254780498

254780498

putative glycerol-3-phosphate acyltransferase PlsX

GeneID in NCBI database:8209493Locus tag:CLIBASIA_01925
Protein GI in NCBI database:254780498Protein Accession:YP_003064911.1
Gene range:+(779279, 780373)Protein Length:364aa
Gene description:putative glycerol-3-phosphate acyltransferase PlsX
COG prediction:[I] Fatty acid/phospholipid biosynthesis enzyme
KEGG prediction:putative glycerol-3-phosphate acyltransferase PlsX; K03621 glycerol-3-phosphate acyltransferase PlsX [EC:2.3.1.15]
SEED prediction:Phosphate:acyl-ACP acyltransferase PlsX
Pathway involved in KEGG:Glycerolipid metabolism [PATH:las00561]
Glycerophospholipid metabolism [PATH:las00564]
Subsystem involved in SEED:Glycerolipid and Glycerophospholipid Metabolism in Bacteria;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----
MNQMDVLQGGNVDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKGKCIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQRVRDSLLDVHEKKIVSGSGK
ccHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccccccEEEEcccccccccccHHHHHHHcccccHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHcccccccccHHEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHHcccccccEEEEEcccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHccccEEEEEccEEEEccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccc
cccccccccccEEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccHccEEEEEccEEEcccccHHHHHHccccccHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHccccccccccEEEccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHHHHcccccccEEEEEEccccccccEEEEEEcccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccEEcccccEEEEccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccEEccccc
mnqmdvlqggnvdtisldlmggdlgARDLILGASKfleahprirflmygdakvclpildshpllkerscfhhcevsiamderpadalrrgrnVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSrisgvdrpslaafwptvkgkciildvgatigSTVSHMVQLSILGSFFarsvagincpsigllnvgteeikgndVLQESARLLRGECcgafkykgfieanDIAKGFVDVIVTEGFSGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREvkegfdprnfnggvlLGVDGlvvkghgssdaKSIFNVLGIAhnmsqngfidMVKDDMQRVRDSLLDVHEKKIVSGSGK
mnqmdvlqggNVDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVsiamderpadalrrGRNVSSMWRAIEAvkknqaasvvTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKGKCIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEgfdprnfnggvLLGVDGLVVKGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQRVRDSlldvhekkivsgsgk
MNQMDVLQGGNVDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKGKCIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNggvllgvdglvvkghgSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQRVRDSLLDVHEKKIVSGSGK
*************TISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKGKCIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDM*********************
MNQMDVLQGGNVDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKGKCIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQRVRDSLLDVHEK********
MNQ*DVLQGGNVDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKGKCIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQRVRDSLLDVH**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQMDVLQGGNVDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKGKCIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQRVRDSLLDVHEKKIVSGSGK
MNQMDVLQGGNVDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKGKCIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQRVRDSLLDVHEKKIVSGSGK
MNQMDVLQGGNVDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKGKCIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQRVRDSLLDVHEKKIVSGSGK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target364 putative glycerol-3-phosphate acyltransferase PlsX [Can
315122315365 putative glycerol-3-phosphate acyltransferase PlsX [Can 1 1e-165
90419419357 fatty acid/phospholipid synthesis protein plsx [Auranti 1 8e-97
241204020348 glycerol-3-phosphate acyltransferase PlsX [Rhizobium le 1 4e-96
222085521348 fatty acid/phospholipid synthesis protein PlsX [Agrobac 1 1e-95
325292552353 glycerol-3-phosphate acyltransferase PlsX [Agrobacteriu 1 2e-95
182676503348 RecName: Full=Phosphate acyltransferase; AltName: Full= 1 2e-95
209548799348 glycerol-3-phosphate acyltransferase PlsX [Rhizobium le 1 7e-95
116251404348 glycerol-3-phosphate acyltransferase PlsX [Rhizobium le 1 8e-95
15888516353 putative glycerol-3-phosphate acyltransferase PlsX [Agr 1 8e-95
222148215347 putative glycerol-3-phosphate acyltransferase PlsX [Agr 1 2e-94
>gi|315122315|ref|YP_004062804.1| putative glycerol-3-phosphate acyltransferase PlsX [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 365 Back     alignment and organism information
 Score =  586 bits (1510), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 290/361 (80%), Positives = 323/361 (89%)

Query: 4   MDVLQGGNVDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPL 63
           MDVL+      ISLDLMGGDLGA+DLI GAS+FLEA+P +RFLMYGD KVCLPILDS+  
Sbjct: 1   MDVLRMSANCIISLDLMGGDLGAKDLIPGASRFLEANPEVRFLMYGDEKVCLPILDSYAK 60

Query: 64  LKERSCFHHCEVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAM 123
           LK+ S FHHC+VSIAMDERPADALRRGRNVSSMW AIEAVKK +A +VVTAGNTGALIAM
Sbjct: 61  LKQNSSFHHCDVSIAMDERPADALRRGRNVSSMWCAIEAVKKKKATAVVTAGNTGALIAM 120

Query: 124 ARLCLSRISGVDRPSLAAFWPTVKGKCIILDVGATIGSTVSHMVQLSILGSFFARSVAGI 183
           ARLCLS+ISGVDRPSLAAFWPT +GKCIILDVGATIGSTVSHM+QLSILGS  ARS  GI
Sbjct: 121 ARLCLSKISGVDRPSLAAFWPTFQGKCIILDVGATIGSTVSHMIQLSILGSVLARSALGI 180

Query: 184 NCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGF 243
            CPS+GLLNVGTEE KG++VLQES RLLR E CG FKYKGF+EA+DI+KG VDV+VTEGF
Sbjct: 181 ECPSVGLLNVGTEETKGHNVLQESGRLLREEYCGDFKYKGFVEASDISKGLVDVVVTEGF 240

Query: 244 SGNIAIKAAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLG 303
           SGNIAIK+AEGAVRHISGVL+KSLNRTL SRIGCLLI+++L+EVKEGFDP NFNGGVLLG
Sbjct: 241 SGNIAIKSAEGAVRHISGVLKKSLNRTLFSRIGCLLIRRALQEVKEGFDPGNFNGGVLLG 300

Query: 304 VDGLVVKGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQRVRDSLLDVHEKKIVSGSG 363
           VDGLVVKGHGSS+AKSIFNVLGIA NMS+NGFIDMVK DMQR+RD+ L+V  K I+S  G
Sbjct: 301 VDGLVVKGHGSSNAKSIFNVLGIARNMSRNGFIDMVKVDMQRMRDNSLNVTGKTILSDYG 360

Query: 364 K 364
           +
Sbjct: 361 R 361


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|90419419|ref|ZP_01227329.1| fatty acid/phospholipid synthesis protein plsx [Aurantimonas manganoxydans SI85-9A1] Length = 357 Back     alignment and organism information
>gi|241204020|ref|YP_002975116.1| glycerol-3-phosphate acyltransferase PlsX [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 348 Back     alignment and organism information
>gi|222085521|ref|YP_002544051.1| fatty acid/phospholipid synthesis protein PlsX [Agrobacterium radiobacter K84] Length = 348 Back     alignment and organism information
>gi|325292552|ref|YP_004278416.1| glycerol-3-phosphate acyltransferase PlsX [Agrobacterium sp. H13-3] Length = 353 Back     alignment and organism information
>gi|182676503|sp|Q2KA02|PLSX_RHIEC RecName: Full=Phosphate acyltransferase; AltName: Full=Acyl-ACP phosphotransacylase; AltName: Full=Acyl-[acyl-carrier-protein]--phosphate acyltransferase; AltName: Full=Phosphate-acyl-ACP acyltransferase Length = 348 Back     alignment and organism information
>gi|209548799|ref|YP_002280716.1| glycerol-3-phosphate acyltransferase PlsX [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 348 Back     alignment and organism information
>gi|116251404|ref|YP_767242.1| glycerol-3-phosphate acyltransferase PlsX [Rhizobium leguminosarum bv. viciae 3841] Length = 348 Back     alignment and organism information
>gi|15888516|ref|NP_354197.1| putative glycerol-3-phosphate acyltransferase PlsX [Agrobacterium tumefaciens str. C58] Length = 353 Back     alignment and organism information
>gi|222148215|ref|YP_002549172.1| putative glycerol-3-phosphate acyltransferase PlsX [Agrobacterium vitis S4] Length = 347 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target364 putative glycerol-3-phosphate acyltransferase PlsX [Can
PRK05331334 PRK05331, PRK05331, putative phosphate acyltransferase; 1e-115
pfam02504322 pfam02504, FA_synthesis, Fatty acid synthesis protein 3e-76
TIGR00182322 TIGR00182, plsX, fatty acid/phospholipid synthesis prot 5e-66
PRK13845437 PRK13845, PRK13845, putative glycerol-3-phosphate acylt 3e-44
PRK13846316 PRK13846, PRK13846, putative glycerol-3-phosphate acylt 1e-37
COG0416338 COG0416, PlsX, Fatty acid/phospholipid biosynthesis enz 1e-98
>gnl|CDD|180021 PRK05331, PRK05331, putative phosphate acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|111407 pfam02504, FA_synthesis, Fatty acid synthesis protein Back     alignment and domain information
>gnl|CDD|129286 TIGR00182, plsX, fatty acid/phospholipid synthesis protein PlsX Back     alignment and domain information
>gnl|CDD|172371 PRK13845, PRK13845, putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>gnl|CDD|139906 PRK13846, PRK13846, putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>gnl|CDD|30765 COG0416, PlsX, Fatty acid/phospholipid biosynthesis enzyme [Lipid metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 364 putative glycerol-3-phosphate acyltransferase PlsX [Can
COG0416338 PlsX Fatty acid/phospholipid biosynthesis enzyme [Lipid 100.0
PRK05331317 putative glycerol-3-phosphate acyltransferase PlsX; Pro 100.0
TIGR00182344 plsX fatty acid/phospholipid synthesis protein PlsX; In 100.0
PRK13845437 putative glycerol-3-phosphate acyltransferase PlsX; Pro 100.0
pfam02504322 FA_synthesis Fatty acid synthesis protein. The plsX gen 100.0
PRK13846316 putative glycerol-3-phosphate acyltransferase PlsX; Pro 100.0
PRK05632702 phosphate acetyltransferase; Reviewed 99.96
PRK12862761 malic enzyme; Reviewed 99.96
PRK07232753 malic enzyme; Reviewed 99.96
PRK09653324 eutD phosphotransacetylase; Reviewed 99.96
pfam01515319 PTA_PTB Phosphate acetyl/butaryl transferase. This fami 99.96
PRK12861762 malic enzyme; Reviewed 99.96
COG0280327 Pta Phosphotransacetylase [Energy production and conver 99.94
TIGR00651322 pta phosphate acetyltransferase; InterPro: IPR004614 Ph 99.92
PRK11890312 phosphate acetyltransferase; Provisional 99.92
PRK05805301 phosphate butyryltransferase; Validated 99.91
PRK07742299 phosphate butyryltransferase; Validated 99.9
PRK08190465 bifunctional enoyl-CoA hydratase/phosphate acetyltransf 99.52
PRK01909329 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Vali 99.27
TIGR02706295 P_butyryltrans phosphate butyryltransferase; InterPro: 99.16
PRK05312336 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 98.86
PRK04607330 consensus 98.84
PRK02848341 consensus 98.75
PRK03367329 consensus 98.7
PRK03743333 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Vali 98.69
PRK00232334 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Revi 98.68
PRK04507323 consensus 98.64
PRK03877328 consensus 98.46
PRK02746332 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 98.33
PRK03371326 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 2; Pr 98.26
COG1995332 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme 97.91
PRK03946304 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 97.64
TIGR02709271 branched_ptb branched-chain phosphotransacylase; InterP 95.91
TIGR03270202 methan_mark_4 putative methanogen marker protein 4. Mem 99.36
COG4002256 Predicted phosphotransacetylase [General function predi 98.16
pfam04166299 PdxA Pyridoxal phosphate biosynthetic protein PdxA. In 98.22
>COG0416 PlsX Fatty acid/phospholipid biosynthesis enzyme [Lipid metabolism] Back     alignment and domain information
>PRK05331 putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>TIGR00182 plsX fatty acid/phospholipid synthesis protein PlsX; InterPro: IPR003664 The plsX gene is part of the bacterial fab gene cluster which encodes several key fatty acid biosynthetic enzymes Back     alignment and domain information
>PRK13845 putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>pfam02504 FA_synthesis Fatty acid synthesis protein Back     alignment and domain information
>PRK13846 putative glycerol-3-phosphate acyltransferase PlsX; Provisional Back     alignment and domain information
>PRK05632 phosphate acetyltransferase; Reviewed Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK07232 malic enzyme; Reviewed Back     alignment and domain information
>PRK09653 eutD phosphotransacetylase; Reviewed Back     alignment and domain information
>pfam01515 PTA_PTB Phosphate acetyl/butaryl transferase Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>COG0280 Pta Phosphotransacetylase [Energy production and conversion] Back     alignment and domain information
>TIGR00651 pta phosphate acetyltransferase; InterPro: IPR004614 Phosphate acetyltransferase (2 Back     alignment and domain information
>PRK11890 phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK05805 phosphate butyryltransferase; Validated Back     alignment and domain information
>PRK07742 phosphate butyryltransferase; Validated Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>PRK01909 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02706 P_butyryltrans phosphate butyryltransferase; InterPro: IPR014079 Members of this family are phosphate butyryltransferase enzymes, also called phosphotransbutyrylase Back     alignment and domain information
>PRK05312 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04607 consensus Back     alignment and domain information
>PRK02848 consensus Back     alignment and domain information
>PRK03367 consensus Back     alignment and domain information
>PRK03743 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK00232 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK04507 consensus Back     alignment and domain information
>PRK03877 consensus Back     alignment and domain information
>PRK02746 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK03371 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 2; Provisional Back     alignment and domain information
>COG1995 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK03946 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02709 branched_ptb branched-chain phosphotransacylase; InterPro: IPR014081 This entry distinguishes branched-chain phosphotransacylases like that of Enterococcus faecalis from closely related subfamilies of phosphate butyryltransferase 2 Back     alignment and domain information
>TIGR03270 methan_mark_4 putative methanogen marker protein 4 Back     alignment and domain information
>COG4002 Predicted phosphotransacetylase [General function prediction only] Back     alignment and domain information
>pfam04166 PdxA Pyridoxal phosphate biosynthetic protein PdxA Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target364 putative glycerol-3-phosphate acyltransferase PlsX [Can
1u7n_A336 Crystal Structure Of The Fatty AcidPHOSPHOLIPID SYN 1e-75
1vi1_A345 Crystal Structure Of A Fatty AcidPHOSPHOLIPID SYNTH 8e-72
1r5j_A337 Crystal Structure Of A Phosphotransacetylase From S 2e-08
1td9_A329 Crystal Structure Of A Phosphotransacetylase From B 2e-11
>gi|52696026|pdb|1U7N|A Chain A, Crystal Structure Of The Fatty AcidPHOSPHOLIPID SYNTHESIS Protein Plsx From Enterococcus Faecalis V583 Length = 336 Back     alignment and structure
 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 99/339 (29%), Positives = 170/339 (50%), Gaps = 11/339 (3%)

Query: 10  GNVDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSC 69
            N   I++D  GGD   + ++ G     +  P I F +YG        +      ++   
Sbjct: 1   SNAXKIAVDAXGGDNAPQAIVEGVXLAKQDFPDIEFQLYGKEAEIKKYI----TDEKNIT 56

Query: 70  FHHCEVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLS 129
             H +  IA D+ P  A+RR +  +S   A +AVK  +A ++ +AGNTGAL+A     + 
Sbjct: 57  IIHTDEKIASDDEPVKAIRRKK-TASXVLAAQAVKNGEADAIFSAGNTGALLAAGLFIVG 115

Query: 130 RISGVDRPSLAAFWPTVKGK---CIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCP 186
           RI  V+RP L +  P           LD+GA   +   H+VQ ++LGSF+A  V  +  P
Sbjct: 116 RIKNVERPGLXSTLPVXGEPDKGFDXLDLGANADNKPEHLVQYAVLGSFYAEKVRNVQNP 175

Query: 187 SIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGN 246
            +GLLN GTEE KG+++ +++  LL         + G +EA ++  G  DV+VT+GF+GN
Sbjct: 176 RVGLLNNGTEETKGSELTKKAFELLA--ADETINFVGNVEARELLNGVADVVVTDGFTGN 233

Query: 247 IAIKAAEGAVRHISGVLQKSL-NRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVD 305
             +K+ EG   +   +L+ ++ +  +  ++G LL+K +L   K+  D     G VL G+ 
Sbjct: 234 AVLKSIEGTAXNXXSLLKTAILSEGVKGKMGALLLKNALHGXKDEXDYSKHGGAVLFGLK 293

Query: 306 GLVVKGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQ 344
             V+K HG++   ++   +   H   +   +  + +  +
Sbjct: 294 APVIKTHGATGPDAVRYTIRQIHTXLETQVVPQLVEYYE 332


>gi|40889972|pdb|1VI1|A Chain A, Crystal Structure Of A Fatty AcidPHOSPHOLIPID SYNTHESIS Protein Length = 345 Back     alignment and structure
>gi|48425286|pdb|1R5J|A Chain A, Crystal Structure Of A Phosphotransacetylase From Streptococcus Pyogenes Length = 337 Back     alignment and structure
>gi|58176784|pdb|1TD9|A Chain A, Crystal Structure Of A Phosphotransacetylase From Bacillus Subtilis Length = 329 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target364 putative glycerol-3-phosphate acyltransferase PlsX [Can
1vi1_A345 Fatty acid/phospholipid synthesis protein PLSX; structu 3e-67
1u7n_A336 Fatty acid/phospholipid synthesis protein PLSX; structu 7e-64
1yco_A279 Branched-chain phosphotransacylase; structural genomics 3e-13
>1vi1_A Fatty acid/phospholipid synthesis protein PLSX; structural genomics, unknown function; HET: MSE; 2.95A {Bacillus subtilis} SCOP: c.77.1.4 Length = 345 Back     alignment and structure
 Score =  250 bits (640), Expect = 3e-67
 Identities = 109/333 (32%), Positives = 187/333 (56%), Gaps = 7/333 (2%)

Query: 14  TISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHC 73
            I++D MGGD   + +I G  K +EA   +   + GD       L +     +R    H 
Sbjct: 4   RIAVDAMGGDHAPKAVIDGVIKGIEAFDDLHITLVGDKTTIESHLTTTS---DRITVLHA 60

Query: 74  EVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISG 133
           +  I   + P  A+RR +  SSM    + V +N+A + ++AGNTGAL+      + RI G
Sbjct: 61  DEVIEPTDEPVRAVRR-KKNSSMVLMAQEVAENRADACISAGNTGALMTAGLFIVGRIKG 119

Query: 134 VDRPSLAAFWPTVKGK-CIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLN 192
           +DRP+LA   PTV G   ++LDVGA + +   H+VQ +I+GS +++ V G+  P +GLLN
Sbjct: 120 IDRPALAPTLPTVSGDGFLLLDVGANVDAKPEHLVQYAIMGSVYSQQVRGVTSPRVGLLN 179

Query: 193 VGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAA 252
           VGTE+ KGN++ +++ ++L+        + G +EA D+     DV+VT+GF+GN+ +K  
Sbjct: 180 VGTEDKKGNELTKQTFQILKETA--NINFIGNVEARDLLDDVADVVVTDGFTGNVTLKTL 237

Query: 253 EGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGH 312
           EG+   I  +++  +  TL S++   ++K  L+E+K   +  N+ G  L G+   V+K H
Sbjct: 238 EGSALSIFKMMRDVMTSTLTSKLAAAVLKPKLKEMKMKMEYSNYGGASLFGLKAPVIKAH 297

Query: 313 GSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQR 345
           GSSD+ ++F  +  A  M       +++++++ 
Sbjct: 298 GSSDSNAVFRAIRQAREMVSQNVAALIQEEVKE 330


>1u7n_A Fatty acid/phospholipid synthesis protein PLSX; structural genomics, enterococcus faecalis V583, PSI, protein structure initiative; HET: MSE; 2.26A {Enterococcus faecalis} SCOP: c.77.1.4 Length = 336 Back     alignment and structure
>1yco_A Branched-chain phosphotransacylase; structural genomics, protein structure initiative, PSI, PTB, nysgxrc; 2.40A {Enterococcus faecalis V583} Length = 279 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target364 putative glycerol-3-phosphate acyltransferase PlsX [Can
1vi1_A345 Fatty acid/phospholipid synthesis protein PLSX; structu 100.0
1u7n_A336 Fatty acid/phospholipid synthesis protein PLSX; structu 100.0
1yco_A279 Branched-chain phosphotransacylase; structural genomics 100.0
1vmi_A355 Putative phosphate acetyltransferase; NP_416953.1, stru 100.0
1td9_A329 Phosphate acetyltransferase; structural genomics, BSGC 99.96
1r5j_A337 Putative phosphotransacetylase; lactate dehydrogenase-l 99.95
2af4_C333 Phosphate acetyltransferase; PTA dimer with one COA lig 99.94
1yxo_A328 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593, 99.07
3lxy_A334 4-hydroxythreonine-4-phosphate dehydrogenase; PDXA, NAD 98.85
2hi1_A330 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridox 98.14
>1vi1_A Fatty acid/phospholipid synthesis protein PLSX; structural genomics, unknown function; HET: MSE; 2.95A {Bacillus subtilis} SCOP: c.77.1.4 Back     alignment and structure
Probab=100.00  E-value=0  Score=843.03  Aligned_cols=332  Identities=33%  Similarity=0.597  Sum_probs=321.8

Q ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHCCC
Q ss_conf             39999746877781777999999998579917999789899999986269751557997785201778306799971376
Q gi|254780498|r   13 DTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGRN   92 (364)
Q Consensus        13 ~kIAVDaMGGD~~P~~vi~Ga~~al~~~~~i~iiLvGdee~I~~~l~~~~~~~~ri~Ii~a~~vI~mde~P~~AlR~kK~   92 (364)
                      ||||||+||||++|+++|+|+..|++++|+++|+|||++++|+++++++   .+|++|+||+++|+|+|+|+.|+|+||+
T Consensus         3 irIAvDaMGGD~~P~~vv~Ga~~al~~~~~~~i~LvG~e~~i~~~l~~~---~~ri~iv~a~~vI~m~d~p~~alr~kk~   79 (345)
T 1vi1_A            3 LRIAVDAMGGDHAPKAVIDGVIKGIEAFDDLHITLVGDKTTIESHLTTT---SDRITVLHADEVIEPTDEPVRAVRRKKN   79 (345)
T ss_dssp             EEEEEESSCSSSTTHHHHHHHHHHHHHCTTEEEEEEECHHHHHTTCCSC---CTTEEEEECCBCCCTTSCHHHHHHHCTT
T ss_pred             EEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHC---CCCEEEEECCCCCCCCCCHHHHHHHCCC
T ss_conf             2999980598668088999999999978897699992899999998536---2663899288740589876899884556


Q ss_pred             CHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCC-CEEEEECCCCCCCCHHHHHHHHH
Q ss_conf             42799999998549953999706426788888753225567632200110558898-45998613277789899999999
Q gi|254780498|r   93 VSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKG-KCIILDVGATIGSTVSHMVQLSI  171 (364)
Q Consensus        93 ~SSm~~a~~lvk~g~aDa~VSaGnTGA~la~a~~~lg~i~Gv~RPala~~~Pt~~g-~~vllD~GAN~d~~~~~L~qfA~  171 (364)
                       ||||+|+++||+|++||+||||||||+|+++++++||+|||+||||+++|||.++ +++|||+|||+||+|++|+|||+
T Consensus        80 -SSm~~a~~lvk~g~ada~VSaGnTGAl~a~a~~~l~~i~gi~RPaia~~~Pt~~g~~~~llD~GAN~d~~p~~L~qFA~  158 (345)
T 1vi1_A           80 -SSMVLMAQEVAENRADACISAGNTGALMTAGLFIVGRIKGIDRPALAPTLPTVSGDGFLLLDVGANVDAKPEHLVQYAI  158 (345)
T ss_dssp             -BHHHHHHHHHHTTSCSEEEECSCHHHHHHHHHHTTCBCTTCSSCEEECEECCSSSCCEEEECSSSCSSCCHHHHHHHHH
T ss_pred             -CHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCEEEECCCCCCCCHHHHHHHHH
T ss_conf             -5599999983032467798446438999999987751047555531255456689861797378566779899999999


Q ss_pred             HHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCEECCCCHHHCCCCCCCEEEECCHHHHHHHHH
Q ss_conf             99999998568999658998404555556579999999974024571320023455453245683899755127889999
Q gi|254780498|r  172 LGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKA  251 (364)
Q Consensus       172 mGs~yak~~~~~~~PrVgLLNiG~E~~KG~~~~kea~~LL~~~~~~~~nF~GniEg~~i~~g~~DVvV~DGFtGNi~LKt  251 (364)
                      ||++|+|.++++++|||||||||+|++||++++|+||+||++..  +|||+|||||+|||+|.+||||||||||||+|||
T Consensus       159 mGs~yak~~~g~~~PrVgLLNiG~E~~KG~~~~kea~~lL~~~~--~~nf~GnvEg~di~~g~~DVvV~DGFtGNi~LKt  236 (345)
T 1vi1_A          159 MGSVYSQQVRGVTSPRVGLLNVGTEDKKGNELTKQTFQILKETA--NINFIGNVEARDLLDDVADVVVTDGFTGNVTLKT  236 (345)
T ss_dssp             HHHHHHHHTSCCSSCEEEEEESSSSTTCSCHHHHHHHHHHHSCT--TSEEEEEEEGGGGGGTSCSEEECCHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHCC--CCCEEEECCCCCCCCCCCEEEEECCCHHHHHHHH
T ss_conf             99999999559999947776356656676699999999887518--9615875576656789940999788235999985


Q ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCHHHCCCEEEEEECCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             88889999999998632220889999998999999997269687087467421614898388998689999999999999
Q gi|254780498|r  252 AEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLGIAHNMS  331 (364)
Q Consensus       252 ~EG~~~~~~~~lk~~~~~~~~~~~~~~l~~~~l~~~~~~~d~~~~gGa~llGl~g~vik~HG~s~~~a~~~ai~~a~~~~  331 (364)
                      +||+++++++++|++++++++++++++++++.|++++++|||++|||||||||||+||||||+|+++||+|||++|.+++
T Consensus       237 ~EG~~~~i~~~lk~~~~~~~~~k~~~ll~~~~l~~l~~~~D~~~~gGA~lLGl~givik~HGsS~~~ai~nAI~~A~~~~  316 (345)
T 1vi1_A          237 LEGSALSIFKMMRDVMTSTLTSKLAAAVLKPKLKEMKMKMEYSNYGGASLFGLKAPVIKAHGSSDSNAVFRAIRQAREMV  316 (345)
T ss_dssp             HHHHHHHHHHHHHHHHTTTC-------CCHHHHHHHHHHHCGGGSCCEEEETBSSCEEECCTTCCHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             52067899999999986548888899987999999997579120799889737810899389999899999999999999


Q ss_pred             HCCHHHHHHHHHHHHHHHH
Q ss_conf             6070689999999998767
Q gi|254780498|r  332 QNGFIDMVKDDMQRVRDSL  350 (364)
Q Consensus       332 ~~~~~~~i~~~~~~~~~~~  350 (364)
                      +++++++|++++++.++..
T Consensus       317 ~~~l~~~I~~~l~~~~~~~  335 (345)
T 1vi1_A          317 SQNVAALIQEEVKEEKTDE  335 (345)
T ss_dssp             HTTHHHHHHHHTSHHHHTC
T ss_pred             HHHHHHHHHHHHHHHCCCC
T ss_conf             9668999999997511543



>1u7n_A Fatty acid/phospholipid synthesis protein PLSX; structural genomics, enterococcus faecalis V583, PSI, protein structure initiative; HET: MSE; 2.26A {Enterococcus faecalis} SCOP: c.77.1.4 Back     alignment and structure
>1yco_A Branched-chain phosphotransacylase; structural genomics, protein structure initiative, PSI, PTB, nysgxrc; 2.40A {Enterococcus faecalis V583} Back     alignment and structure
>1vmi_A Putative phosphate acetyltransferase; NP_416953.1, structural genomics, JCSG, protein structure initiative, PSI; 2.32A {Escherichia coli} SCOP: c.77.1.5 Back     alignment and structure
>1td9_A Phosphate acetyltransferase; structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 2.75A {Bacillus subtilis} SCOP: c.77.1.5 PDB: 1xco_A Back     alignment and structure
>1r5j_A Putative phosphotransacetylase; lactate dehydrogenase-like nucleotide-binding fold, structural genomics, BSGC structure funded by NIH; 2.70A {Streptococcus pyogenes} SCOP: c.77.1.5 Back     alignment and structure
>2af4_C Phosphate acetyltransferase; PTA dimer with one COA ligand bound PER monomer, acyltransferase; HET: COA; 2.15A {Methanosarcina thermophila} SCOP: c.77.1.5 PDB: 1qzt_A* 2af3_C* Back     alignment and structure
>1yxo_A 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593,pyridoxine biosynthesis,oxidoreductase, structural genomics, PSI; 2.01A {Pseudomonas aeruginosa} Back     alignment and structure
>3lxy_A 4-hydroxythreonine-4-phosphate dehydrogenase; PDXA, NAD- dependent, metal-binding, NAD, NADP, oxidoreductase, pyridoxine biosynthesis; HET: SUC; 1.70A {Yersinia pestis} PDB: 1ps6_A* 1ptm_A 1ps7_A 1r8k_A Back     alignment and structure
>2hi1_A 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridoxal phosphate biosynthesis, structural genomics, PSI-2; 2.30A {Salmonella typhimurium LT2} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 364 putative glycerol-3-phosphate acyltransferase PlsX [Can
d1u7na_329 c.77.1.4 (A:) Fatty acid/phospholipid synthesis protein 1e-66
d1vi1a_334 c.77.1.4 (A:) Fatty acid/phospholipid synthesis protein 1e-65
>d1u7na_ c.77.1.4 (A:) Fatty acid/phospholipid synthesis protein PlsX {Enterococcus faecalis [TaxId: 1351]} Length = 329 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: PlsX-like
domain: Fatty acid/phospholipid synthesis protein PlsX
species: Enterococcus faecalis [TaxId: 1351]
 Score =  247 bits (631), Expect = 1e-66
 Identities = 102/335 (30%), Positives = 175/335 (52%), Gaps = 11/335 (3%)

Query: 14  TISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHC 73
            I++D MGGD   + ++ G     +  P I F +YG        +     +       H 
Sbjct: 2   KIAVDAMGGDNAPQAIVEGVMLAKQDFPDIEFQLYGKEAEIKKYITDEKNIT----IIHT 57

Query: 74  EVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISG 133
           +  IA D+ P  A+RR +  +SM  A +AVK  +A ++ +AGNTGAL+A     + RI  
Sbjct: 58  DEKIASDDEPVKAIRRKKT-ASMVLAAQAVKNGEADAIFSAGNTGALLAAGLFIVGRIKN 116

Query: 134 VDRPSLAAFWPTVKGK---CIILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGL 190
           V+RP L +  P +        +LD+GA   +   H+VQ ++LGSF+A  V  +  P +GL
Sbjct: 117 VERPGLMSTLPVMGEPDKGFDMLDLGANADNKPEHLVQYAVLGSFYAEKVRNVQNPRVGL 176

Query: 191 LNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIK 250
           LN GTEE KG+++ +++  LL         + G +EA ++  G  DV+VT+GF+GN  +K
Sbjct: 177 LNNGTEETKGSELTKKAFELL--AADETINFVGNVEARELLNGVADVVVTDGFTGNAVLK 234

Query: 251 AAEGAVRHISGVLQKS-LNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVV 309
           + EG   ++  +L+ + L+  +  ++G LL+K +L  +K+  D     G VL G+   V+
Sbjct: 235 SIEGTAMNMMSLLKTAILSEGVKGKMGALLLKNALHGMKDEMDYSKHGGAVLFGLKAPVI 294

Query: 310 KGHGSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQ 344
           K HG++   ++   +   H M +   +  + +  +
Sbjct: 295 KTHGATGPDAVRYTIRQIHTMLETQVVPQLVEYYE 329


>d1vi1a_ c.77.1.4 (A:) Fatty acid/phospholipid synthesis protein PlsX {Bacillus subtilis [TaxId: 1423]} Length = 334 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target364 putative glycerol-3-phosphate acyltransferase PlsX [Can
d1vi1a_334 Fatty acid/phospholipid synthesis protein PlsX {Bacillu 100.0
d1u7na_329 Fatty acid/phospholipid synthesis protein PlsX {Enteroc 100.0
d1vmia_329 Ethanolamine utilization protein EutD {Escherichia coli 100.0
d1xcoa_324 Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 14 99.96
d1r5ja_329 Phosphotransacetylase Pta {Streptococcus pyogenes [TaxI 99.95
d2af4c1332 Phosphotransacetylase Pta {Methanosarcina thermophila [ 99.95
d1ptma_329 4-hydroxythreonine-4-phosphate dehydrogenase PdxA {Esch 98.58
>d1vi1a_ c.77.1.4 (A:) Fatty acid/phospholipid synthesis protein PlsX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: PlsX-like
domain: Fatty acid/phospholipid synthesis protein PlsX
species: Bacillus subtilis [TaxId: 1423]
Probab=100.00  E-value=0  Score=833.41  Aligned_cols=331  Identities=33%  Similarity=0.602  Sum_probs=321.6

Q ss_pred             EEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHCC
Q ss_conf             23999974687778177799999999857991799978989999998626975155799778520177830679997137
Q gi|254780498|r   12 VDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGR   91 (364)
Q Consensus        12 m~kIAVDaMGGD~~P~~vi~Ga~~al~~~~~i~iiLvGdee~I~~~l~~~~~~~~ri~Ii~a~~vI~mde~P~~AlR~kK   91 (364)
                      .||||||+||||++|.++|+|+..|++++|+++|+||||+++|++++++.   .++++|+||+++|+|+|+|+.|+|+||
T Consensus         1 sirIAvDaMGGD~~P~~~v~Ga~~al~~~~~~~i~LvG~~~~i~~~l~~~---~~~i~Ivha~~~I~m~d~p~~alr~kk   77 (334)
T d1vi1a_           1 SLRIAVDAMGGDHAPKAVIDGVIKGIEAFDDLHITLVGDKTTIESHLTTT---SDRITVLHADEVIEPTDEPVRAVRRKK   77 (334)
T ss_dssp             CEEEEEESSCSSSTTHHHHHHHHHHHHHCTTEEEEEEECHHHHHTTCCSC---CTTEEEEECCBCCCTTSCHHHHHHHCT
T ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHC---CCCEEEECCCCCCCCCCCHHHHHHHCC
T ss_conf             95999981487658288999999999878898699995899999998537---366499838873158862257888443


Q ss_pred             CCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCCC-EEEEECCCCCCCCHHHHHHHH
Q ss_conf             6427999999985499539997064267888887532255676322001105588984-599861327778989999999
Q gi|254780498|r   92 NVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKGK-CIILDVGATIGSTVSHMVQLS  170 (364)
Q Consensus        92 ~~SSm~~a~~lvk~g~aDa~VSaGnTGA~la~a~~~lg~i~Gv~RPala~~~Pt~~g~-~vllD~GAN~d~~~~~L~qfA  170 (364)
                      + ||||+|+++||+|++|++||||||||+|+.+++++||||||+||||+++|||.++. ++|||+|||+||+|++|+|||
T Consensus        78 ~-SSm~~a~~lvk~g~ada~VSaGnTGAl~a~a~~~l~~i~gi~RPaia~~~Pt~~g~~~vllD~GAN~~~~~~~L~qFA  156 (334)
T d1vi1a_          78 N-SSMVLMAQEVAENRADACISAGNTGALMTAGLFIVGRIKGIDRPALAPTLPTVSGDGFLLLDVGANVDAKPEHLVQYA  156 (334)
T ss_dssp             T-BHHHHHHHHHHTTSCSEEEECSCHHHHHHHHHHTTCBCTTCSSCEEECEECCSSSCCEEEECSSSCSSCCHHHHHHHH
T ss_pred             C-CHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCHHHHHEECCCCCCCCEEEECCCCCCCCCHHHHHHHH
T ss_conf             3-159999998641455727853675455765876675312431003330177777876289717867678819999999


Q ss_pred             HHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCEECCCCHHHCCCCCCCEEEECCHHHHHHHH
Q ss_conf             99999999856899965899840455555657999999997402457132002345545324568389975512788999
Q gi|254780498|r  171 ILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIK  250 (364)
Q Consensus       171 ~mGs~yak~~~~~~~PrVgLLNiG~E~~KG~~~~kea~~LL~~~~~~~~nF~GniEg~~i~~g~~DVvV~DGFtGNi~LK  250 (364)
                      +||++|+|.++++++|||||||||+|++||++++|+||+||++..  +|||+|||||+|||+|.+||||||||||||+||
T Consensus       157 ~mG~~ya~~~~~~~~P~VgLLNiG~E~~KG~~~~k~a~~lL~~~~--~~nf~GniEg~di~~g~~DVvV~DGFtGNv~LK  234 (334)
T d1vi1a_         157 IMGSVYSQQVRGVTSPRVGLLNVGTEDKKGNELTKQTFQILKETA--NINFIGNVEARDLLDDVADVVVTDGFTGNVTLK  234 (334)
T ss_dssp             HHHHHHHHHTSCCSSCEEEEEESSSSTTCSCHHHHHHHHHHHSCT--TSEEEEEEEGGGGGGTSCSEEECCHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCC--CCCEEEEECCEECCCCCEEEEEECCCHHHHHHH
T ss_conf             999999998489754346764044556664378999998753137--844266522200247836899975600457877


Q ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCHHHCCCEEEEEECCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             98888999999999863222088999999899999999726968708746742161489838899868999999999999
Q gi|254780498|r  251 AAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLGIAHNM  330 (364)
Q Consensus       251 t~EG~~~~~~~~lk~~~~~~~~~~~~~~l~~~~l~~~~~~~d~~~~gGa~llGl~g~vik~HG~s~~~a~~~ai~~a~~~  330 (364)
                      |+||+++++.++||++++++++++++++++++.|+++++++||++|||||||||||+||||||+|+++||+|||++|.++
T Consensus       235 t~EG~~~~~~~~lk~~~~~~~~~~~~~~l~~~~l~~l~~~~d~~~~gGa~lLGlng~vik~HG~S~~~ai~nAI~~a~~~  314 (334)
T d1vi1a_         235 TLEGSALSIFKMMRDVMTSTLTSKLAAAVLKPKLKEMKMKMEYSNYGGASLFGLKAPVIKAHGSSDSNAVFRAIRQAREM  314 (334)
T ss_dssp             HHHHHHHHHHHHHHHHHTTTC-------CCHHHHHHHHHHHCGGGSCCEEEETBSSCEEECCTTCCHHHHHHHHHHHHHH
T ss_pred             HHCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             62115889999999876122266788887899999998757901039868971682189927999989999999999999


Q ss_pred             HHCCHHHHHHHHHHHHHH
Q ss_conf             960706899999999987
Q gi|254780498|r  331 SQNGFIDMVKDDMQRVRD  348 (364)
Q Consensus       331 ~~~~~~~~i~~~~~~~~~  348 (364)
                      ++++++++|++++++.++
T Consensus       315 v~~~~~~~i~~~l~~~~~  332 (334)
T d1vi1a_         315 VSQNVAALIQEEVKEEKT  332 (334)
T ss_dssp             HHTTHHHHHHHHTSHHHH
T ss_pred             HHHCHHHHHHHHHHHHCC
T ss_conf             986889999999975203



>d1u7na_ c.77.1.4 (A:) Fatty acid/phospholipid synthesis protein PlsX {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vmia_ c.77.1.5 (A:) Ethanolamine utilization protein EutD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xcoa_ c.77.1.5 (A:) Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r5ja_ c.77.1.5 (A:) Phosphotransacetylase Pta {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2af4c1 c.77.1.5 (C:2-333) Phosphotransacetylase Pta {Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1ptma_ c.77.1.3 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 364 putative glycerol-3-phosphate acyltransferase PlsX
1vi1_A_345 (A:) Fatty acid/phospholipid synthesis protein PLS 3e-48
1u7n_A_1-119_283-336173 (A:1-119,A:283-336) Fatty acid/phospholipid synthe 3e-29
1u7n_A_1-119_283-336173 (A:1-119,A:283-336) Fatty acid/phospholipid synthe 1e-09
1u7n_A_120-228109 (A:120-228) Fatty acid/phospholipid synthesis prot 6e-28
1yco_A_95-246152 (A:95-246) Branched-chain phosphotransacylase; str 8e-13
>1vi1_A (A:) Fatty acid/phospholipid synthesis protein PLSX; structural genomics, unknown function; HET: MSE; 2.95A {Bacillus subtilis}Length = 345 Back     alignment and structure
 Score =  186 bits (473), Expect = 3e-48
 Identities = 108/340 (31%), Positives = 180/340 (52%), Gaps = 7/340 (2%)

Query: 14  TISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHC 73
            I++D  GGD   + +I G  K +EA   +   + GD       L +      R    H 
Sbjct: 4   RIAVDAXGGDHAPKAVIDGVIKGIEAFDDLHITLVGDKTTIESHLTTTSD---RITVLHA 60

Query: 74  EVSIAMDERPADALRRGRNVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISG 133
           +  I   + P  A+RR +N S +  A + V +N+A + ++AGNTGAL       + RI G
Sbjct: 61  DEVIEPTDEPVRAVRRKKNSSXVLXA-QEVAENRADACISAGNTGALXTAGLFIVGRIKG 119

Query: 134 VDRPSLAAFWPTVKGKC-IILDVGATIGSTVSHMVQLSILGSFFARSVAGINCPSIGLLN 192
           +DRP+LA   PTV G   ++LDVGA + +   H+VQ +I GS +++ V G+  P +GLLN
Sbjct: 120 IDRPALAPTLPTVSGDGFLLLDVGANVDAKPEHLVQYAIXGSVYSQQVRGVTSPRVGLLN 179

Query: 193 VGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIKAA 252
           VGTE+ KGN++ +++ ++L+      F   G +EA D+     DV+VT+GF+GN+ +K  
Sbjct: 180 VGTEDKKGNELTKQTFQILKETANINFI--GNVEARDLLDDVADVVVTDGFTGNVTLKTL 237

Query: 253 EGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGH 312
           EG+   I    +     TL S++   ++K  L+E K   +  N+ G  L G+   V+K H
Sbjct: 238 EGSALSIFKXXRDVXTSTLTSKLAAAVLKPKLKEXKXKXEYSNYGGASLFGLKAPVIKAH 297

Query: 313 GSSDAKSIFNVLGIAHNMSQNGFIDMVKDDMQRVRDSLLD 352
           GSSD+ ++F  +  A          +++++++  +     
Sbjct: 298 GSSDSNAVFRAIRQAREXVSQNVAALIQEEVKEEKTDEEG 337


>1u7n_A (A:1-119,A:283-336) Fatty acid/phospholipid synthesis protein PLSX; structural genomics, enterococcus faecalis V583, PSI, protein structure initiative; HET: MSE; 2.26A {Enterococcus faecalis}Length = 173 Back     alignment and structure
>1u7n_A (A:1-119,A:283-336) Fatty acid/phospholipid synthesis protein PLSX; structural genomics, enterococcus faecalis V583, PSI, protein structure initiative; HET: MSE; 2.26A {Enterococcus faecalis}Length = 173 Back     alignment and structure
>1u7n_A (A:120-228) Fatty acid/phospholipid synthesis protein PLSX; structural genomics, enterococcus faecalis V583, PSI, protein structure initiative; HET: MSE; 2.26A {Enterococcus faecalis}Length = 109 Back     alignment and structure
>1yco_A (A:95-246) Branched-chain phosphotransacylase; structural genomics, protein structure initiative, PSI, PTB, nysgxrc; 2.40A {Enterococcus faecalis V583}Length = 152 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target364 putative glycerol-3-phosphate acyltransferase PlsX [Can
1vi1_A_345 Fatty acid/phospholipid synthesis protein PLSX; st 100.0
1u7n_A_1-119_283-336173 Fatty acid/phospholipid synthesis protein PLSX; st 100.0
1yxo_A_328 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA 98.94
1ptm_A_329 4-hydroxythreonine-4-phosphate dehydrogenase; crys 98.84
1u7n_A_120-228109 Fatty acid/phospholipid synthesis protein PLSX; st 100.0
1yco_A_95-246152 Branched-chain phosphotransacylase; structural gen 99.94
1td9_A_151-302152 Phosphate acetyltransferase; structural genomics, 99.18
1r5j_A_153-306154 Putative phosphotransacetylase; lactate dehydrogen 99.17
2af4_C_144-302159 Phosphate acetyltransferase; PTA dimer with one CO 99.09
1vmi_A_1-23_155-309178 Putative phosphate acetyltransferase; NP_416953.1, 99.02
1r5j_A_1-152_307-337183 Putative phosphotransacetylase; lactate dehydrogen 99.08
1vmi_A_24-154_310-355177 Putative phosphate acetyltransferase; NP_416953.1, 98.87
2af4_C_1-143_303-333174 Phosphate acetyltransferase; PTA dimer with one CO 98.86
1td9_A_1-150_303-329177 Phosphate acetyltransferase; structural genomics, 99.06
1yco_A_1-94_247-279127 Branched-chain phosphotransacylase; structural gen 97.06
2hi1_A_330 4-hydroxythreonine-4-phosphate dehydrogenase 2; py 98.39
>1vi1_A (A:) Fatty acid/phospholipid synthesis protein PLSX; structural genomics, unknown function; HET: MSE; 2.95A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=0  Score=549.04  Aligned_cols=339  Identities=32%  Similarity=0.547  Sum_probs=324.2

Q ss_pred             EEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHCC
Q ss_conf             23999974687778177799999999857991799978989999998626975155799778520177830679997137
Q gi|254780498|r   12 VDTISLDLMGGDLGARDLILGASKFLEAHPRIRFLMYGDAKVCLPILDSHPLLKERSCFHHCEVSIAMDERPADALRRGR   91 (364)
Q Consensus        12 m~kIAVDaMGGD~~P~~vi~Ga~~al~~~~~i~iiLvGdee~I~~~l~~~~~~~~ri~Ii~a~~vI~mde~P~~AlR~kK   91 (364)
                      -+||++|+||||+||++.+.+|..++.+++.++++|||+++.|++.+++++.   ++..+++.+.+.|++.|..++|++|
T Consensus         2 ~~rIa~~~~g~deg~d~~vl~A~~~~~~~~~~~~iLvG~~~~I~~~l~~~~~---~~~~~~~~~~~~~~~~~~~a~r~~~   78 (345)
T 1vi1_A            2 SLRIAVDAXGGDHAPKAVIDGVIKGIEAFDDLHITLVGDKTTIESHLTTTSD---RITVLHADEVIEPTDEPVRAVRRKK   78 (345)
T ss_dssp             CEEEEEESSCSSSTTHHHHHHHHHHHHHCTTEEEEEEECHHHHHTTCCSCCT---TEEEEECCBCCCTTSCHHHHHHHCT
T ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHCCC---CEEEECCCCCCCCCCCHHHHHHHHH
T ss_conf             5299998048855818899999999987889869999489999999843705---6389858762058865578988511


Q ss_pred             CCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCC-CEEEEECCCCCCCCHHHHHHHH
Q ss_conf             642799999998549953999706426788888753225567632200110558898-4599861327778989999999
Q gi|254780498|r   92 NVSSMWRAIEAVKKNQAASVVTAGNTGALIAMARLCLSRISGVDRPSLAAFWPTVKG-KCIILDVGATIGSTVSHMVQLS  170 (364)
Q Consensus        92 ~~SSm~~a~~lvk~g~aDa~VSaGnTGA~la~a~~~lg~i~Gv~RPala~~~Pt~~g-~~vllD~GAN~d~~~~~L~qfA  170 (364)
                      + +||+.|++||++|++|++||+|||+++++.+++++|+++++.||+++.++|+.++ .++|+|+|+|++|+|++|+|||
T Consensus        79 ~-~s~~~a~~lv~~G~aD~~vsg~~t~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~l~D~g~n~~p~~~~l~~iA  157 (345)
T 1vi1_A           79 N-SSXVLXAQEVAENRADACISAGNTGALXTAGLFIVGRIKGIDRPALAPTLPTVSGDGFLLLDVGANVDAKPEHLVQYA  157 (345)
T ss_dssp             T-BHHHHHHHHHHTTSCSEEEECSCHHHHHHHHHHTTCBCTTCSSCEEECEECCSSSCCEEEECSSSCSSCCHHHHHHHH
T ss_pred             H-HHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCEEEEECCCCCCCCCHHHHHHH
T ss_conf             0-289999998631465647744671778999988775313553342002266778996079827867678808999999


Q ss_pred             HHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCCEECCCCHHHCCCCCCCEEEECCHHHHHHHH
Q ss_conf             99999999856899965899840455555657999999997402457132002345545324568389975512788999
Q gi|254780498|r  171 ILGSFFARSVAGINCPSIGLLNVGTEEIKGNDVLQESARLLRGECCGAFKYKGFIEANDIAKGFVDVIVTEGFSGNIAIK  250 (364)
Q Consensus       171 ~mGs~yak~~~~~~~PrVgLLNiG~E~~KG~~~~kea~~LL~~~~~~~~nF~GniEg~~i~~g~~DVvV~DGFtGNi~LK  250 (364)
                      +|+++|++.++|+++|||||||+|+|++||.+.+++|+++|++.  +++||.||+|+++++++++||+|||||+||+.+|
T Consensus       158 ~~~a~~~~~~lGie~PkValLs~g~~~~~~~~~~~eA~~ll~~~--~~~~~~G~ie~~~~l~~~~~v~v~dg~~~n~~~k  235 (345)
T 1vi1_A          158 IXGSVYSQQVRGVTSPRVGLLNVGTEDKKGNELTKQTFQILKET--ANINFIGNVEARDLLDDVADVVVTDGFTGNVTLK  235 (345)
T ss_dssp             HHHHHHHHHTSCCSSCEEEEEESSSSTTCSCHHHHHHHHHHHSC--TTSEEEEEEEGGGGGGTSCSEEECCHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHC--CCCCEEEEECCCEECCCCEEEEEECCHHHHHHHH
T ss_conf             99999999955976522787404455776227899999875323--7843477503542038945799974311238998


Q ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCHHHCCCEEEEEECCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             98888999999999863222088999999899999999726968708746742161489838899868999999999999
Q gi|254780498|r  251 AAEGAVRHISGVLQKSLNRTLLSRIGCLLIKKSLREVKEGFDPRNFNGGVLLGVDGLVVKGHGSSDAKSIFNVLGIAHNM  330 (364)
Q Consensus       251 t~EG~~~~~~~~lk~~~~~~~~~~~~~~l~~~~l~~~~~~~d~~~~gGa~llGl~g~vik~HG~s~~~a~~~ai~~a~~~  330 (364)
                      ++||.+.+++++||+.++++++..+.+..+...+.+++.++||..|+|++|+|++++|+++||+|++.+++|+|..|...
T Consensus       236 ~~eG~a~~l~~~lk~~~~~~i~p~l~a~ni~~kl~~~~~~~~~~~~~G~illG~~~pv~~~sr~s~~~~i~~~i~~a~~~  315 (345)
T 1vi1_A          236 TLEGSALSIFKXXRDVXTSTLTSKLAAAVLKPKLKEXKXKXEYSNYGGASLFGLKAPVIKAHGSSDSNAVFRAIRQAREX  315 (345)
T ss_dssp             HHHHHHHHHHHHHHHHHTTTC-------CCHHHHHHHHHHHCGGGSCCEEEETBSSCEEECCTTCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             76547889999999886110466788888789999999746933029778972683289947999989999999999999


Q ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             96070689999999998767522233
Q gi|254780498|r  331 SQNGFIDMVKDDMQRVRDSLLDVHEK  356 (364)
Q Consensus       331 ~~~~~~~~i~~~~~~~~~~~~~~~~~  356 (364)
                      ++++++++|++++++.+.+.++..+.
T Consensus       316 a~~~~~~~i~~~l~~~~~~~~~~~~~  341 (345)
T 1vi1_A          316 VSQNVAALIQEEVKEEKTDEEGGSHH  341 (345)
T ss_dssp             HHTTHHHHHHHHTSHHHHTC------
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             98668999999997503643478656



>1u7n_A (A:1-119,A:283-336) Fatty acid/phospholipid synthesis protein PLSX; structural genomics, enterococcus faecalis V583, PSI, protein structure initiative; HET: MSE; 2.26A {Enterococcus faecalis} Back     alignment and structure
>1yxo_A (A:) 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593,pyridoxine biosynthesis,oxidoreductase, structural genomics, PSI; 2.01A {Pseudomonas aeruginosa} Back     alignment and structure
>1ptm_A (A:) 4-hydroxythreonine-4-phosphate dehydrogenase; crystal strucrure, PDXA, pyridoxal 5'-phosphate biosynthesis, PLP; 1.96A {Escherichia coli} Back     alignment and structure
>1u7n_A (A:120-228) Fatty acid/phospholipid synthesis protein PLSX; structural genomics, enterococcus faecalis V583, PSI, protein structure initiative; HET: MSE; 2.26A {Enterococcus faecalis} Back     alignment and structure
>1yco_A (A:95-246) Branched-chain phosphotransacylase; structural genomics, protein structure initiative, PSI, PTB, nysgxrc; 2.40A {Enterococcus faecalis V583} Back     alignment and structure
>1td9_A (A:151-302) Phosphate acetyltransferase; structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 2.75A {Bacillus subtilis} Back     alignment and structure
>1r5j_A (A:153-306) Putative phosphotransacetylase; lactate dehydrogenase-like nucleotide-binding fold, structural genomics, BSGC structure funded by NIH; 2.70A {Streptococcus pyogenes} Back     alignment and structure
>2af4_C (C:144-302) Phosphate acetyltransferase; PTA dimer with one COA ligand bound PER monomer, acyltransferase; HET: COA; 2.15A {Methanosarcina thermophila} Back     alignment and structure
>1vmi_A (A:1-23,A:155-309) Putative phosphate acetyltransferase; NP_416953.1, structural genomics, JCSG, protein structure initiative, PSI; 2.32A {Escherichia coli} Back     alignment and structure
>1r5j_A (A:1-152,A:307-337) Putative phosphotransacetylase; lactate dehydrogenase-like nucleotide-binding fold, structural genomics, BSGC structure funded by NIH; 2.70A {Streptococcus pyogenes} Back     alignment and structure
>1vmi_A (A:24-154,A:310-355) Putative phosphate acetyltransferase; NP_416953.1, structural genomics, JCSG, protein structure initiative, PSI; 2.32A {Escherichia coli} Back     alignment and structure
>2af4_C (C:1-143,C:303-333) Phosphate acetyltransferase; PTA dimer with one COA ligand bound PER monomer, acyltransferase; HET: COA; 2.15A {Methanosarcina thermophila} Back     alignment and structure
>1td9_A (A:1-150,A:303-329) Phosphate acetyltransferase; structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; 2.75A {Bacillus subtilis} Back     alignment and structure
>1yco_A (A:1-94,A:247-279) Branched-chain phosphotransacylase; structural genomics, protein structure initiative, PSI, PTB, nysgxrc; 2.40A {Enterococcus faecalis V583} Back     alignment and structure
>2hi1_A (A:) 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridoxal phosphate biosynthesis, structural genomics, PSI-2; 2.30A {Salmonella typhimurium LT2} Back     alignment and structure