254780496

254780496

integration host factor subunit alpha

GeneID in NCBI database:8209491Locus tag:CLIBASIA_01915
Protein GI in NCBI database:254780496Protein Accession:YP_003064909.1
Gene range:+(781420, 781764)Protein Length:114aa
Gene description:integration host factor subunit alpha
COG prediction:[L] Bacterial nucleoid DNA-binding protein
KEGG prediction:ihfA; integration host factor subunit alpha; K04764 integration host factor subunit alpha
SEED prediction:Integration host factor alpha subunit
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA structural proteins, bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MSKTITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVGRNLQTNQEVKIDPRRVVVFKASSILKKRIMDDMRGRKCNKDDVTSPSGSY
ccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEEEEEccccccccccccEEEEccccEEEEEccHHHHHHHHcccccccccccccccccccc
ccccEcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEEEEEccEEEEccccccEEEEccEEEEEEEEcHHHHHHHHHHcccccccccccccccccc
MSKTITRSDLVKSISkefglsrkdsTRFVTTLFNEICDSAVRGEAIKISSFATFHVkqkgsrvgrnlqtnqevkidprrVVVFKASSILKKRImddmrgrkcnkddvtspsgsy
msktitrsdlvksiskefglsrkdstrFVTTLFNEICDSAVRGEAIKISSFAtfhvkqkgsrvgrnlqtnqevkidprrvvvfkassilkkrimddmrgrkcnkddvtspsgsy
MSKTITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVGRNLQTNQEVKIDPRRVVVFKASSILKKRIMDDMRGRKCNKDDVTSPSGSY
***TITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQK******NLQTNQEVKIDPRRVVVFKASSIL*************************
********DLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVGRNLQTNQEVKIDPRRVVVFKASSILKKRIMDDMRG***************
*SKTITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVGRNLQTNQEVKIDPRRVVVFKASSILKKRIMDDM*****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKTITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVGRNLQTNQEVKIDPRRVVVFKASSILKKRIMDDMRGRKCNKDDVTSPSGSY
MSKTITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVGRNLQTNQEVKIDPRRVVVFKASSILKKRIMDDMRGRKCNKDDVTSPSGSY
MSKTITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVGRNLQTNQEVKIDPRRVVVFKASSILKKRIMDDMRGRKCNKDDVTSPSGSY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target114 integration host factor subunit alpha [Candidatus Liber
254780748100 integration host factor, beta subunit [Candidatus 0.003
>gi|254780748|ref|YP_003065161.1| integration host factor, beta subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 100 Back     alignment
 Score = 32.3 bits (72), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 5  ITRSDLVKSISKEFG-LSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRV 63
          + +S L+ +I+K+   L+ +D  + V  L  E+  +   G  ++I  F +F V+++ +R+
Sbjct: 1  MIKSSLIGTIAKKNPKLNYQDVEKIVNMLLEEMTQALANGGRVEIRGFGSFSVRKRAARL 60

Query: 64 GRNLQTNQEVKIDPRRVVVFKASSILKKRI 93
           R     + + ++ + V  F+A   LK+R+
Sbjct: 61 ARAPLAQKVISVEEKMVPFFRAGKNLKERL 90

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target114 integration host factor subunit alpha [Candidatus Liber
315122317110 integration host factor subunit alpha [Candidatus Liber 1 6e-39
110633500111 integration host factor subunit alpha [Mesorhizobium sp 1 1e-24
49475535108 integration host factor subunit alpha [Bartonella hense 1 2e-24
240850682104 integration host factor subunit alpha [Bartonella graha 1 4e-24
49474169104 integration host factor subunit alpha [Bartonella quint 1 4e-24
15964977112 integration host factor subunit alpha [Sinorhizobium me 1 6e-24
163868458107 integration host factor subunit alpha [Bartonella tribo 1 7e-24
319898983103 integration host factor alpha subunit [Bartonella clarr 1 1e-23
159184652112 integration host factor subunit alpha [Agrobacterium tu 1 1e-23
222148217112 integration host factor subunit alpha [Agrobacterium vi 1 1e-23
>gi|315122317|ref|YP_004062806.1| integration host factor subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 110 Back     alignment and organism information
 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/107 (75%), Positives = 93/107 (86%)

Query: 1   MSKTITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKG 60
           M+KTITRSDL KSISK FGLSRKDST FVTT+FNEICDSA RGEAIKISSFATF V++KG
Sbjct: 1   MNKTITRSDLAKSISKNFGLSRKDSTFFVTTVFNEICDSAARGEAIKISSFATFRVRKKG 60

Query: 61  SRVGRNLQTNQEVKIDPRRVVVFKASSILKKRIMDDMRGRKCNKDDV 107
            RVGRNLQTNQEV I  RRV+VFKAS +LKKRIMD++   +C ++D+
Sbjct: 61  PRVGRNLQTNQEVMIGSRRVMVFKASDVLKKRIMDELDNLECKEEDL 107


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110633500|ref|YP_673708.1| integration host factor subunit alpha [Mesorhizobium sp. BNC1] Length = 111 Back     alignment and organism information
>gi|49475535|ref|YP_033576.1| integration host factor subunit alpha [Bartonella henselae str. Houston-1] Length = 108 Back     alignment and organism information
>gi|240850682|ref|YP_002972082.1| integration host factor subunit alpha [Bartonella grahamii as4aup] Length = 104 Back     alignment and organism information
>gi|49474169|ref|YP_032211.1| integration host factor subunit alpha [Bartonella quintana str. Toulouse] Length = 104 Back     alignment and organism information
>gi|15964977|ref|NP_385330.1| integration host factor subunit alpha [Sinorhizobium meliloti 1021] Length = 112 Back     alignment and organism information
>gi|163868458|ref|YP_001609667.1| integration host factor subunit alpha [Bartonella tribocorum CIP 105476] Length = 107 Back     alignment and organism information
>gi|319898983|ref|YP_004159076.1| integration host factor alpha subunit [Bartonella clarridgeiae 73] Length = 103 Back     alignment and organism information
>gi|159184652|ref|NP_354199.2| integration host factor subunit alpha [Agrobacterium tumefaciens str. C58] Length = 112 Back     alignment and organism information
>gi|222148217|ref|YP_002549174.1| integration host factor subunit alpha [Agrobacterium vitis S4] Length = 112 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target114 integration host factor subunit alpha [Candidatus Liber
PRK0028599 PRK00285, ihfA, integration host factor subunit alpha; 2e-26
cd0059187 cd00591, HU_IHF, Integration host factor (IHF) and HU a 7e-19
COG077694 COG0776, HimA, Bacterial nucleoid DNA-binding protein [ 1e-18
TIGR0098796 TIGR00987, himA, integration host factor, alpha subunit 6e-18
smart0041190 smart00411, BHL, bacterial (prokaryotic) histone like d 4e-17
PRK0019994 PRK00199, ihfB, integration host factor subunit beta; R 3e-10
TIGR0098894 TIGR00988, hip, integration host factor, beta subunit 8e-10
PRK1066490 PRK10664, PRK10664, transcriptional regulator HU subuni 6e-07
PRK1075390 PRK10753, PRK10753, transcriptional regulator HU subuni 4e-06
pfam0021690 pfam00216, Bac_DNA_binding, Bacterial DNA-binding prote 1e-19
>gnl|CDD|178961 PRK00285, ihfA, integration host factor subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|29683 cd00591, HU_IHF, Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and higher-order nucleoprotein complex assembly Back     alignment and domain information
>gnl|CDD|31119 COG0776, HimA, Bacterial nucleoid DNA-binding protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130060 TIGR00987, himA, integration host factor, alpha subunit Back     alignment and domain information
>gnl|CDD|128689 smart00411, BHL, bacterial (prokaryotic) histone like domain Back     alignment and domain information
>gnl|CDD|178925 PRK00199, ihfB, integration host factor subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|130061 TIGR00988, hip, integration host factor, beta subunit Back     alignment and domain information
>gnl|CDD|170612 PRK10664, PRK10664, transcriptional regulator HU subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|138142 PRK10753, PRK10753, transcriptional regulator HU subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|143973 pfam00216, Bac_DNA_binding, Bacterial DNA-binding protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 114 integration host factor subunit alpha [Candidatus Liber
PRK00285100 ihfA integration host factor subunit alpha; Reviewed 99.95
PRK1066490 transcriptional regulator HU subunit beta; Provisional 99.95
PRK1075390 transcriptional regulator HU subunit alpha; Provisional 99.95
PRK0019991 ihfB integration host factor subunit beta; Reviewed 99.94
COG077694 HimA Bacterial nucleoid DNA-binding protein [DNA replic 99.94
smart0041190 BHL bacterial (prokaryotic) histone like domain. 99.93
pfam0021690 Bac_DNA_binding Bacterial DNA-binding protein. 99.93
TIGR0098894 hip integration host factor, beta subunit; InterPro: IP 99.91
cd0059187 HU_IHF Integration host factor (IHF) and HU are small h 99.9
TIGR0098796 himA integration host factor, alpha subunit; InterPro: 99.86
TIGR01201198 HU_rel DNA-binding protein, putative; InterPro: IPR0059 98.25
>PRK00285 ihfA integration host factor subunit alpha; Reviewed Back     alignment and domain information
>PRK10664 transcriptional regulator HU subunit beta; Provisional Back     alignment and domain information
>PRK10753 transcriptional regulator HU subunit alpha; Provisional Back     alignment and domain information
>PRK00199 ihfB integration host factor subunit beta; Reviewed Back     alignment and domain information
>COG0776 HimA Bacterial nucleoid DNA-binding protein [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00411 BHL bacterial (prokaryotic) histone like domain Back     alignment and domain information
>pfam00216 Bac_DNA_binding Bacterial DNA-binding protein Back     alignment and domain information
>TIGR00988 hip integration host factor, beta subunit; InterPro: IPR005685 Integration host factor (IHF) is a heterodimeric protein consisting of alpha (IPR005684 from INTERPRO) and beta subunits Back     alignment and domain information
>cd00591 HU_IHF Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and higher-order nucleoprotein complex assembly Back     alignment and domain information
>TIGR00987 himA integration host factor, alpha subunit; InterPro: IPR005684 Integration host factor (IHF) is a heterodimeric protein consisting of alpha and beta (IPR005685 from INTERPRO) subunits Back     alignment and domain information
>TIGR01201 HU_rel DNA-binding protein, putative; InterPro: IPR005902 This family of proteins is related to, but longer than, DNA-binding protein HU Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target114 integration host factor subunit alpha [Candidatus Liber
1hue_A90 Histone-Like Protein Length = 90 6e-23
2iif_A204 Single Chain Integration Host Factor Mutant Protein 7e-23
2iie_A204 Single Chain Integration Host Factor Protein (Scihf 1e-22
2o97_B90 Crystal Structure Of E. Coli Hu Heterodimer Length 5e-21
3rhi_A93 Dna-Binding Protein Hu From Bacillus Anthracis Leng 1e-20
1ihf_A99 Integration Host FactorDNA COMPLEX Length = 99 1e-20
1ihf_B94 Integration Host FactorDNA COMPLEX Length = 94 6e-20
1ouz_B94 Crystal Structure Of A Mutant Ihf (Betae44a) Comple 8e-20
1mul_A90 Crystal Structure Of The E. Coli Hu Alpha2 Protein 1e-18
1p51_A94 Anabaena Hu-Dna Cocrystal Structure (Ahu6) Length = 2e-18
1b8z_A90 Hu From Thermotoga Maritima Length = 90 6e-15
1riy_A90 Hu Mutant V42i From Thermotoga Maritima Length = 90 8e-15
3c4i_A99 Crystal Structure Analysis Of N Terminal Region Con 2e-14
2np2_A108 Hbb-Dna Complex Length = 108 1e-12
1exe_A99 Solution Structure Of A Mutant Of Transcription Fac 2e-12
1wtu_A99 Transcription Factor 1, Nmr, Minimized Average Stru 5e-11
2iif_A204 Single Chain Integration Host Factor Mutant Protein 6e-11
2iie_A204 Single Chain Integration Host Factor Protein (Scihf 8e-11
gi|1311345|pdb|1HUE|A Chain A, Histone-Like Protein Length = 90 Back     alignment and structure
 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 57/90 (63%)

Query: 5  ITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVG 64
          + +++L+ ++++  GLS+KD+T+ V  +F+ I ++  +G+ +++  F  F V+++ +R G
Sbjct: 1  MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKG 60

Query: 65 RNLQTNQEVKIDPRRVVVFKASSILKKRIM 94
          RN QT +E++I   +V  FK    LK  + 
Sbjct: 61 RNPQTGEEMEIPASKVPAFKPGKALKDAVK 90


>gi|134104523|pdb|2IIF|A Chain A, Single Chain Integration Host Factor Mutant Protein (Scihf2- K45ae) In Complex With Dna Length = 204 Back     alignment and structure
>gi|134104519|pdb|2IIE|A Chain A, Single Chain Integration Host Factor Protein (Scihf2) In Complex With Dna Length = 204 Back     alignment and structure
gi|134105079|pdb|2O97|B Chain B, Crystal Structure Of E. Coli Hu Heterodimer Length = 90 Back     alignment and structure
>gi|329666305|pdb|3RHI|A Chain A, Dna-Binding Protein Hu From Bacillus Anthracis Length = 93 Back     alignment and structure
gi|1942275|pdb|1IHF|A Chain A, Integration Host FactorDNA COMPLEX Length = 99 Back     alignment and structure
gi|1942276|pdb|1IHF|B Chain B, Integration Host FactorDNA COMPLEX Length = 94 Back     alignment and structure
>gi|34811460|pdb|1OUZ|B Chain B, Crystal Structure Of A Mutant Ihf (Betae44a) Complexed With A Variant H' Site (T44a) Length = 94 Back     alignment and structure
gi|34810779|pdb|1MUL|A Chain A, Crystal Structure Of The E. Coli Hu Alpha2 Protein Length = 90 Back     alignment and structure
gi|31615985|pdb|1P51|A Chain A, Anabaena Hu-Dna Cocrystal Structure (Ahu6) Length = 94 Back     alignment and structure
gi|7245986|pdb|1B8Z|A Chain A, Hu From Thermotoga Maritima Length = 90 Back     alignment and structure
>gi|58176578|pdb|1RIY|A Chain A, Hu Mutant V42i From Thermotoga Maritima Length = 90 Back     alignment and structure
>gi|222447026|pdb|3C4I|A Chain A, Crystal Structure Analysis Of N Terminal Region Containing The Dimerization Domain And Dna Binding Domain Of Hu Protein(Histone Like Protein-Dna Binding) From Mycobacterium Tuberculosis [h37rv] Length = 99 Back     alignment and structure
gi|134104949|pdb|2NP2|A Chain A, Hbb-Dna Complex Length = 108 Back     alignment and structure
>gi|11514467|pdb|1EXE|A Chain A, Solution Structure Of A Mutant Of Transcription Factor 1. Length = 99 Back     alignment and structure
gi|1942238|pdb|1WTU|A Chain A, Transcription Factor 1, Nmr, Minimized Average Structure Length = 99 Back     alignment and structure
>gi|134104523|pdb|2IIF|A Chain A, Single Chain Integration Host Factor Mutant Protein (Scihf2- K45ae) In Complex With Dna Length = 204 Back     alignment and structure
>gi|134104519|pdb|2IIE|A Chain A, Single Chain Integration Host Factor Protein (Scihf2) In Complex With Dna Length = 204 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target114 integration host factor subunit alpha [Candidatus Liber
2iie_A204 Integration HOST factor; DNA kinking, bending, U-turn, 2e-20
1owf_A99 IHF-alpha, integration HOST factor alpha-subunit; prote 3e-20
3c4i_A99 DNA-binding protein HU homolog; dimerization by four he 4e-19
1hue_A90 HU protein; DNA-binding; NMR {Geobacillus stearothermop 6e-19
1mul_A90 NS2, HU-2, DNA binding protein HU-alpha; histone-like; 6e-19
1owf_B94 IHF-beta, integration HOST factor beta-subunit; protein 1e-18
1p71_A94 DNA-binding protein HU; protein-DNA complex, DNA bendin 7e-18
1exe_A99 Transcription factor 1; beta ribbon ARMS, DNA-binding, 2e-17
1b8z_A90 Protein (histonelike protein HU); thermostable DNA bind 9e-17
2o97_B90 NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DN 5e-16
2np2_A108 HBB; protein-DNA complex, DNA-binding protein, DNA-bend 5e-15
>2iie_A Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Length = 204 Back     alignment and structure
 Score = 92.3 bits (229), Expect = 2e-20
 Identities = 32/103 (31%), Positives = 56/103 (54%)

Query: 1   MSKTITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKG 60
            S  +T++++ + +  + GLS++D+   V   F EI  +   GE +K+S F  F ++ K 
Sbjct: 43  GSGGLTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKN 102

Query: 61  SRVGRNLQTNQEVKIDPRRVVVFKASSILKKRIMDDMRGRKCN 103
            R GRN +T +++ I  RRVV F+    LK R+ +   G +  
Sbjct: 103 QRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENAGGGERIE 145


>1owf_A IHF-alpha, integration HOST factor alpha-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} SCOP: a.55.1.1 PDB: 1ouz_A 1ihf_A 1owg_A 2ht0_A Length = 99 Back     alignment and structure
>3c4i_A DNA-binding protein HU homolog; dimerization by four helix bundle interaction, DNA condensation; 2.04A {Mycobacterium tuberculosis} Length = 99 Back     alignment and structure
>1hue_A HU protein; DNA-binding; NMR {Geobacillus stearothermophilus} SCOP: a.55.1.1 PDB: 1huu_A Length = 90 Back     alignment and structure
>1mul_A NS2, HU-2, DNA binding protein HU-alpha; histone-like; HET: DNA; 2.30A {Escherichia coli} SCOP: a.55.1.1 PDB: 2o97_A Length = 90 Back     alignment and structure
>1owf_B IHF-beta, integration HOST factor beta-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} SCOP: a.55.1.1 PDB: 1ouz_B 2ht0_B 1ihf_B 1owg_B Length = 94 Back     alignment and structure
>1p71_A DNA-binding protein HU; protein-DNA complex, DNA bending, DNA binding protein/DNA complex; 1.90A {Anabaena SP} SCOP: a.55.1.1 PDB: 1p51_A 1p78_A Length = 94 Back     alignment and structure
>1exe_A Transcription factor 1; beta ribbon ARMS, DNA-binding, DNA-bending protein; NMR {Bacillus phage SPO1} SCOP: a.55.1.1 PDB: 1wtu_A Length = 99 Back     alignment and structure
>1b8z_A Protein (histonelike protein HU); thermostable DNA binding protein; 1.60A {Thermotoga maritima} SCOP: a.55.1.1 PDB: 1riy_A Length = 90 Back     alignment and structure
>2o97_B NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DNA structure, DNA supercoiling, E. coli; 2.45A {Escherichia coli} SCOP: a.55.1.1 Length = 90 Back     alignment and structure
>2np2_A HBB; protein-DNA complex, DNA-binding protein, DNA-bending protein, dnabii family, HU/IHF family, DNA binding protein/DNA complex; 3.02A {Borrelia burgdorferi} Length = 108 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target114 integration host factor subunit alpha [Candidatus Liber
2iie_A204 Integration HOST factor; DNA kinking, bending, U-turn, 99.94
1owf_A99 IHF-alpha, integration HOST factor alpha-subunit; prote 99.94
3c4i_A99 DNA-binding protein HU homolog; dimerization by four he 99.94
1p71_A94 DNA-binding protein HU; protein-DNA complex, DNA bendin 99.94
1owf_B94 IHF-beta, integration HOST factor beta-subunit; protein 99.93
2o97_B90 NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DN 99.93
1mul_A90 NS2, HU-2, DNA binding protein HU-alpha; histone-like; 99.93
2np2_A108 HBB; protein-DNA complex, DNA-binding protein, DNA-bend 99.92
1b8z_A90 Protein (histonelike protein HU); thermostable DNA bind 99.92
1hue_A90 HU protein; DNA-binding; NMR {Geobacillus stearothermop 99.92
1exe_A99 Transcription factor 1; beta ribbon ARMS, DNA-binding, 99.92
2iie_A204 Integration HOST factor; DNA kinking, bending, U-turn, 99.63
>2iie_A Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Back     alignment and structure
Probab=99.94  E-value=7.3e-27  Score=184.87  Aligned_cols=101  Identities=32%  Similarity=0.594  Sum_probs=96.2

Q ss_pred             CCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCCCCEEEECCCCEE
Q ss_conf             87666999999999971999999999999999999999755996000041699985026764306889888995688537
Q gi|254780496|r    2 SKTITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVGRNLQTNQEVKIDPRRVV   81 (114)
Q Consensus         2 ~~~mtK~eli~~ia~~~g~s~~~~~~~v~~~~~~i~~~L~~g~~V~l~gfGtF~~~~~~~R~~rNP~Tge~i~ip~k~~v   81 (114)
                      ..+|||+|||+.||+++|+++.+++.+|++|+++|.++|.+|++|+|+|||+|+++.+++|.||||+|||.++||++++|
T Consensus        44 ~~~mTK~ELi~~Ia~~tglSkkda~~ivd~f~d~I~e~L~~g~~V~L~gFGtF~vk~rkaR~grNPkTgE~i~IpakkvV  123 (204)
T 2iie_A           44 SGGLTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVV  123 (204)
T ss_dssp             SSSBCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHTTCEEEETTTEEEEEEEECCBCCBCTTTCCBCCBCCEEEE
T ss_pred             CCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEEEEEECCEEEECCCCCCEEEECCCCCE
T ss_conf             99736999999999986979999999999999999999864986988505789998875701058699988985486417


Q ss_pred             EECCCHHHHHHHHHHHCCCCC
Q ss_conf             761698999997311101334
Q gi|254780496|r   82 VFKASSILKKRIMDDMRGRKC  102 (114)
Q Consensus        82 ~Fkpsk~Lk~~in~~~~~~~~  102 (114)
                      +|+||+.||+.||+..++...
T Consensus       124 kFKpsK~LK~~VN~~~qge~v  144 (204)
T 2iie_A          124 TFRPGQKLKSRVENAGGGERI  144 (204)
T ss_dssp             EEEECHHHHHHHHHHCCCCCE
T ss_pred             EEECCHHHHHHHHCCCCCCCC
T ss_conf             981099999998587878765



>1owf_A IHF-alpha, integration HOST factor alpha-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} SCOP: a.55.1.1 PDB: 1ouz_A 1ihf_A 1owg_A 2ht0_A Back     alignment and structure
>3c4i_A DNA-binding protein HU homolog; dimerization by four helix bundle interaction, DNA condensation; 2.04A {Mycobacterium tuberculosis} Back     alignment and structure
>1p71_A DNA-binding protein HU; protein-DNA complex, DNA bending, DNA binding protein/DNA complex; 1.90A {Anabaena SP} SCOP: a.55.1.1 PDB: 1p51_A 1p78_A Back     alignment and structure
>1owf_B IHF-beta, integration HOST factor beta-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} SCOP: a.55.1.1 PDB: 1ouz_B 2ht0_B 1ihf_B 1owg_B Back     alignment and structure
>2o97_B NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DNA structure, DNA supercoiling, E. coli; 2.45A {Escherichia coli} SCOP: a.55.1.1 Back     alignment and structure
>1mul_A NS2, HU-2, DNA binding protein HU-alpha; histone-like; HET: DNA; 2.30A {Escherichia coli} SCOP: a.55.1.1 PDB: 2o97_A Back     alignment and structure
>2np2_A HBB; protein-DNA complex, DNA-binding protein, DNA-bending protein, dnabii family, HU/IHF family, DNA binding protein/DNA complex; 3.02A {Borrelia burgdorferi} Back     alignment and structure
>1b8z_A Protein (histonelike protein HU); thermostable DNA binding protein; 1.60A {Thermotoga maritima} SCOP: a.55.1.1 PDB: 1riy_A Back     alignment and structure
>1hue_A HU protein; DNA-binding; NMR {Geobacillus stearothermophilus} SCOP: a.55.1.1 PDB: 1huu_A Back     alignment and structure
>1exe_A Transcription factor 1; beta ribbon ARMS, DNA-binding, DNA-bending protein; NMR {Bacillus phage SPO1} SCOP: a.55.1.1 PDB: 1wtu_A Back     alignment and structure
>2iie_A Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 114 integration host factor subunit alpha [Candidatus Liber
d1owfa_96 a.55.1.1 (A:) Integration host factor alpha subunit (IH 7e-19
d1mula_90 a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562] 2e-18
d1huua_90 a.55.1.1 (A:) HU protein {Bacillus stearothermophilus [ 4e-18
d1b8za_90 a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2 8e-18
d1exea_99 a.55.1.1 (A:) Transcription factor 1, TF1 {Bacteriophag 1e-17
d1p71a_94 a.55.1.1 (A:) HU protein {Anabaena sp. [TaxId: 1167]} L 2e-17
d2o97b190 a.55.1.1 (B:1-90) HU protein {Escherichia coli, beta-is 1e-16
d1owfb_94 a.55.1.1 (B:) Integration host factor beta subunit (IHF 9e-16
>d1owfa_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]} Length = 96 Back     information, alignment and structure

class: All alpha proteins
fold: IHF-like DNA-binding proteins
superfamily: IHF-like DNA-binding proteins
family: Prokaryotic DNA-bending protein
domain: Integration host factor alpha subunit (IHFA)
species: Escherichia coli [TaxId: 562]
 Score = 86.4 bits (214), Expect = 7e-19
 Identities = 30/89 (33%), Positives = 52/89 (58%)

Query: 5  ITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVG 64
          +T++++ + +  + GLS++D+   V   F EI  +   GE +K+S F  F ++ K  R G
Sbjct: 2  LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPG 61

Query: 65 RNLQTNQEVKIDPRRVVVFKASSILKKRI 93
          RN +T +++ I  RRVV F+    LK R+
Sbjct: 62 RNPKTGEDIPITARRVVTFRPGQKLKSRV 90


>d1mula_ a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562]} Length = 90 Back     information, alignment and structure
>d1huua_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus [TaxId: 1422]} Length = 90 Back     information, alignment and structure
>d1b8za_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]} Length = 90 Back     information, alignment and structure
>d1exea_ a.55.1.1 (A:) Transcription factor 1, TF1 {Bacteriophage SPO1 [TaxId: 10685]} Length = 99 Back     information, alignment and structure
>d1p71a_ a.55.1.1 (A:) HU protein {Anabaena sp. [TaxId: 1167]} Length = 94 Back     information, alignment and structure
>d2o97b1 a.55.1.1 (B:1-90) HU protein {Escherichia coli, beta-isoform [TaxId: 562]} Length = 90 Back     information, alignment and structure
>d1owfb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]} Length = 94 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target114 integration host factor subunit alpha [Candidatus Liber
d1p71a_94 HU protein {Anabaena sp. [TaxId: 1167]} 99.94
d1owfa_96 Integration host factor alpha subunit (IHFA) {Escherich 99.93
d2o97b190 HU protein {Escherichia coli, beta-isoform [TaxId: 562] 99.93
d1owfb_94 Integration host factor beta subunit (IHFB) {Escherichi 99.93
d1mula_90 HU protein {Escherichia coli [TaxId: 562]} 99.93
d1exea_99 Transcription factor 1, TF1 {Bacteriophage SPO1 [TaxId: 99.92
d1b8za_90 HU protein {Thermotoga maritima [TaxId: 2336]} 99.92
d1huua_90 HU protein {Bacillus stearothermophilus [TaxId: 1422]} 99.92
>d1p71a_ a.55.1.1 (A:) HU protein {Anabaena sp. [TaxId: 1167]} Back     information, alignment and structure
class: All alpha proteins
fold: IHF-like DNA-binding proteins
superfamily: IHF-like DNA-binding proteins
family: Prokaryotic DNA-bending protein
domain: HU protein
species: Anabaena sp. [TaxId: 1167]
Probab=99.94  E-value=9.4e-27  Score=182.71  Aligned_cols=92  Identities=21%  Similarity=0.520  Sum_probs=90.6

Q ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCCCCEEEECCCCEEEEC
Q ss_conf             66999999999971999999999999999999999755996000041699985026764306889888995688537761
Q gi|254780496|r    5 ITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVGRNLQTNQEVKIDPRRVVVFK   84 (114)
Q Consensus         5 mtK~eli~~ia~~~g~s~~~~~~~v~~~~~~i~~~L~~g~~V~l~gfGtF~~~~~~~R~~rNP~Tge~i~ip~k~~v~Fk   84 (114)
                      |||+|||+.||+++|+++.+++.++++|+++|.++|..|++|+|+|||+|+++.+++|.||||+|||.+.||++++|+|+
T Consensus         1 M~K~eli~~ia~~~~ls~~~~~~~v~~~~~~i~~~L~~~~~V~l~~fG~F~~~~~~~R~grNP~Tge~i~ip~k~~v~Fk   80 (94)
T d1p71a_           1 MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREGRNPKTNEKMEIPATRVPAFS   80 (94)
T ss_dssp             CBHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHTTCCEEETTTEEEEEEEECCEEEECTTTCCEEEECCEEEEEEE
T ss_pred             CCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEECEEEEEEEECCCCEEECCCCCCEEEECCCCEEEEE
T ss_conf             97899999999855969999999999999999999845997999343789888236630488999988986287208995


Q ss_pred             CCHHHHHHHHHH
Q ss_conf             698999997311
Q gi|254780496|r   85 ASSILKKRIMDD   96 (114)
Q Consensus        85 psk~Lk~~in~~   96 (114)
                      ||+.|++.||..
T Consensus        81 ~sk~Lk~~vN~~   92 (94)
T d1p71a_          81 AGKLFREKVAPP   92 (94)
T ss_dssp             ECHHHHHHHSCC
T ss_pred             CCHHHHHHHCCC
T ss_conf             599999976778



>d1owfa_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o97b1 a.55.1.1 (B:1-90) HU protein {Escherichia coli, beta-isoform [TaxId: 562]} Back     information, alignment and structure
>d1owfb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mula_ a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1exea_ a.55.1.1 (A:) Transcription factor 1, TF1 {Bacteriophage SPO1 [TaxId: 10685]} Back     information, alignment and structure
>d1b8za_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1huua_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 114 integration host factor subunit alpha [Candidatus
1mul_A_90 (A:) NS2, HU-2, DNA binding protein HU-alpha; hist 3e-17
2o97_B_90 (B:) NS1, HU-1, DNA-binding protein HU-beta; heter 3e-17
1p71_A_94 (A:) DNA-binding protein HU; protein-DNA complex, 3e-17
1b8z_A_90 (A:) Protein (histonelike protein HU); thermostabl 3e-17
1hue_A_90 (A:) HU protein; DNA-binding; NMR {Geobacillus ste 9e-17
3c4i_A_99 (A:) DNA-binding protein HU homolog; dimerization 1e-16
1owf_B_94 (B:) IHF-beta, integration HOST factor beta-subuni 2e-16
1exe_A_99 (A:) Transcription factor 1; beta ribbon ARMS, DNA 3e-16
2iie_A_204 (A:) Integration HOST factor; DNA kinking, bending 3e-11
2iie_A_204 (A:) Integration HOST factor; DNA kinking, bending 4e-07
1owf_A_42-9958 (A:42-99) IHF-alpha, integration HOST factor alpha 1e-09
2np2_A_53-10856 (A:53-108) HBB; protein-DNA complex, DNA-binding p 2e-08
>1mul_A (A:) NS2, HU-2, DNA binding protein HU-alpha; histone-like; HET: DNA; 2.30A {Escherichia coli}Length = 90 Back     alignment and structure
 Score = 82.1 bits (203), Expect = 3e-17
 Identities = 25/89 (28%), Positives = 46/89 (51%)

Query: 5  ITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVG 64
          + ++ L+  I+++  LS+  +   + +    I +S   G+A+++  F TF V  +  R G
Sbjct: 1  MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG 60

Query: 65 RNLQTNQEVKIDPRRVVVFKASSILKKRI 93
          RN QT +E+KI    V  F +   LK  +
Sbjct: 61 RNPQTGKEIKIAAANVPAFVSGKALKDAV 89


>2o97_B (B:) NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DNA structure, DNA supercoiling, E. coli; 2.45A {Escherichia coli}Length = 90 Back     alignment and structure
>1p71_A (A:) DNA-binding protein HU; protein-DNA complex, DNA bending, DNA binding protein/DNA complex; 1.90A {Anabaena SP}Length = 94 Back     alignment and structure
>1b8z_A (A:) Protein (histonelike protein HU); thermostable DNA binding protein; 1.60A {Thermotoga maritima}Length = 90 Back     alignment and structure
>1hue_A (A:) HU protein; DNA-binding; NMR {Geobacillus stearothermophilus}Length = 90 Back     alignment and structure
>3c4i_A (A:) DNA-binding protein HU homolog; dimerization by four helix bundle interaction, DNA condensation; 2.04A {Mycobacterium tuberculosis}Length = 99 Back     alignment and structure
>1owf_B (B:) IHF-beta, integration HOST factor beta-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli}Length = 94 Back     alignment and structure
>1exe_A (A:) Transcription factor 1; beta ribbon ARMS, DNA-binding, DNA-bending protein; NMR {Bacillus phage SPO1}Length = 99 Back     alignment and structure
>2iie_A (A:) Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A*Length = 204 Back     alignment and structure
>2iie_A (A:) Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A*Length = 204 Back     alignment and structure
>1owf_A (A:42-99) IHF-alpha, integration HOST factor alpha-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli}Length = 58 Back     alignment and structure
>2np2_A (A:53-108) HBB; protein-DNA complex, DNA-binding protein, DNA-bending protein, dnabii family, HU/IHF family, DNA binding protein/DNA complex; 3.02A {Borrelia burgdorferi}Length = 56 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target114 integration host factor subunit alpha [Candidatus Liber
1p71_A_94 DNA-binding protein HU; protein-DNA complex, DNA b 99.93
3c4i_A_99 DNA-binding protein HU homolog; dimerization by fo 99.92
1owf_B_94 IHF-beta, integration HOST factor beta-subunit; pr 99.92
1mul_A_90 NS2, HU-2, DNA binding protein HU-alpha; histone-l 99.92
2o97_B_90 NS1, HU-1, DNA-binding protein HU-beta; heterodime 99.92
2iie_A_204 Integration HOST factor; DNA kinking, bending, U-t 99.91
1b8z_A_90 Protein (histonelike protein HU); thermostable DNA 99.91
1exe_A_99 Transcription factor 1; beta ribbon ARMS, DNA-bind 99.9
1hue_A_90 HU protein; DNA-binding; NMR {Geobacillus stearoth 99.9
2iie_A_204 Integration HOST factor; DNA kinking, bending, U-t 99.7
1owf_A_42-9958 IHF-alpha, integration HOST factor alpha-subunit; 99.59
2np2_A_53-10856 HBB; protein-DNA complex, DNA-binding protein, DNA 99.52
>1p71_A (A:) DNA-binding protein HU; protein-DNA complex, DNA bending, DNA binding protein/DNA complex; 1.90A {Anabaena SP} Back     alignment and structure
Probab=99.93  E-value=2e-25  Score=177.03  Aligned_cols=92  Identities=21%  Similarity=0.520  Sum_probs=90.6

Q ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCCCCEEEECCCCEEEEC
Q ss_conf             66999999999971999999999999999999999755996000041699985026764306889888995688537761
Q gi|254780496|r    5 ITRSDLVKSISKEFGLSRKDSTRFVTTLFNEICDSAVRGEAIKISSFATFHVKQKGSRVGRNLQTNQEVKIDPRRVVVFK   84 (114)
Q Consensus         5 mtK~eli~~ia~~~g~s~~~~~~~v~~~~~~i~~~L~~g~~V~l~gfGtF~~~~~~~R~~rNP~Tge~i~ip~k~~v~Fk   84 (114)
                      |||+|||+.||+++++++.+++.++++|+++|.++|.+|+.|+|+|||+|+++.+++|.++||+|||.+.||++++|+|+
T Consensus         1 MtK~eli~~ia~~~~ls~~~v~~~i~~~~~~i~~~L~~~~~V~l~~fG~F~v~~~~~r~~~Np~Tge~i~i~~~~~v~Fk   80 (94)
T 1p71_A            1 MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREGRNPKTNEKMEIPATRVPAFS   80 (94)
T ss_dssp             CBHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHTTCCEEETTTEEEEEEEECCEEEECTTTCCEEEECCEEEEEEE
T ss_pred             CCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCEECCEEEEEEEEECCCEEECCCCCCEEEECCCCCEEEE
T ss_conf             98899999999845979999999999999999999864886050352699999836723289799978996487408995


Q ss_pred             CCHHHHHHHHHH
Q ss_conf             698999997311
Q gi|254780496|r   85 ASSILKKRIMDD   96 (114)
Q Consensus        85 psk~Lk~~in~~   96 (114)
                      ||+.|+++||+.
T Consensus        81 psk~lk~~in~~   92 (94)
T 1p71_A           81 AGKLFREKVAPP   92 (94)
T ss_dssp             ECHHHHHHHSCC
T ss_pred             CCHHHHHHHCCC
T ss_conf             498999975778



>3c4i_A (A:) DNA-binding protein HU homolog; dimerization by four helix bundle interaction, DNA condensation; 2.04A {Mycobacterium tuberculosis} Back     alignment and structure
>1owf_B (B:) IHF-beta, integration HOST factor beta-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} Back     alignment and structure
>1mul_A (A:) NS2, HU-2, DNA binding protein HU-alpha; histone-like; HET: DNA; 2.30A {Escherichia coli} Back     alignment and structure
>2o97_B (B:) NS1, HU-1, DNA-binding protein HU-beta; heterodimer, DNA structure, DNA supercoiling, E. coli; 2.45A {Escherichia coli} Back     alignment and structure
>2iie_A (A:) Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Back     alignment and structure
>1b8z_A (A:) Protein (histonelike protein HU); thermostable DNA binding protein; 1.60A {Thermotoga maritima} Back     alignment and structure
>1exe_A (A:) Transcription factor 1; beta ribbon ARMS, DNA-binding, DNA-bending protein; NMR {Bacillus phage SPO1} Back     alignment and structure
>1hue_A (A:) HU protein; DNA-binding; NMR {Geobacillus stearothermophilus} Back     alignment and structure
>2iie_A (A:) Integration HOST factor; DNA kinking, bending, U-turn, intercalation, divalent, metal, recombination/DNA complex; HET: DNA; 2.41A {Escherichia coli} PDB: 2iif_A* Back     alignment and structure
>1owf_A (A:42-99) IHF-alpha, integration HOST factor alpha-subunit; protein-DNA recognition, indirect readout, DNA bending, minor groove; 1.95A {Escherichia coli} Back     alignment and structure
>2np2_A (A:53-108) HBB; protein-DNA complex, DNA-binding protein, DNA-bending protein, dnabii family, HU/IHF family, DNA binding protein/DNA complex; 3.02A {Borrelia burgdorferi} Back     alignment and structure