254780497

254780497

3-oxoacyl-(acyl carrier protein) synthase III

GeneID in NCBI database:8209492Locus tag:CLIBASIA_01920
Protein GI in NCBI database:254780497Protein Accession:YP_003064910.1
Gene range:+(780379, 781353)Protein Length:324aa
Gene description:3-oxoacyl-(acyl carrier protein) synthase III
COG prediction:[I] 3-oxoacyl-[acyl-carrier-protein] synthase III
KEGG prediction:fabH; 3-oxoacyl-(acyl carrier protein) synthase III (EC:2.3.1.180); K00648 3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
SEED prediction:3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.41)
Pathway involved in KEGG:Fatty acid biosynthesis [PATH:las00061]
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----
MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW
ccEEEEEEEEEEcccccccHHHHHHHccccHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHccccHHHccEEEEEEcccccccccHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHHHHHcccccEEEEEEEHHHHcccccccccccEEEEEEEEEEEEccccccccccccccEEEHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEccccHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccEEEEEEEEccccEEEEEEEc
cccEEEEEEEEEccccEEEHHHHcccccccccHHHHcccccEEEcccccccHHHHHHHHHHHHHHHHcccHHHccEEEEEccccccccccHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHHHHHccccccEEEEEEEEHHHHcccccccccccEcEEEEEEEEEEEccccEcccEEEEcHHHcccccccccEEEEcccccccccccEcEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEccccHHHHHHHHHHccccHHHEcccHHHHcEcHHHHHHHHHHHHHHccccccccEEEEEEEEcccEEEEEEEEc
MIRSTVRGIglslprrvlsnsdlesivdtsdgwikrrvgisrrhiagkdettaSLGEAAARDALhhaemsvdDIDLIIVAtstpdqtfpstAVNIQNRlgmkrgfaFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSdtfsrivdwsdrstcvlfgdgAGALILEGvevkgssmadtgILSTylcsdgsyidklyvdggpstsrtvgciRMEGKAVFKYAVEKAVELIEKVFdsthltienidwfvphqaNWRIINSIVDkmkipfdkVIVTVDihgntsaaSIPLALAVAVKEGRVKKGDCLLLEamgggftsgTVLLRW
mirstvrgiglslprrvlsnsdlesivdtsdgwikrrvgisrrhiagkdettaSLGEAAARDALHHAEMSVDDIDLIIVATstpdqtfpsTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTadsyirsgvvrRVMVIGSdtfsrivdwsdRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIEnidwfvphqaNWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLleamgggftsgtvllrw
MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW
*IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW
MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW
*IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxhhhhhhhhhhhhhhhhhhhhxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW
MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW
MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target324 3-oxoacyl-(acyl carrier protein) synthase III [Candidat
254780489325 3-oxoacyl-(acyl carrier protein) synthase II [Cand 7e-45
>gi|254780489|ref|YP_003064902.1| 3-oxoacyl-(acyl carrier protein) synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 325 Back     alignment
 Score =  172 bits (436), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 175/315 (55%), Gaps = 13/315 (4%)

Query: 1   MIRST--VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           MI+S+  + G G ++P + + NS +E  ++   G I+++ GI  R+ A K ET   +   
Sbjct: 1   MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQ 60

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           A   AL +A +  D I L ++ATSTPD   P ++  I +RLG+ +  A D+   C+GF+Y
Sbjct: 61  AGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLY 120

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+  ADSYI S   + V++I ++  SR ++  D+ T ++FGD AGA++L    +K  S  
Sbjct: 121 ALVMADSYINSH-QKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKS-- 177

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIR------MEGKAVFKYAVEKAVELIE 232
             GIL   L SDGS  D + +  G STS               G  +F  AV+   +  +
Sbjct: 178 --GILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQSAK 235

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +    + L  ++I+ F+PHQAN RII  + +K+ +    ++ ++   GN+S+ASIPL+L+
Sbjct: 236 QSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLS 295

Query: 293 VAVKEGRVKKGDCLL 307
           +  +    +KG+ +L
Sbjct: 296 LENQRKPFQKGEKIL 310

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target324 3-oxoacyl-(acyl carrier protein) synthase III [Candidat
315122316323 3-oxoacyl-(acyl carrier protein) synthase III [Candidat 1 1e-151
327189793323 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobiu 1 1e-124
162329643323 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobiu 1 1e-121
325292553323 3-oxoacyl-acyl carrier protein synthase III [Agrobacter 1 1e-120
209548800331 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobiu 1 1e-120
15888517323 3-oxoacyl-(acyl carrier protein) synthase III [Agrobact 1 1e-119
116251405323 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobiu 1 1e-119
241204021323 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobiu 1 1e-119
222148216323 3-oxoacyl-(acyl-carrier-protein) synthase III [Agrobact 1 1e-118
319784145323 3-oxoacyl-(acyl-carrier-protein) synthase III [Mesorhiz 1 1e-118
>gi|315122316|ref|YP_004062805.1| 3-oxoacyl-(acyl carrier protein) synthase III [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 323 Back     alignment and organism information
 Score =  538 bits (1385), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 259/324 (79%), Positives = 298/324 (91%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G SLP++VLSN+DLESI+DTSD WI+RRVGIS+RHIAGK ETTASLGEAAA
Sbjct: 1   MIRSVVRGFGSSLPKKVLSNADLESIIDTSDDWIRRRVGISQRHIAGKGETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           RDAL+ A+M+ DDIDLII+ATSTPDQTFP+TAVN+QNRLGMK+GFAFD+QAVCSGF+YA+
Sbjct: 61  RDALYQAKMNADDIDLIILATSTPDQTFPATAVNVQNRLGMKKGFAFDIQAVCSGFLYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIRSGVV+RVMVIG+DTFSRI+DWSDRSTC+LFGDGAG+LILE  +V+ SS +D 
Sbjct: 121 TTADAYIRSGVVQRVMVIGADTFSRIIDWSDRSTCILFGDGAGSLILEATQVQ-SSDSDI 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILSTYL SDGS+I+KL+VDGGPSTS TVG +RM+G+ VFKYAVE A ELI+KV DS++L
Sbjct: 180 GILSTYLYSDGSHIEKLHVDGGPSTSGTVGYVRMKGREVFKYAVESAAELIKKVLDSSNL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           TI +IDWFVPHQAN RIINSI ++M I  DKVIVTVDIHGNTSAASIPLAL+VAVKEGR+
Sbjct: 240 TIADIDWFVPHQANLRIINSISERMNISSDKVIVTVDIHGNTSAASIPLALSVAVKEGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGDCLLLEAMGGGFTSG VLLRW
Sbjct: 300 KKGDCLLLEAMGGGFTSGAVLLRW 323


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327189793|gb|EGE56934.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium etli CNPAF512] Length = 323 Back     alignment and organism information
>gi|162329643|ref|YP_469062.2| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium etli CFN 42] Length = 323 Back     alignment and organism information
>gi|325292553|ref|YP_004278417.1| 3-oxoacyl-acyl carrier protein synthase III [Agrobacterium sp. H13-3] Length = 323 Back     alignment and organism information
>gi|209548800|ref|YP_002280717.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 331 Back     alignment and organism information
>gi|15888517|ref|NP_354198.1| 3-oxoacyl-(acyl carrier protein) synthase III [Agrobacterium tumefaciens str. C58] Length = 323 Back     alignment and organism information
>gi|116251405|ref|YP_767243.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium leguminosarum bv. viciae 3841] Length = 323 Back     alignment and organism information
>gi|241204021|ref|YP_002975117.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 323 Back     alignment and organism information
>gi|222148216|ref|YP_002549173.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Agrobacterium vitis S4] Length = 323 Back     alignment and organism information
>gi|319784145|ref|YP_004143621.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 323 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target324 3-oxoacyl-(acyl carrier protein) synthase III [Candidat
PRK09352319 PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protein) sy 1e-137
PRK12879325 PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protein) sy 1e-109
cd00830320 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthas 1e-107
TIGR00747318 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) synth 1e-101
PLN02326379 PLN02326, PLN02326, 3-oxoacyl-[acyl-carrier-protein] sy 4e-82
CHL00203326 CHL00203, fabH, 3-oxoacyl-acyl-carrier-protein synthase 3e-75
PRK05963326 PRK05963, PRK05963, 3-oxoacyl-(acyl carrier protein) sy 1e-62
PRK07204329 PRK07204, PRK07204, 3-oxoacyl-(acyl carrier protein) sy 2e-55
cd00827324 cd00827, init_cond_enzymes, "initiating" condensing enz 4e-46
PRK07515372 PRK07515, PRK07515, 3-oxoacyl-(acyl carrier protein) sy 1e-31
PRK12880353 PRK12880, PRK12880, 3-oxoacyl-(acyl carrier protein) sy 1e-29
PRK06840339 PRK06840, PRK06840, hypothetical protein; Validated 4e-27
PRK09258338 PRK09258, PRK09258, 3-oxoacyl-(acyl carrier protein) sy 5e-22
PRK06816378 PRK06816, PRK06816, 3-oxoacyl-(acyl carrier protein) sy 5e-21
cd00831361 cd00831, CHS_like, Chalcone and stilbene synthases; pla 3e-20
COG3425377 COG3425, PksG, 3-hydroxy-3-methylglutaryl CoA synthase 6e-20
COG3424356 COG3424, BcsA, Predicted naringenin-chalcone synthase [ 1e-15
TIGR00748345 TIGR00748, HMG_CoA_syn_Arc, hydroxymethylglutaryl-CoA s 6e-10
TIGR01835379 TIGR01835, HMG-CoA-S_prok, 3-hydroxy-3-methylglutaryl C 7e-06
COG0332323 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] 1e-109
pfam0854190 pfam08541, ACP_syn_III_C, 3-Oxoacyl-[acyl-carrier-prote 5e-30
pfam0854580 pfam08545, ACP_syn_III, 3-Oxoacyl-[acyl-carrier-protein 1e-27
cd00825332 cd00825, decarbox_cond_enzymes, decarboxylating condens 4e-20
cd00327254 cd00327, cond_enzymes, Condensing enzymes; Family of en 6e-20
PRK04262347 PRK04262, PRK04262, hypothetical protein; Provisional 2e-11
cd00829375 cd00829, SCP-x_thiolase, Thiolase domain associated wit 4e-09
PRK07516389 PRK07516, PRK07516, acetyl-CoA acetyltransferase; Provi 2e-04
PRK12578385 PRK12578, PRK12578, acetyl-CoA acetyltransferase; Provi 0.003
>gnl|CDD|181792 PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|183809 PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|29417 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>gnl|CDD|162020 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>gnl|CDD|177960 PLN02326, PLN02326, 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>gnl|CDD|164577 CHL00203, fabH, 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>gnl|CDD|180328 PRK05963, PRK05963, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|180881 PRK07204, PRK07204, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|29414 cd00827, init_cond_enzymes, "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>gnl|CDD|181012 PRK07515, PRK07515, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|171793 PRK12880, PRK12880, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|180722 PRK06840, PRK06840, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|181732 PRK09258, PRK09258, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|180710 PRK06816, PRK06816, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|29418 cd00831, CHS_like, Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>gnl|CDD|33231 COG3425, PksG, 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|33230 COG3424, BcsA, Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|129831 TIGR00748, HMG_CoA_syn_Arc, hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>gnl|CDD|130894 TIGR01835, HMG-CoA-S_prok, 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>gnl|CDD|30680 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|117118 pfam08541, ACP_syn_III_C, 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal Back     alignment and domain information
>gnl|CDD|117122 pfam08545, ACP_syn_III, 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III Back     alignment and domain information
>gnl|CDD|73238 cd00825, decarbox_cond_enzymes, decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|73194 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|179804 PRK04262, PRK04262, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|29416 cd00829, SCP-x_thiolase, Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>gnl|CDD|181013 PRK07516, PRK07516, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183606 PRK12578, PRK12578, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 324 3-oxoacyl-(acyl carrier protein) synthase III [Candidat
TIGR00747329 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III; Int 100.0
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 100.0
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK12879326 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
CHL00203327 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisi 100.0
PRK05963327 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III (KAS 100.0
PRK09258339 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK06840337 hypothetical protein; Validated 100.0
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK04262346 hypothetical protein; Provisional 100.0
cd00827324 init_cond_enzymes "initiating" condensing enzymes are a 100.0
cd00831361 CHS_like Chalcone and stilbene synthases; plant-specifi 100.0
COG3425377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid met 100.0
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secondary 100.0
TIGR01835412 HMG-CoA-S_prok hydroxymethylglutaryl-CoA synthase; Inte 100.0
TIGR00748347 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, put 100.0
TIGR01833461 HMG-CoA-S_euk hydroxymethylglutaryl-CoA synthase; Inter 99.93
KOG1393462 consensus 99.91
PRK07314411 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.72
PRK07103415 polyketide beta-ketoacyl:acyl carrier protein synthase; 99.69
PRK06365415 acetyl-CoA acetyltransferase; Provisional 99.69
PRK07516389 acetyl-CoA acetyltransferase; Provisional 99.69
PRK05952379 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.68
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synth 99.68
PRK06333424 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.67
PTZ00050477 3-oxoacyl-acyl carrier protein synthase; Provisional 99.65
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.65
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.65
PRK08722414 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.64
PRK07967406 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed 99.64
PRK08768411 consensus 99.64
TIGR03150407 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2. FabB 99.63
PRK08371388 consensus 99.62
PRK09185395 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed 99.59
cd00828407 elong_cond_enzymes "elongating" condensing enzymes are 99.56
PRK08439405 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.54
cd00832399 CLF Chain-length factor (CLF) is a factor required for 99.5
PRK07937352 lipid-transfer protein; Provisional 99.42
PRK06066375 acetyl-CoA acetyltransferase; Provisional 99.33
PRK06519397 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.01
KOG1202 2376 consensus 98.7
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes that 100.0
cd00825332 decarbox_cond_enzymes decarboxylating condensing enzyme 99.75
PRK12578385 acetyl-CoA acetyltransferase; Provisional 99.68
PRK06059399 lipid-transfer protein; Provisional 99.68
PRK08256391 lipid-transfer protein; Provisional 99.65
PRK06157400 acetyl-CoA acetyltransferase; Validated 99.64
PRK06364389 consensus 99.64
PRK06158384 thiolase; Provisional 99.6
PRK08313391 acetyl-CoA acetyltransferase; Provisional 99.54
PRK06065393 acetyl-CoA acetyltransferase; Provisional 99.53
PRK08142388 acetyl-CoA acetyltransferase; Provisional 99.53
PRK09116336 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.52
smart00825424 PKS_KS Beta-ketoacyl synthase. The structure of beta-ke 99.51
PRK06504390 acetyl-CoA acetyltransferase; Provisional 99.51
PRK07850387 acetyl-CoA acetyltransferase; Provisional 99.5
PRK06147346 3-oxoacyl-(acyl carrier protein) synthase; Validated 99.48
cd00833421 PKS polyketide synthases (PKSs) polymerize simple fatty 99.47
PRK07855386 lipid-transfer protein; Provisional 99.4
PRK09052399 acetyl-CoA acetyltransferase; Provisional 99.34
TIGR02845331 spore_V_AD stage V sporulation protein AD; InterPro: IP 99.33
PRK06690361 acetyl-CoA acetyltransferase; Provisional 99.24
PRK08304336 stage V sporulation protein AD; Validated 99.04
pfam07451329 SpoVAD Stage V sporulation protein AD (SpoVAD). This fa 99.04
PRK12404334 stage V sporulation protein AD; Provisional 98.96
KOG1390396 consensus 98.8
KOG1389435 consensus 98.8
pfam00195228 Chal_sti_synt_N Chalcone and stilbene synthases, N-term 99.95
pfam01154171 HMG_CoA_synt_N Hydroxymethylglutaryl-coenzyme A synthas 99.92
pfam00109243 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 99.08
pfam0854190 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] sy 99.9
pfam02797151 Chal_sti_synt_C Chalcone and stilbene synthases, C-term 99.65
pfam08540282 HMG_CoA_synt_C Hydroxymethylglutaryl-coenzyme A synthas 98.31
pfam00195228 Chal_sti_synt_N Chalcone and stilbene synthases, N-term 96.58
pfam02803123 Thiolase_C Thiolase, C-terminal domain. Thiolase is rep 96.29
TIGR01930447 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro 96.19
TIGR02845 331 spore_V_AD stage V sporulation protein AD; InterPro: IP 95.33
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 95.31
PRK07491392 consensus 94.65
PRK06205404 acetyl-CoA acetyltransferase; Provisional 94.56
PRK06845392 consensus 94.48
PRK08234400 consensus 94.43
PRK08242402 acetyl-CoA acetyltransferase; Validated 94.2
PRK07851405 acetyl-CoA acetyltransferase; Provisional 93.9
PRK07801382 acetyl-CoA acetyltransferase; Provisional 93.89
PRK08131401 acetyl-CoA acetyltransferase; Provisional 93.68
PRK08041391 consensus 93.59
PRK06633392 acetyl-CoA acetyltransferase; Provisional 93.54
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 93.35
PRK06445394 acetyl-CoA acetyltransferase; Provisional 93.29
PRK05656392 acetyl-CoA acetyltransferase; Provisional 93.28
PRK08170426 acetyl-CoA acetyltransferase; Provisional 93.07
pfam02801117 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal doma 93.03
PRK08257 502 acetyl-CoA acetyltransferase; Validated 92.7
PRK07661384 acetyl-CoA acetyltransferase; Provisional 92.45
PRK06954397 acetyl-CoA acetyltransferase; Provisional 92.4
PRK06689391 consensus 91.79
PRK07025393 consensus 91.09
PRK09051394 beta-ketothiolase; Provisional 90.31
pfam08392290 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like p 99.83
cd00751386 thiolase Thiolase are ubiquitous enzymes that catalyze 99.73
PRK08235393 acetyl-CoA acetyltransferase; Provisional 99.67
PRK07800393 consensus 99.66
PRK05790393 acetyl-CoA acetyltransferase; Provisional 99.66
PRK06845392 consensus 99.66
PRK06289 408 acetyl-CoA acetyltransferase; Provisional 99.63
PRK07801382 acetyl-CoA acetyltransferase; Provisional 99.62
PRK06954397 acetyl-CoA acetyltransferase; Provisional 99.6
PRK07851 405 acetyl-CoA acetyltransferase; Provisional 99.57
PRK07491392 consensus 99.57
PRK08041391 consensus 99.57
cd00826393 nondecarbox_cond_enzymes nondecarboxylating condensing 99.57
PRK06366388 acetyl-CoA acetyltransferase; Provisional 99.56
PRK07124 402 consensus 99.56
PRK09051394 beta-ketothiolase; Provisional 99.54
PRK08242402 acetyl-CoA acetyltransferase; Validated 99.53
PRK08131 401 acetyl-CoA acetyltransferase; Provisional 99.52
PRK06445394 acetyl-CoA acetyltransferase; Provisional 99.51
PRK07025393 consensus 99.51
PRK06205 404 acetyl-CoA acetyltransferase; Provisional 99.5
PRK05656392 acetyl-CoA acetyltransferase; Provisional 99.49
PRK07108392 acetyl-CoA acetyltransferase; Provisional 99.48
PRK08963 436 fadI 3-ketoacyl-CoA thiolase; Reviewed 99.48
PRK06025 417 acetyl-CoA acetyltransferase; Provisional 99.47
PRK06633392 acetyl-CoA acetyltransferase; Provisional 99.47
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 99.46
PRK08170 426 acetyl-CoA acetyltransferase; Provisional 99.45
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 99.45
PRK06689391 consensus 99.44
PRK08234400 consensus 99.42
PRK09268 428 acetyl-CoA acetyltransferase; Provisional 99.4
PRK07661384 acetyl-CoA acetyltransferase; Provisional 99.34
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 99.32
pfam00108264 Thiolase_N Thiolase, N-terminal domain. Thiolase is rep 99.06
TIGR01930 447 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro 99.03
PRK08257 502 acetyl-CoA acetyltransferase; Validated 98.76
KOG1406 408 consensus 98.68
KOG1391396 consensus 98.49
COG0183392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] 98.39
KOG1392 465 consensus 98.27
pfam02803123 Thiolase_C Thiolase, C-terminal domain. Thiolase is rep 93.32
pfam0854190 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] sy 92.47
TIGR02446 430 FadI acetyl-CoA C-acyltransferase FadI; InterPro: IPR01 91.88
cd00829375 SCP-x_thiolase Thiolase domain associated with sterol c 99.73
PRK06064389 acetyl-CoA acetyltransferase; Provisional 99.64
PRK06363387 consensus 99.57
COG3321 1061 Polyketide synthase modules and related proteins [Secon 99.17
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 96.63
pfam0854580 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synt 99.65
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid m 99.17
KOG1394440 consensus 98.93
cd00831361 CHS_like Chalcone and stilbene synthases; plant-specifi 96.2
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes that 94.13
PRK05952379 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 93.85
PRK04262346 hypothetical protein; Provisional 93.15
PRK09185395 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed 93.12
PRK07937352 lipid-transfer protein; Provisional 92.69
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 92.61
PRK05963327 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 95.5
PRK12879326 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 95.31
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III (KAS 94.85
CHL00203327 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisi 94.54
cd00829375 SCP-x_thiolase Thiolase domain associated with sterol c 91.87
cd00826393 nondecarbox_cond_enzymes nondecarboxylating condensing 91.69
PRK09258339 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 95.29
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 94.9
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 94.79
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 93.95
PRK06840337 hypothetical protein; Validated 93.95
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 92.86
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 91.87
pfam08392290 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like p 95.24
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secondary 94.12
PRK06504390 acetyl-CoA acetyltransferase; Provisional 94.08
PRK07850387 acetyl-CoA acetyltransferase; Provisional 93.48
PRK09052399 acetyl-CoA acetyltransferase; Provisional 93.39
PRK06690361 acetyl-CoA acetyltransferase; Provisional 92.71
PRK07855386 lipid-transfer protein; Provisional 93.6
PRK06158384 thiolase; Provisional 90.5
PRK12578385 acetyl-CoA acetyltransferase; Provisional 90.37
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III; InterPro: IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH), in general, initiates elongation in type II fatty acid synthase systems found in bacteria and plants Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok hydroxymethylglutaryl-CoA synthase; InterPro: IPR011554 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative; InterPro: IPR004656 This family of archaeal proteins shows considerable homology and identical active site residues to FabH, the beta-ketoacyl-acyl carrier protein synthase III of bacteria and plants Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk hydroxymethylglutaryl-CoA synthase; InterPro: IPR010122 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>KOG1393 consensus Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK08768 consensus Back     alignment and domain information
>TIGR03150 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Back     alignment and domain information
>PRK08371 consensus Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>KOG1202 consensus Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK06364 consensus Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD; InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>pfam07451 SpoVAD Stage V sporulation protein AD (SpoVAD) Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>KOG1390 consensus Back     alignment and domain information
>KOG1389 consensus Back     alignment and domain information
>pfam00195 Chal_sti_synt_N Chalcone and stilbene synthases, N-terminal domain Back     alignment and domain information
>pfam01154 HMG_CoA_synt_N Hydroxymethylglutaryl-coenzyme A synthase N terminal Back     alignment and domain information
>pfam00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>pfam08541 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal Back     alignment and domain information
>pfam02797 Chal_sti_synt_C Chalcone and stilbene synthases, C-terminal domain Back     alignment and domain information
>pfam08540 HMG_CoA_synt_C Hydroxymethylglutaryl-coenzyme A synthase C terminal Back     alignment and domain information
>pfam00195 Chal_sti_synt_N Chalcone and stilbene synthases, N-terminal domain Back     alignment and domain information
>pfam02803 Thiolase_C Thiolase, C-terminal domain Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro: IPR002155 Two different types of thiolase , , are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD; InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK07491 consensus Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06845 consensus Back     alignment and domain information
>PRK08234 consensus Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08041 consensus Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>pfam02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06689 consensus Back     alignment and domain information
>PRK07025 consensus Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>pfam08392 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like protein Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07800 consensus Back     alignment and domain information
>PRK05790 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06845 consensus Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07491 consensus Back     alignment and domain information
>PRK08041 consensus Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07124 consensus Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07025 consensus Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK06689 consensus Back     alignment and domain information
>PRK08234 consensus Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>pfam00108 Thiolase_N Thiolase, N-terminal domain Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro: IPR002155 Two different types of thiolase , , are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>KOG1406 consensus Back     alignment and domain information
>KOG1391 consensus Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG1392 consensus Back     alignment and domain information
>pfam02803 Thiolase_C Thiolase, C-terminal domain Back     alignment and domain information
>pfam08541 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal Back     alignment and domain information
>TIGR02446 FadI acetyl-CoA C-acyltransferase FadI; InterPro: IPR012806 This subunit of the FadJI complex has acetyl-CoA C-acyltransferase (2 Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06363 consensus Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432 Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9 Back     alignment and domain information
>pfam08545 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1394 consensus Back     alignment and domain information