1b7b_A_ 310 Carbamate kinase; phosphotransferase, arginine cat 99.29
2ako_A_ 251 Glutamate 5-kinase; structural genomics, PSI, prot 99.22
3d40_A_ 286 FOMA protein; fosfomycin, antibiotic resistance, k 99.19
2e9y_A_1-124_169-316 272 Carbamate kinase; transferase, structural genomics 99.13
2a1f_A_ 247 Uridylate kinase; PYRH, structural genomics, PSI, 99.12
2jjx_A_ 255 Uridylate kinase, UMP kinase; structural genomics, 99.11
2j0w_A_1-292 292 Lysine-sensitive aspartokinase 3; feedback inhibit 99.06
2rd5_A_16-282 267 Acetylglutamate kinase-like protein; protein-prote 99.05
1ybd_A_ 239 Uridylate kinase; alpha/beta/alpha fold, hexamer, 99.02
3ek6_A_ 243 Uridylate kinase; UMPK unique GTP binding site, al 99.01
1z9d_A_ 252 Uridylate kinase, UK, UMP kinase; structural genom 98.91
2va1_A_ 256 Uridylate kinase; UMPK, transferase, pyrimidine bi 98.55
2cdq_A_1-304 304 Aspartokinase; aspartate kinase, amino acid metabo 95.94
3c1m_A_1-304 304 Probable aspartokinase; allosteric inhibition, thr 99.16
2brx_A_ 244 Uridylate kinase; UMP kinase, amino acid kinase, p 99.01
2j4j_A_ 226 Uridylate kinase; transferase, nucleoside monophos 98.8
2ij9_A_219 Uridylate kinase; structural genomics, protein str 98.14
2ogx_A_ 276 Molybdenum storage protein subunit alpha; open alp 97.97
>2bty_A (A:) Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} Back     alignment and structure
Probab=99.98  E-value=9.7e-32  Score=224.11  Aligned_cols=141  Identities=43%  Similarity=0.791  Sum_probs=132.6

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHCCCCCEEECCCC
Q ss_conf             06228999999998759889998675672474689999999999851897179984572457889997089811557834
Q 537021.9.peg.3    9 QAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLR   88 (150)
Q Consensus         9 ~a~~l~ea~pYi~~~r~ktiVIK~GG~~l~d~~l~~~~~~dI~ll~~~G~k~ViVHGgg~qI~~~l~~~gi~~~~v~G~R   88 (150)
                      .-..||||+|||++|||||||||+||+++.|++.+++|++||++|+..|+++|||||||+|+++.+.++|+++.+.+|.|
T Consensus         5 ~~~~~~~a~pyi~~~~~k~iVIKiGGsvi~d~~~~~~l~~dia~L~~~G~~iViVhG~~~~~~~~l~~~~i~~~~~~~~~   84 (282)
T 2bty_A            5 TVNVLLEALPYIKEFYGKTFVIKFGGSAMKQENAKKAFIQDIILLKYTGIKPIIVHGGGPAISQMMKDLGIEPVFKNGHR   84 (282)
T ss_dssp             HHHHHHHHHHHHHHHTTCEEEEEECSHHHHSHHHHHHHHHHHHHHHHTTCEEEEEECCSHHHHHHHHHHTCCCCBSSSSB
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEECHHHHCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHCCCCCCCCCCCC
T ss_conf             88899997899998589989999790672685289999999999998899599997997530557997799532336755


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEEEEECC--CCCCCCCCCCC
Q ss_conf             66124899999997416689999999828997687786558989999747--52111799510
Q 537021.9.peg.3   89 ITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKAR--HSLRLSPNTKK  149 (150)
Q Consensus        89 VTd~~tl~iv~~vL~G~vn~~lv~~L~~~g~~avglsg~dg~li~a~~~~--~~lg~vg~~~k  149 (150)
                      +|+++++++++|++.|.+|+.+++.|+++|++|+++++.+.++..++...  .+++++|++++
T Consensus        85 vt~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~a~~~~~~~~~~~~~~~~~~~~d~~~~g~~~~  147 (282)
T 2bty_A           85 VTDEKTMEIVEMVLVGKINKEIVMNLNLHGGRAVGICGKDSKLIVAEKETKHGDIGYVGKVKK  147 (282)
T ss_dssp             CBCHHHHHHHHHHHHHTHHHHHHHHHHTTTCCEEEEETTGGGSEEEEECCTTCCCBSBEEEEE
T ss_pred             CCCHHHHHHHHHHHHCCHHHHHHHHHHCCCCCEEEEECCCCCCEEECCCCCCCCCCCCCCHHE
T ss_conf             556457899999984310488999986047775675044444056315655565464411110



>2ap9_A (A:) NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis CDC1551} Back     alignment and structure
>2v5h_A (A:) Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transferase, cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Back     alignment and structure
>1e19_A (A:1-124,A:169-314) Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} Back     alignment and structure
>3d2m_A (A:1-305) Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>1gs5_A (A:) Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} Back     alignment and structure
>2buf_A (A:22-300) Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} Back     alignment and structure
>2egx_A (A:) Putative acetylglutamate kinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.92A {Thermus thermophilus HB8} Back     alignment and structure