254780495

254780495

superoxide dismutase

GeneID in NCBI database:8209490Locus tag:CLIBASIA_01910
Protein GI in NCBI database:254780495Protein Accession:YP_003064908.1
Gene range:-(782237, 782854)Protein Length:205aa
Gene description:superoxide dismutase
COG prediction:[P] Superoxide dismutase
KEGG prediction:superoxide dismutase; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
SEED prediction:Superoxide dismutase [Fe] (EC 1.15.1.1)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Protection from Reactive Oxygen Species
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLAQKVT
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccEEEEEEEccEEEEEEEEccccccccccEEEEEEEHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccc
ccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHccHccccHHHccHHHHHHHHHHcccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEEEccccHHHHccEEEEEEEccHHHcHHHHcccHHHHHHHHHHHcEcHHHHHHHHHHHHHccccc
mdfklpnlpysyddlspymsketleyhhdvhhknyaDNALKLASDAEMLHLSLEEIIIKshgsnaglfnnasqyyNHNLFWACMkkndgkgkvpqaLSDAIDDNFGSFEKFKSDLITAASTqfgsgwgwlsvkngkleisktqnaenplingaipilgIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLAQKVT
mdfklpnlpysyddLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLAQKVT
MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLAQKVT
MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFWACMKK*********ALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAML*****
MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLAQKVT
*DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLAQKVT
MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLAQKVT
MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLAQKVT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target205 superoxide dismutase [Candidatus Liberibacter asiaticus
315122318206 superoxide dismutase [Candidatus Liberibacter solanacea 1 4e-94
15888217200 superoxide dismutase [Agrobacterium tumefaciens str. C5 1 9e-71
325292253200 Superoxide dismutase [Agrobacterium sp. H13-3] Length = 1 5e-70
222085262200 superoxide dismutase protein [Agrobacterium radiobacter 1 7e-70
116251108200 superoxide dismutase [Rhizobium leguminosarum bv. vicia 1 5e-69
86356843200 superoxide dismutase protein [Rhizobium etli CFN 42] Le 1 7e-69
190890912200 superoxide dismutase [Rhizobium etli CIAT 652] Length = 1 9e-69
241203704200 superoxide dismutase [Rhizobium leguminosarum bv. trifo 1 3e-68
327192626200 Superoxide dismutase [Rhizobium etli CNPAF512] Length = 1 3e-68
209548448200 superoxide dismutase [Rhizobium leguminosarum bv. trifo 1 4e-68
>gi|315122318|ref|YP_004062807.1| superoxide dismutase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 206 Back     alignment and organism information
 Score =  348 bits (892), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 180/203 (88%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKS 60
           M F+LPNLPY YD LSPYMS ETL+YHH VHHK YADNALKLASDAEMLH  LEEIIIKS
Sbjct: 1   MAFELPNLPYDYDALSPYMSPETLKYHHGVHHKTYADNALKLASDAEMLHSPLEEIIIKS 60

Query: 61  HGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120
           +GSNAGLFNNASQYYNHNLFW CMKKN G  K+PQ LSDAI+ NFGS+EKFKSD ITAA 
Sbjct: 61  YGSNAGLFNNASQYYNHNLFWLCMKKNGGGEKIPQVLSDAINSNFGSYEKFKSDFITAAC 120

Query: 121 TQFGSGWGWLSVKNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           TQF SGW WLSVKNGKLEISKTQNAENPLINGA PILGIDVWEHAYYLDF+Y+R+ Y+E+
Sbjct: 121 TQFASGWTWLSVKNGKLEISKTQNAENPLINGATPILGIDVWEHAYYLDFQYKRSSYVEN 180

Query: 181 FITNLVNWEYVCERYETAMLAQK 203
           F+++L+NWEYV ERYE+ +L QK
Sbjct: 181 FVSHLINWEYVHERYESTILTQK 203


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15888217|ref|NP_353898.1| superoxide dismutase [Agrobacterium tumefaciens str. C58] Length = 200 Back     alignment and organism information
>gi|325292253|ref|YP_004278117.1| Superoxide dismutase [Agrobacterium sp. H13-3] Length = 200 Back     alignment and organism information
>gi|222085262|ref|YP_002543792.1| superoxide dismutase protein [Agrobacterium radiobacter K84] Length = 200 Back     alignment and organism information
>gi|116251108|ref|YP_766946.1| superoxide dismutase [Rhizobium leguminosarum bv. viciae 3841] Length = 200 Back     alignment and organism information
>gi|86356843|ref|YP_468735.1| superoxide dismutase protein [Rhizobium etli CFN 42] Length = 200 Back     alignment and organism information
>gi|190890912|ref|YP_001977454.1| superoxide dismutase [Rhizobium etli CIAT 652] Length = 200 Back     alignment and organism information
>gi|241203704|ref|YP_002974800.1| superoxide dismutase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 200 Back     alignment and organism information
>gi|327192626|gb|EGE59569.1| Superoxide dismutase [Rhizobium etli CNPAF512] Length = 200 Back     alignment and organism information
>gi|209548448|ref|YP_002280365.1| superoxide dismutase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 200 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 superoxide dismutase [Candidatus Liberibacter asiaticus
KOG0876234 KOG0876, KOG0876, KOG0876, Manganese superoxide dismuta 4e-48
PLN02685299 PLN02685, PLN02685, iron superoxide dismutase 9e-48
PRK10543193 PRK10543, PRK10543, superoxide dismutase; Provisional 7e-46
PTZ00078193 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Provisio 3e-45
PLN02184212 PLN02184, PLN02184, superoxide dismutase [Fe] 4e-45
PRK10925206 PRK10925, PRK10925, superoxide dismutase; Provisional 4e-43
PLN02622261 PLN02622, PLN02622, iron superoxide dismutase 2e-41
PLN02471231 PLN02471, PLN02471, superoxide dismutase [Mn] 9e-29
COG0605204 COG0605, SodA, Superoxide dismutase [Inorganic ion tran 4e-63
pfam02777105 pfam02777, Sod_Fe_C, Iron/manganese superoxide dismutas 1e-33
pfam0008182 pfam00081, Sod_Fe_N, Iron/manganese superoxide dismutas 1e-20
>gnl|CDD|36094 KOG0876, KOG0876, KOG0876, Manganese superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|178288 PLN02685, PLN02685, iron superoxide dismutase Back     alignment and domain information
>gnl|CDD|182534 PRK10543, PRK10543, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|185432 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Provisional Back     alignment and domain information
>gnl|CDD|177838 PLN02184, PLN02184, superoxide dismutase [Fe] Back     alignment and domain information
>gnl|CDD|182843 PRK10925, PRK10925, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|166263 PLN02622, PLN02622, iron superoxide dismutase Back     alignment and domain information
>gnl|CDD|178090 PLN02471, PLN02471, superoxide dismutase [Mn] Back     alignment and domain information
>gnl|CDD|30950 COG0605, SodA, Superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|145761 pfam02777, Sod_Fe_C, Iron/manganese superoxide dismutases, C-terminal domain Back     alignment and domain information
>gnl|CDD|109149 pfam00081, Sod_Fe_N, Iron/manganese superoxide dismutases, alpha-hairpin domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 205 superoxide dismutase [Candidatus Liberibacter asiaticus
PRK10925206 superoxide dismutase; Provisional 100.0
COG0605204 SodA Superoxide dismutase [Inorganic ion transport and 100.0
PRK10543193 superoxide dismutase; Provisional 100.0
PTZ00078198 Fe-superoxide dismutase; Provisional 100.0
KOG0876234 consensus 100.0
pfam02777105 Sod_Fe_C Iron/manganese superoxide dismutases, C-termin 100.0
pfam0008182 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-ha 99.96
>PRK10925 superoxide dismutase; Provisional Back     alignment and domain information
>COG0605 SodA Superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10543 superoxide dismutase; Provisional Back     alignment and domain information
>PTZ00078 Fe-superoxide dismutase; Provisional Back     alignment and domain information
>KOG0876 consensus Back     alignment and domain information
>pfam02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain Back     alignment and domain information
>pfam00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target205 superoxide dismutase [Candidatus Liberibacter asiaticus
3kky_A211 Structure Of Manganese Superoxide Dismutase From De 1e-54
1y67_A229 Crystal Structure Of Manganese Superoxide Dismutase 2e-54
2cdy_A231 Manganese Superoxide Dismutase (Mn-Sod) From Deinoc 3e-53
2rcv_A202 Crystal Structure Of The Bacillus Subtilis Superoxi 5e-53
1xuq_A212 Crystal Structure Of Soda-1 (Ba4499) From Bacillus 1e-51
1my6_A199 The 1.6 A Structure Of Fe-Superoxide Dismutase From 3e-50
1gv3_A248 The 2.0 Angstrom Resolution Structure Of The Cataly 7e-50
1dt0_A197 Cloning, Sequence, And Crystallographic Structure O 8e-50
1vew_A205 Manganese Superoxide Dismutase From Escherichia Col 2e-49
1en6_A205 Crystal Structure Analysis Of The E. Coli Manganese 2e-49
1i0h_A205 Crystal Structure Of The E. Coli Manganese Superoxi 3e-49
1en4_A205 Crystal Structure Analysis Of The E. Coli Manganese 4e-49
1n0j_A199 The Structure Of Human Mitochondrial Mn3+ Superoxid 4e-49
3mds_A203 Maganese Superoxide Dismutase From Thermus Thermoph 7e-49
1jr9_A202 Crystal Structure Of Manganese Superoxide Dismutase 8e-49
1en5_A205 Crystal Structure Analysis Of The E. Coli Manganese 1e-48
3sdp_A195 The 2.1 Angstroms Resolution Structure Of Iron Supe 2e-48
2cw2_A226 Crystal Structure Of Superoxide Dismutase From P. M 2e-48
1msd_A198 Comparison Of The Crystal Structures Of Genetically 4e-48
1var_A198 Mitochondrial Manganese Superoxide Dismutase Varian 4e-48
1i08_A205 Crystal Structure Analysis Of The H30a Mutant Of Ma 5e-48
1em1_A198 X-Ray Crystal Structure For Human Manganese Superox 5e-48
1qnm_A198 Human Manganese Superoxide Dismutase Mutant Q143n L 6e-48
1pl4_A198 Crystal Structure Of Human Mnsod Y166f Mutant Lengt 8e-48
1n0n_A199 Catalytic And Structural Effects Of Amino-Acid Subs 1e-47
1isa_A192 Structure-Function In E. Coli Iron Superoxide Dismu 1e-47
2nyb_A192 Crystal Structure Of E.Coli Iron Superoxide Dismuta 1e-47
3c3t_A198 Role Of A Glutamate Bridge Spanning The Dimeric Int 2e-47
1szx_A198 Role Of Hydrogen Bonding In The Active Site Of Huma 2e-47
1za5_A192 Q69h-Fesod Length = 192 2e-47
2qkc_A196 Structural And Kinetic Study Of The Differences Bet 2e-47
2qka_A196 Structural And Kinetic Study Of The Differences Bet 3e-47
1ap5_A198 Tyr34->phe Mutant Of Human Mitochondrial Manganese 3e-47
3c3s_A198 Role Of A Glutamate Bridge Spanning The Dimeric Int 4e-47
1zuq_A198 Contribution To Structure And Catalysis Of Tyrosine 4e-47
1luw_A198 Catalytic And Structural Effects Of Amino-Acid Subs 4e-47
1zsp_A198 Contribution To Structure And Catalysis Of Tyrosine 4e-47
2gds_A198 Interrupting The Hydrogen Bonding Network At The Ac 4e-47
1ja8_A198 Kinetic Analysis Of Product Inhibition In Human Man 6e-47
2adp_A198 Nitrated Human Manganese Superoxide Dismutase Lengt 7e-47
1zte_A198 Contribution To Structure And Catalysis Of Tyrosine 7e-47
1ma1_A205 Structure And Properties Of The Atypical Iron Super 8e-47
1pm9_A198 Crystal Structure Of Human Mnsod H30n, Y166f Mutant 9e-47
3h1s_A195 Crystal Structure Of Superoxide Dismutase From Fran 1e-46
2p4k_A198 Contribution To Structure And Catalysis Of Tyrosine 2e-46
1qnn_A191 Cambialistic Superoxide Dismutase From Porphyromona 3e-46
1kkc_A221 Crystal Structure Of Aspergillus Fumigatus Mnsod Le 7e-46
1ues_A191 Crystal Structure Of Porphyromonas Gingivalis Sod L 8e-46
3lio_A192 X-Ray Structure Of The Iron Superoxide Dismutase Fr 2e-45
1ar4_A201 X-Ray Structure Analysis Of The Cambialistic Supero 2e-45
1xre_A217 Crystal Structure Of Soda-2 (Ba5696) From Bacillus 4e-45
3dc6_A198 Crystal Structure Of A Manganese Superoxide Dismuta 9e-45
2w7w_A194 The Crystal Structure Of Iron Superoxide Dismutase 5e-44
1unf_X238 The Crystal Structure Of The Eukaryotic Fesod From 1e-43
2awp_A198 Crystal Structure Of Plasmodium Knowlesi Structure 2e-43
2a03_A206 Superoxide Dismutase Protein From Plasmodium Berghe 2e-43
2bpi_A206 Stucture Of Iron Dependent Superoxide Dismutase Fro 2e-43
3evk_A222 Crystal Structure Of The Metal-Bound Superoxide Dis 3e-43
3bfr_A215 The Crystal Structure Of Sod2 From Saccharomyces Ce 5e-43
3dc5_A195 Crystal Structure Of A Manganese Superoxide Dismuta 7e-43
1gn3_A207 H145q Mutant Of Mycobacterium Tuberculosis Iron-Sup 8e-43
1gn4_A207 H145e Mutant Of Mycobacterium Tuberculosis Iron-Sup 9e-43
2goj_A197 The Crystal Structure Of The Enzyme Fe-Superoxide D 1e-42
1gn2_A207 S123c Mutant Of The Iron-Superoxide Dismutase From 2e-42
1ids_A207 X-Ray Structure Analysis Of The Iron-Dependent Supe 2e-42
1gn6_A207 G152a Mutant Of Mycobacterium Tuberculosis Iron-Sup 3e-42
3ak1_A214 Superoxide Dismutase From Aeropyrum Pernix K1, Apo- 2e-41
3esf_A197 Crystal Structure Of The Enzyme Fe-Superoxide Dismu 4e-41
1xil_A198 Hydrogen Bonding In Human Manganese Superoxide Dism 5e-41
1xdc_A198 Hydrogen Bonding In Human Manganese Superoxide Dism 2e-40
3lsu_A207 Crystal Structure Of Sod2 From Saccharomyces Cerevi 2e-38
3js4_A227 Crystal Structure Of Iron Superoxide Dismutase From 6e-38
2gpc_A194 The Crystal Structure Of The Enzyme Fe-Superoxide D 8e-38
1wb8_A210 Iron Superoxide Dismutase (Fe-Sod) From The Hyperth 3e-37
2cw3_A280 X-Ray Structure Of Pmsod2, Superoxide Dismutase Fro 1e-36
1wb7_A210 Iron Superoxide Dismutase (Fe-Sod) From The Hyperth 2e-36
3cei_A213 Crystal Structure Of Superoxide Dismutase From Heli 4e-36
1b06_A210 Superoxide Dismutase From Sulfolobus Acidocaldarius 5e-35
1p7g_A222 Crystal Structure Of Superoxide Dismutase From Pyro 2e-34
1coj_A212 Fe-Sod From Aquifex Pyrophilus, A Hyperthermophilic 3e-28
gi|310942702|pdb|3KKY|A Chain A, Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans In The Orthorhombic Space Group P212121: A Case Study Of Mistaken Identity Length = 211 Back     alignment and structure
 Score =  216 bits (551), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 91/212 (42%), Positives = 123/212 (58%), Gaps = 14/212 (6%)

Query: 1   MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIK- 59
           M + LP LPY+YD L P++   T+E HH  HH+ Y DNA K     E   L +E++I + 
Sbjct: 1   MAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQL 60

Query: 60  ---SHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQ---ALSDAIDDNFGSFEKFKS 113
                     L NNA  + NH++FW  M +  G+    Q    L DAI+  FGSF+ FK 
Sbjct: 61  DRVPADKKGALRNNAGGHANHSMFWQIMGQGQGQNGANQPSGELLDAINSAFGSFDAFKQ 120

Query: 114 DLITAASTQFGSGWGWLSVKNGKLEISKTQNAENPLING------AIPILGIDVWEHAYY 167
               AA T+FGSGW WL VK+GKL++  T N +NPL+          PILG+DVWEHAYY
Sbjct: 121 KFEDAAKTRFGSGWAWLVVKDGKLDVVSTANQDNPLMGEAIAGVSGTPILGVDVWEHAYY 180

Query: 168 LDFKYRRAHYIESFITNLVNWEYVCERYETAM 199
           L+++ RR  Y+ +F  N+VNW+ V +RY  A 
Sbjct: 181 LNYQNRRPDYLAAF-WNVVNWDEVSKRYAAAK 211


>gi|61679581|pdb|1Y67|A Chain A, Crystal Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans Length = 229 Back     alignment and structure
>gi|90109118|pdb|2CDY|A Chain A, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus Radiodurans Length = 231 Back     alignment and structure
>gi|168988704|pdb|2RCV|A Chain A, Crystal Structure Of The Bacillus Subtilis Superoxide Dismutase Length = 202 Back     alignment and structure
>gi|73535546|pdb|1XUQ|A Chain A, Crystal Structure Of Soda-1 (Ba4499) From Bacillus Anthracis At 1.8a Resolution. Length = 212 Back     alignment and structure
>gi|34810954|pdb|1MY6|A Chain A, The 1.6 A Structure Of Fe-Superoxide Dismutase From The Thermophilic Cyanobacterium Thermosynechococcus Elongatus : Correlation Of Epr And Structural Characteristics Length = 199 Back     alignment and structure
>gi|23200074|pdb|1GV3|A Chain A, The 2.0 Angstrom Resolution Structure Of The Catalytic Portion Of A Cyanobacterial Membrane-Bound Manganese Superoxide Dismutase Length = 248 Back     alignment and structure
>gi|12084342|pdb|1DT0|A Chain A, Cloning, Sequence, And Crystallographic Structure Of Recombinant Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 197 Back     alignment and structure
>gi|3212626|pdb|1VEW|A Chain A, Manganese Superoxide Dismutase From Escherichia Coli Length = 205 Back     alignment and structure
>gi|14719528|pdb|1EN6|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146l Mutant Length = 205 Back     alignment and structure
>gi|13399622|pdb|1I0H|A Chain A, Crystal Structure Of The E. Coli Manganese Superoxide Dismutase Mutant Y174f At 1.35 Angstroms Resolution. Length = 205 Back     alignment and structure
>gi|14719520|pdb|1EN4|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146h Mutant Length = 205 Back     alignment and structure
gi|24987870|pdb|1N0J|A Chain A, The Structure Of Human Mitochondrial Mn3+ Superoxide Dismutase Reveals A Novel Tetrameric Interface Of Two 4- Helix Bundles Length = 199 Back     alignment and structure
gi|494880|pdb|3MDS|A Chain A, Maganese Superoxide Dismutase From Thermus Thermophilus Length = 203 Back     alignment and structure
gi|23200182|pdb|1JR9|A Chain A, Crystal Structure Of Manganese Superoxide Dismutases From Bacillus Halodenitrificans Length = 202 Back     alignment and structure
>gi|14719524|pdb|1EN5|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Y34f Mutant Length = 205 Back     alignment and structure
>gi|349942|pdb|3SDP|A Chain A, The 2.1 Angstroms Resolution Structure Of Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 195 Back     alignment and structure
>gi|110591072|pdb|2CW2|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Marinus Length = 226 Back     alignment and structure
gi|443133|pdb|1MSD|A Chain A, Comparison Of The Crystal Structures Of Genetically Engineered Human Manganese Superoxide Dismutase And Manganese Superoxide Dismutase From Thermus Thermophilus. Differences In Dimer-Dimer Interactions. Length = 198 Back     alignment and structure
>gi|1633498|pdb|1VAR|A Chain A, Mitochondrial Manganese Superoxide Dismutase Variant With Ile 58 Replaced By Thr Length = 198 Back     alignment and structure
>gi|13399618|pdb|1I08|A Chain A, Crystal Structure Analysis Of The H30a Mutant Of Manganese Superoxide Dismutase From E. Coli Length = 205 Back     alignment and structure
>gi|7546411|pdb|1EM1|A Chain A, X-Ray Crystal Structure For Human Manganese Superoxide Dismutase, Q143a Length = 198 Back     alignment and structure
>gi|2780818|pdb|1QNM|A Chain A, Human Manganese Superoxide Dismutase Mutant Q143n Length = 198 Back     alignment and structure
>gi|40889314|pdb|1PL4|A Chain A, Crystal Structure Of Human Mnsod Y166f Mutant Length = 198 Back     alignment and structure
>gi|24987872|pdb|1N0N|A Chain A, Catalytic And Structural Effects Of Amino-Acid Substitution At His30 In Human Manganese Superoxide Dismutase Length = 199 Back     alignment and structure
>gi|640114|pdb|1ISA|A Chain A, Structure-Function In E. Coli Iron Superoxide Dismutase: Comparisons With The Manganese Enzyme From T. Thermophilus Length = 192 Back     alignment and structure
>gi|119390689|pdb|2NYB|A Chain A, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e At 1.1 Angstrom Resolution Length = 192 Back     alignment and structure
>gi|185177923|pdb|3C3T|A Chain A, Role Of A Glutamate Bridge Spanning The Dimeric Interface Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>gi|48425747|pdb|1SZX|A Chain A, Role Of Hydrogen Bonding In The Active Site Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>gi|93278547|pdb|1ZA5|A Chain A, Q69h-Fesod Length = 192 Back     alignment and structure
>gi|194708958|pdb|2QKC|A Chain A, Structural And Kinetic Study Of The Differences Between Human And E.Coli Manganese Superoxide Dismutases Length = 196 Back     alignment and structure
>gi|194708956|pdb|2QKA|A Chain A, Structural And Kinetic Study Of The Differences Between Human And E.Coli Manganese Superoxide Dismutases Length = 196 Back     alignment and structure
>gi|2914414|pdb|1AP5|A Chain A, Tyr34->phe Mutant Of Human Mitochondrial Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>gi|185177921|pdb|3C3S|A Chain A, Role Of A Glutamate Bridge Spanning The Dimeric Interface Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>gi|99031752|pdb|1ZUQ|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>gi|21730859|pdb|1LUW|A Chain A, Catalytic And Structural Effects Of Amino-Acid Substitution At His 30 In Human Manganese Superoxide Dismutase: Insertion Of Val Cgamma Into The Substrate Access Channel Length = 198 Back     alignment and structure
>gi|99031743|pdb|1ZSP|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>gi|93279976|pdb|2GDS|A Chain A, Interrupting The Hydrogen Bonding Network At The Active Site Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>gi|14488599|pdb|1JA8|A Chain A, Kinetic Analysis Of Product Inhibition In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>gi|110590806|pdb|2ADP|A Chain A, Nitrated Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>gi|99031748|pdb|1ZTE|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Suerpoxide Dismutase Length = 198 Back     alignment and structure
gi|23200495|pdb|1MA1|A Chain A, Structure And Properties Of The Atypical Iron Superoxide Dismutase From Methanobacterium Thermoautotrophicum Length = 205 Back     alignment and structure
>gi|40889321|pdb|1PM9|A Chain A, Crystal Structure Of Human Mnsod H30n, Y166f Mutant Length = 198 Back     alignment and structure
>gi|229597962|pdb|3H1S|A Chain A, Crystal Structure Of Superoxide Dismutase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 195 Back     alignment and structure
>gi|145580455|pdb|2P4K|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
gi|9257063|pdb|1QNN|A Chain A, Cambialistic Superoxide Dismutase From Porphyromonas Gingivalis Length = 191 Back     alignment and structure
>gi|18158810|pdb|1KKC|A Chain A, Crystal Structure Of Aspergillus Fumigatus Mnsod Length = 221 Back     alignment and structure
>gi|49259339|pdb|1UES|A Chain A, Crystal Structure Of Porphyromonas Gingivalis Sod Length = 191 Back     alignment and structure
gi|306440523|pdb|3LIO|A Chain A, X-Ray Structure Of The Iron Superoxide Dismutase From Pseudoalteromonas Haloplanktis (Crystal Form I) Length = 192 Back     alignment and structure
gi|2624606|pdb|1AR4|A Chain A, X-Ray Structure Analysis Of The Cambialistic Superoxide Dismutase From Propionibacterium Shermanii Active With Fe Or Mn Length = 201 Back     alignment and structure
>gi|73535536|pdb|1XRE|A Chain A, Crystal Structure Of Soda-2 (Ba5696) From Bacillus Anthracis At 1.8a Resolution. Length = 217 Back     alignment and structure
>gi|239781783|pdb|3DC6|A Chain A, Crystal Structure Of A Manganese Superoxide Dismutases From Caenorhabditis Elegans Length = 198 Back     alignment and structure
gi|223673836|pdb|2W7W|A Chain A, The Crystal Structure Of Iron Superoxide Dismutase From Aliivibrio Salmonicida. Length = 194 Back     alignment and structure
>gi|56554197|pdb|1UNF|X Chain X, The Crystal Structure Of The Eukaryotic Fesod From Vigna Unguiculata Suggests A New Enzymatic Mechanism Length = 238 Back     alignment and structure
gi|78101475|pdb|2AWP|A Chain A, Crystal Structure Of Plasmodium Knowlesi Structure Of Iron Super-Oxide Dismutase Length = 198 Back     alignment and structure
>gi|71042573|pdb|2A03|A Chain A, Superoxide Dismutase Protein From Plasmodium Berghei Length = 206 Back     alignment and structure
>gi|118137360|pdb|2BPI|A Chain A, Stucture Of Iron Dependent Superoxide Dismutase From P. Falciparum. Length = 206 Back     alignment and structure
>gi|256599618|pdb|3EVK|A Chain A, Crystal Structure Of The Metal-Bound Superoxide Dismutase From Pyrobaculum Aerophilum Length = 222 Back     alignment and structure
>gi|217035334|pdb|3BFR|A Chain A, The Crystal Structure Of Sod2 From Saccharomyces Cerevisiae Length = 215 Back     alignment and structure
>gi|239781781|pdb|3DC5|A Chain A, Crystal Structure Of A Manganese Superoxide Dismutases From Caenorhabditis Elegans Length = 195 Back     alignment and structure
>gi|16975374|pdb|1GN3|A Chain A, H145q Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>gi|16975376|pdb|1GN4|A Chain A, H145e Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>gi|158428654|pdb|2GOJ|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Plasmodium Falciparum Length = 197 Back     alignment and structure
>gi|16975366|pdb|1GN2|A Chain A, S123c Mutant Of The Iron-Superoxide Dismutase From Mycobacterium Tuberculosis. Length = 207 Back     alignment and structure
gi|809161|pdb|1IDS|A Chain A, X-Ray Structure Analysis Of The Iron-Dependent Superoxide Dismutase From Mycobacterium Tuberculosis At 2.0 Angstroms Resolutions Reveals Novel Dimer-Dimer Interactions Length = 207 Back     alignment and structure
>gi|16975380|pdb|1GN6|A Chain A, G152a Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
gi|321159636|pdb|3AK1|A Chain A, Superoxide Dismutase From Aeropyrum Pernix K1, Apo-Form Length = 214 Back     alignment and structure
>gi|237640521|pdb|3ESF|A Chain A, Crystal Structure Of The Enzyme Fe-Superoxide Dismutase Tbsodb2 From Trypanosoma Brucei Length = 197 Back     alignment and structure
>gi|62738433|pdb|1XIL|A Chain A, Hydrogen Bonding In Human Manganese Superoxide Dismutase Containing 3-Fluorotyrosine Length = 198 Back     alignment and structure
>gi|62738405|pdb|1XDC|A Chain A, Hydrogen Bonding In Human Manganese Superoxide Dismutase Containing 3-Fluorotyrosine Length = 198 Back     alignment and structure
>gi|323714460|pdb|3LSU|A Chain A, Crystal Structure Of Sod2 From Saccharomyces Cerevisiae Length = 207 Back     alignment and structure
>gi|259090389|pdb|3JS4|A Chain A, Crystal Structure Of Iron Superoxide Dismutase From Anaplasma Phagocytophilum Length = 227 Back     alignment and structure
>gi|158428656|pdb|2GPC|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Trypanosoma Cruzi Length = 194 Back     alignment and structure
>gi|56966751|pdb|1WB8|A Chain A, Iron Superoxide Dismutase (Fe-Sod) From The Hyperthermophile Sulfolobus Solfataricus. 2.3 A Resolution Structure Of Recombinant Protein With A Covalently Modified Tyrosin In The Active Site. Length = 210 Back     alignment and structure
gi|110591074|pdb|2CW3|A Chain A, X-Ray Structure Of Pmsod2, Superoxide Dismutase From Perkinsus Marinus Length = 280 Back     alignment and structure
>gi|56966749|pdb|1WB7|A Chain A, Iron Superoxide Dismutase (Fe-Sod) From The Hyperthermophile Sulfolobus Solfataricus. Crystal Structure Of The Y41f Mutant. Length = 210 Back     alignment and structure
>gi|190016323|pdb|3CEI|A Chain A, Crystal Structure Of Superoxide Dismutase From Helicobacter Pylori Length = 213 Back     alignment and structure
>gi|6573494|pdb|1B06|A Chain A, Superoxide Dismutase From Sulfolobus Acidocaldarius Length = 210 Back     alignment and structure
>gi|39654426|pdb|1P7G|A Chain A, Crystal Structure Of Superoxide Dismutase From Pyrobaculum Aerophilum Length = 222 Back     alignment and structure
>gi|5542211|pdb|1COJ|A Chain A, Fe-Sod From Aquifex Pyrophilus, A Hyperthermophilic Bacterium Length = 212 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 superoxide dismutase [Candidatus Liberibacter asiaticus
3cei_A213 Superoxide dismutase; oxidoreductase; 2.40A {Helicobact 4e-60
1gv3_A248 Manganese superoxide dismutase; anabaena PCC 7120,; 2.0 7e-55
1p7g_A222 Superoxide dismutase; alpha-beta, oxidoreductase; 1.80A 2e-53
1kkc_A221 Mnsod, manganese superoxide dismutase; homotetramer, ox 2e-52
1my6_A199 Iron (III) superoxide dismutase; iron speroxide dismuta 4e-52
1ids_A207 Iron superoxide dismutase; 2.00A {Mycobacterium tubercu 4e-52
1mng_A203 Manganese superoxide dismutase; oxidoreductase(superoxi 5e-52
3kky_A211 Mnsod, superoxide dismutase [MN]; manganese, ME binding 7e-52
1ma1_A205 Superoxide dismutase; metal specificity, azide inhibiti 2e-51
1xre_A217 SODA-2, superoxide dismutase; spine, oxidoreductase; 1. 3e-51
1ix9_A205 Mnsod, superoxide dismutase; manganese superoxide dismu 3e-50
3bfr_A215 Superoxide dismutase [MN]; alpha/beta fold, manganese, 1e-49
3dc5_A195 Superoxide dismutase [MN] 2; alpha hairpin N domain, al 1e-49
2rcv_A202 Superoxide dismutase [MN]; bacillus subtilis,superoxide 2e-49
1pl4_A198 Superoxide dismutase [MN], mitochondrial; oxidoreductas 4e-49
3lio_A192 Iron superoxide dismutase; cold adaptation, flexibility 7e-49
3js4_A227 Superoxide dismutase; niaid, ssgcid, seattle structural 1e-48
1y67_A229 Mnsod, manganese superoxide dismutase; manganese enzyme 1e-48
2cw3_A280 Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50 5e-48
1unf_X238 Iron superoxide dismutase; oxidoreductase, eukaryotic, 5e-48
1dt0_A197 Superoxide dismutase; pseudomonas ovalis; 2.10A {Pseudo 2e-47
2cw2_A226 Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Per 1e-45
2nyb_A192 Superoxide dismutase [FE]; iron superoxide dismutase Q6 2e-45
1uer_A191 SOD, superoxide dismutase; metal-specific, cambialistic 7e-44
2awp_A198 Iron super-oxide dismutase; structural genomics, struct 9e-44
1bsm_A201 Superoxide dismutase; oxidoreductase; 1.35A {Propioniba 3e-41
1b06_A210 Protein (superoxide dismutase); 2.20A {Sulfolobus acido 4e-40
3h1s_A195 Superoxide dismutase; SOBD, csgid, oxidoreductase, stru 1e-39
1coj_A212 Protein (superoxide dismutase); oxidoreductase; 1.90A { 5e-37
2gpc_A194 Iron superoxide dismutase; alpha+beta structure, oxidor 1e-36
>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Length = 213 Back     alignment and structure
 Score =  226 bits (577), Expect = 4e-60
 Identities = 77/199 (38%), Positives = 112/199 (56%), Gaps = 8/199 (4%)

Query: 3   FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSHG 62
           F L  LP++ D +  ++S    ++HH  HH+ Y +N   L    +    SL  I+ KS G
Sbjct: 2   FTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSG 61

Query: 63  SNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQ 122
              G+FNNA+Q YNH+ +W C+               A++ +FGS EKFK D I +A+T 
Sbjct: 62  ---GVFNNAAQIYNHDFYWDCLSPKATALSDELK--GALEKDFGSLEKFKEDFIKSATTL 116

Query: 123 FGSGWGWLSV--KNGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHYIES 180
           FGSGW W +      K+EI +T NA+ P+ +  +P+L +DVWEHAYY+D K  R  Y+E 
Sbjct: 117 FGSGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEK 176

Query: 181 FITNLVNWEYVCERYETAM 199
           F    +NW +V + YE A 
Sbjct: 177 FY-GHINWHFVSQCYEWAK 194


>1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Length = 248 Back     alignment and structure
>1p7g_A Superoxide dismutase; alpha-beta, oxidoreductase; 1.80A {Pyrobaculum aerophilum} SCOP: a.2.11.1 d.44.1.1 PDB: 3evk_A Length = 222 Back     alignment and structure
>1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Length = 221 Back     alignment and structure
>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Length = 199 Back     alignment and structure
>1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Length = 207 Back     alignment and structure
>1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Length = 203 Back     alignment and structure
>3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Length = 211 Back     alignment and structure
>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Length = 205 Back     alignment and structure
>1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Length = 217 Back     alignment and structure
>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 1en5_A 1en4_A 1i08_A 1en6_A Length = 205 Back     alignment and structure
>3bfr_A Superoxide dismutase [MN]; alpha/beta fold, manganese, metal-binding, mitochondrion, oxidoreductase, transit peptide; 2.05A {Saccharomyces cerevisiae} Length = 215 Back     alignment and structure
>3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Length = 195 Back     alignment and structure
>2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Length = 202 Back     alignment and structure
>1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Length = 198 Back     alignment and structure
>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Length = 192 Back     alignment and structure
>3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infectious disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum HZ} Length = 227 Back     alignment and structure
>1y67_A Mnsod, manganese superoxide dismutase; manganese enzyme, metalloprotein, oxidoreductase; 1.85A {Deinococcus radiodurans} SCOP: a.2.11.1 d.44.1.1 PDB: 2aw9_A 2cdy_A 2ce4_A Length = 229 Back     alignment and structure
>2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Length = 280 Back     alignment and structure
>1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Length = 238 Back     alignment and structure
>1dt0_A Superoxide dismutase; pseudomonas ovalis; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 PDB: 3sdp_A Length = 197 Back     alignment and structure
>2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Length = 226 Back     alignment and structure
>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Length = 192 Back     alignment and structure
>1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Length = 191 Back     alignment and structure
>2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Length = 198 Back     alignment and structure
>1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichiisubsp} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Length = 201 Back     alignment and structure
>1b06_A Protein (superoxide dismutase); 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Length = 210 Back     alignment and structure
>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structural genomics, national institute of allergy and infectious diseases; 1.90A {Francisella tularensis subsp} Length = 195 Back     alignment and structure
>1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Length = 212 Back     alignment and structure
>2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Length = 194 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 superoxide dismutase [Candidatus Liberibacter asiaticus
1gv3_A248 Manganese superoxide dismutase; anabaena PCC 7120,; 2.0 100.0
1unf_X238 Iron superoxide dismutase; oxidoreductase, eukaryotic, 100.0
2rcv_A202 Superoxide dismutase [MN]; bacillus subtilis,superoxide 100.0
1my6_A199 Iron (III) superoxide dismutase; iron speroxide dismuta 100.0
1xre_A217 SODA-2, superoxide dismutase; spine, oxidoreductase; 1. 100.0
2cw2_A226 Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Per 100.0
3js4_A227 Superoxide dismutase; niaid, ssgcid, seattle structural 100.0
3h1s_A195 Superoxide dismutase; SOBD, csgid, oxidoreductase, stru 100.0
2cw3_A280 Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50 100.0
1ids_A207 Iron superoxide dismutase; 2.00A {Mycobacterium tubercu 100.0
1bsm_A201 Superoxide dismutase; oxidoreductase; 1.35A {Propioniba 100.0
1mng_A203 Manganese superoxide dismutase; oxidoreductase(superoxi 100.0
1ix9_A205 Mnsod, superoxide dismutase; manganese superoxide dismu 100.0
3cei_A213 Superoxide dismutase; oxidoreductase; 2.40A {Helicobact 100.0
1b06_A210 Protein (superoxide dismutase); oxidoreductase; 2.20A { 100.0
1dt0_A197 Superoxide dismutase; pseudomonas ovalis, oxidoreductas 100.0
1p7g_A222 Superoxide dismutase; alpha-beta, oxidoreductase; 1.80A 100.0
1ma1_A205 Superoxide dismutase; metal specificity, azide inhibiti 100.0
1uer_A191 SOD, superoxide dismutase; metal-specific, cambialistic 100.0
2nyb_A192 Superoxide dismutase [FE]; iron superoxide dismutase Q6 100.0
3bfr_A215 Superoxide dismutase [MN]; alpha/beta fold, manganese, 100.0
2awp_A198 Iron super-oxide dismutase; structural genomics, struct 100.0
1pl4_A198 Superoxide dismutase [MN], mitochondrial; oxidoreductas 100.0
1kkc_A221 Mnsod, manganese superoxide dismutase; homotetramer, ox 100.0
3kky_A211 Mnsod, superoxide dismutase [MN]; manganese, ME binding 100.0
3lio_A192 Iron superoxide dismutase; cold adaptation, flexibility 100.0
3dc5_A195 Superoxide dismutase [MN] 2; alpha hairpin N domain, al 100.0
2gpc_A194 Iron superoxide dismutase; alpha+beta structure, oxidor 100.0
1coj_A212 Protein (superoxide dismutase); oxidoreductase; 1.90A { 100.0
>1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=514.78  Aligned_cols=200  Identities=36%  Similarity=0.734  Sum_probs=184.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCH-HHHHHHHHHHHHHHH----CCCHHHHHHHHHHHH
Q ss_conf             877999999865558646999999987328878998899985000-233200457897641----011145543322256
Q gi|254780495|r    2 DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDA-EMLHLSLEEIIIKSH----GSNAGLFNNASQYYN   76 (205)
Q Consensus         2 ~~~Lp~Lpy~~~aLeP~IS~~tl~~Hy~kHh~~YV~~lN~~~~~~-~~~~~~l~~~~~~~~----~~~~~~~nnagg~~n   76 (205)
                      +|+||||||+|+||||+||++||++||+|||+|||++||+++++. +....++++++....    ..+..++||+|||+|
T Consensus        37 ~~~LP~LPY~y~aLeP~IS~~tm~~Hh~kHh~gYV~~LN~~l~~~~~~~~~~l~~i~~~~~~~~~~~~~~v~nnagg~~N  116 (248)
T 1gv3_A           37 PAELPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNALKKHPELQNSSVEALLRDLNSVPEDIRTTVRNNGGGHLN  116 (248)
T ss_dssp             TCCCCCCSSCTTTTTTTSCHHHHHHHHHTHHHHHHHHHHHHHHTCGGGGGSCHHHHHHTGGGSCTTTHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87799998983524441699999999999999999999999971288764989999861343146778999988888877


Q ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECC-CCEEEEEECCCCCCCCCCCCCC
Q ss_conf             899985078888876406899999974308999999999998620143431001034-1012344314767540014785
Q gi|254780495|r   77 HNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIP  155 (205)
Q Consensus        77 H~lff~~l~p~~~~~~p~~~L~~~I~~~FGS~d~fk~~f~~~A~s~~GsGWvwL~~~-~~~L~i~~~~n~~~p~~~~~~P  155 (205)
                      |+|||+||+|+ +++.|++.|+++|+++|||+|+||++|+++|.++|||||||||++ +|+|.|++++||++|++.+.+|
T Consensus       117 H~lFw~~l~P~-g~~~P~g~L~~aI~~~FGS~d~fk~~F~~aa~~~fGSGWvwLv~~~~g~L~i~~t~n~~~p~~~~~~P  195 (248)
T 1gv3_A          117 HTIFWQIMSPD-GGGQPTGDIAQEINQTFGSFEEFKKQFNQAGGDRFGSGWVWLVRNPQGQLQVVSTPNQDNPIMEGSYP  195 (248)
T ss_dssp             HHHHHHTBCTT-CCSSCCHHHHHHHHHHHSSHHHHHHHHHHHHHHCCSSEEEEEEECTTSCEEEEEEETTCCGGGGTCEE
T ss_pred             HHHHHCCCCCC-CCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCEEEEEECCCCCCCCCCCEE
T ss_conf             99986144889-99999999999999874899999999999987275770799999899988999842777765679974


Q ss_pred             EEEEEHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHCC
Q ss_conf             356437687769875177499999998613598999999999997347
Q gi|254780495|r  156 ILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYETAMLAQK  203 (205)
Q Consensus       156 lL~iDvWEHAYylDY~n~r~~Yi~~f~~n~inW~~v~~r~~~a~~~~~  203 (205)
                      ||||||||||||+||||+|++||++| |++|||++|++||+.|.++++
T Consensus       196 lL~lDvWEHAYyldY~n~r~~Yi~~~-~~~inW~~v~~r~~~A~~~~~  242 (248)
T 1gv3_A          196 IMGNDVWEHAYYLRYQNRRPEYLNNW-WNVVNWSEINRRTQASRQSNS  242 (248)
T ss_dssp             EEEEECSGGGTHHHHTTCHHHHHHHG-GGGBCHHHHHHHHHHC-----
T ss_pred             EEEEEEHHHHHHHHHCCCHHHHHHHH-HHHCCHHHHHHHHHHHHHHCC
T ss_conf             79886355552887564789999999-974199999999999986465



>1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Back     alignment and structure
>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Back     alignment and structure
>3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infectious disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum HZ} Back     alignment and structure
>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structural genomics, national institute of allergy and infectious diseases; 1.90A {Francisella tularensis subsp} Back     alignment and structure
>2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Back     alignment and structure
>1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Back     alignment and structure
>1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichiisubsp} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Back     alignment and structure
>1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Back     alignment and structure
>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 1en5_A 1en4_A 1i08_A 1en6_A Back     alignment and structure
>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Back     alignment and structure
>1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius dsm 639} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Back     alignment and structure
>1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 PDB: 3sdp_A Back     alignment and structure
>1p7g_A Superoxide dismutase; alpha-beta, oxidoreductase; 1.80A {Pyrobaculum aerophilum} SCOP: a.2.11.1 d.44.1.1 PDB: 3evk_A Back     alignment and structure
>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Back     alignment and structure
>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Back     alignment and structure
>3bfr_A Superoxide dismutase [MN]; alpha/beta fold, manganese, metal-binding, mitochondrion, oxidoreductase, transit peptide; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Back     alignment and structure
>1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Back     alignment and structure
>1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Back     alignment and structure
>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Back     alignment and structure
>3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Back     alignment and structure
>2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Back     alignment and structure
>1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 205 superoxide dismutase [Candidatus Liberibacter asiaticus
d1my6a2110 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Th 8e-28
d1unfx2134 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {C 8e-28
d1jr9a2111 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Ba 2e-27
d1ma1a2113 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Ar 5e-27
d1gv3a2111 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {A 2e-26
d1coja2122 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aq 2e-26
d1wb8a2116 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Ar 3e-26
d1kkca2116 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {As 2e-25
d1bsma2115 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase { 2e-25
d1mnga2111 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Th 2e-25
d1y67a2116 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {De 3e-25
d1ix9a2115 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Es 4e-25
d1p7ga2119 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {A 9e-25
d1dt0a2114 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Ps 2e-24
d1uera2107 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase { 3e-24
d2p4ka2115 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Hu 1e-23
d2nyba2110 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Es 1e-23
d1idsa2114 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD) {My 3e-23
d1unfx191 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Co 2e-21
d1uera184 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Po 2e-21
d1ix9a190 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Esch 3e-20
d1mnga192 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Ther 9e-20
d1p7ga192 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD) {Ar 3e-19
d1wb8a189 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Arch 5e-19
d1gv3a1102 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD) {An 5e-19
d1my6a188 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Ther 7e-19
d1ma1a188 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) {Arch 7e-19
d1jr9a190 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Baci 8e-19
d2nyba182 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Esch 1e-18
d1bsma186 a.2.11.1 (A:1-86) Cambialistic superoxide dismutase {Pr 1e-18
d1kkca184 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) {Asp 2e-18
d1idsa184 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) {Myco 3e-18
d2p4ka183 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Huma 8e-17
d1coja189 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aqui 1e-12
>d1my6a2 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Length = 110 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Fe,Mn superoxide dismutase (SOD), C-terminal domain
superfamily: Fe,Mn superoxide dismutase (SOD), C-terminal domain
family: Fe,Mn superoxide dismutase (SOD), C-terminal domain
domain: Fe superoxide dismutase (FeSOD)
species: Thermosynechococcus elongatus [TaxId: 146786]
 Score =  117 bits (294), Expect = 8e-28
 Identities = 52/108 (48%), Positives = 78/108 (72%)

Query: 89  GKGKVPQALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVKNGKLEISKTQNAENP 148
           G G     ++  I+  FGS+++FK+    AA+TQFGSGW WL ++ G L+++KT NAENP
Sbjct: 2   GGGVPTGDVAARINSAFGSYDEFKAQFKNAAATQFGSGWAWLVLEAGTLKVTKTANAENP 61

Query: 149 LINGAIPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCERYE 196
           L++G +P+L IDVWEHAYYLD++ RR  +I++F+  LVNW++V +   
Sbjct: 62  LVHGQVPLLTIDVWEHAYYLDYQNRRPDFIDNFLNQLVNWDFVAKNLA 109


>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Length = 134 Back     information, alignment and structure
>d1jr9a2 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Length = 111 Back     information, alignment and structure
>d1ma1a2 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 113 Back     information, alignment and structure
>d1gv3a2 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Length = 111 Back     information, alignment and structure
>d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Length = 122 Back     information, alignment and structure
>d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 116 Back     information, alignment and structure
>d1kkca2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Length = 116 Back     information, alignment and structure
>d1bsma2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 115 Back     information, alignment and structure
>d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 111 Back     information, alignment and structure
>d1y67a2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} Length = 116 Back     information, alignment and structure
>d1ix9a2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1p7ga2 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 119 Back     information, alignment and structure
>d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]} Length = 114 Back     information, alignment and structure
>d1uera2 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 107 Back     information, alignment and structure
>d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2nyba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Length = 110 Back     information, alignment and structure
>d1idsa2 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 114 Back     information, alignment and structure
>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Length = 91 Back     information, alignment and structure
>d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 84 Back     information, alignment and structure
>d1ix9a1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Length = 90 Back     information, alignment and structure
>d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 92 Back     information, alignment and structure
>d1p7ga1 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 92 Back     information, alignment and structure
>d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 89 Back     information, alignment and structure
>d1gv3a1 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Length = 102 Back     information, alignment and structure
>d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Length = 88 Back     information, alignment and structure
>d1ma1a1 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 88 Back     information, alignment and structure
>d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Length = 90 Back     information, alignment and structure