254780504

254780504

glucose-6-phosphate 1-dehydrogenase

GeneID in NCBI database:8209499Locus tag:CLIBASIA_01955
Protein GI in NCBI database:254780504Protein Accession:YP_003064917.1
Gene range:-(770971, 772449)Protein Length:492aa
Gene description:glucose-6-phosphate 1-dehydrogenase
COG prediction:[G] Glucose-6-phosphate 1-dehydrogenase
KEGG prediction:glucose-6-phosphate 1-dehydrogenase (EC:1.1.1.49); K00036 glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49]
SEED prediction:Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)
Pathway involved in KEGG:Pentose phosphate pathway [PATH:las00030]
Glutathione metabolism [PATH:las00480]
Subsystem involved in SEED:Pentose phosphate pathway;
Formaldehyde assimilation: Ribulose monophosphate pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490--
MQNHTPNIHNSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESYRSFVDKELQRYLKDGEYNPLKVQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANNLVTEHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGIPVKGYLEEIPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRTPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLLQKDGRRWHNNT
cccccccccccEEEEEccccHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHccEEEEcccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHccHHHEEEEccccccHHHHHHHHHHHccHHHHHHHccccccEEEEEEccccccccHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHcccEEEEEccccccccccccccccccccccccccEEEEEEEEcccccccccEEEEccccccccEEEEEEEEEccccHHcccccccccccEEEEEEccccEEEEEEEEEEcccccEEEEEEEEEEEEccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccc
cccccccccccEEEEEccccHHHHHcHHHHHHHHHHcccccccccEEEEEEcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHcccccHHHEEEcccccccccccHHHHHHHccHHHHcccccccEEEEEEEEEccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHHccEccccHHHHHHHEEEEEEccccccccccccccccccccccccccEEEEEEEEcccccccccEEEEccccccccEEEEEEEEccccccHHHHHHHcccccEEEEEEcccccEEEEEEEccccccccccEEccccccHHHHcccccHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccEccccc
mqnhtpnihnsdfiifggtgdlakrklfpalynnytnreenqisSRIIGICRIKMTVESYRSFVDKELQRYLkdgeynplkvQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANNLVTEHTRVVlekpigsnlssAQEIHAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAmemppsveaksikNEKIKVLQALQMITPENVQKLTVRGQyqsgiingipvkgyleeiplgisdtETFVAIKAnidnprwsgipfylrTGKYLAKHISEIVIalkpapctifdhqmskIETNKLILRLQNNGEIEqfittkdhstsnmklktTALRICCcskrikrtpdgYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDyyaagtwgpdqsdvllqkdgrrwhnnt
mqnhtpnihnsdfiiFGGTGDLAKRKLFPALYNNytnreenqissriiGICRIKMTVESYRSFVDKELQRYLkdgeynplKVQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANNLVTEHTRVVLEkpigsnlssaQEIHAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTaetigvedRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGIPVKGYLEEIPLGISDTETFVAIKanidnprwsgipFYLRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFittkdhstsnmklkttalricccskrIKRTPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAgtwgpdqsdvllqkdgrrwhnnt
MQNHTPNIHNSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESYRSFVDKELQRYLKDGEYNPLKVQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANNLVTEHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGIPVKGYLEEIPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRTPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLLQKDGRRWHNNT
******N**NSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESYRSFVDKELQR*****EYNPLKVQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANNLVTEHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGIPVKGYLEEIPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRTPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLLQKDG**WH***
MQNHTPNIHNSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESYRSFVDKELQRYLKDGEYNPLKVQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANNLVTEHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGIPVKGYLEEIPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRTPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLLQKDGRRWHNNT
*****PNIHNSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESYRSFVDKELQRYLKDGEYNPLKVQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANNLVTEHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGIPVKGYLEEIPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRTPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLLQKDG*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNHTPNIHNSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESYRSFVDKELQRYLKDGEYNPLKVQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANNLVTEHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGIPVKGYLEEIPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRTPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLLQKDGRRWHNNT
MQNHTPNIHNSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESYRSFVDKELQRYLKDGEYNPLKVQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANNLVTEHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGIPVKGYLEEIPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRTPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLLQKDGRRWHNNT
MQNHTPNIHNSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESYRSFVDKELQRYLKDGEYNPLKVQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANNLVTEHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGIPVKGYLEEIPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRTPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLLQKDGRRWHNNT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target492 glucose-6-phosphate 1-dehydrogenase [Candidatus Liberib
315122299493 glucose-6-phosphate 1-dehydrogenase [Candidatus Liberib 1 0.0
222084912491 glucose-6-phosphate 1-dehydrogenase [Agrobacterium radi 1 1e-154
116250525491 glucose-6-phosphate 1-dehydrogenase [Rhizobium legumino 1 1e-153
241203149491 glucose-6-phosphate 1-dehydrogenase [Rhizobium legumino 1 1e-153
325291988502 Glucose-6-phosphate 1-dehydrogenase [Agrobacterium sp. 1 1e-152
159184383491 glucose-6-phosphate 1-dehydrogenase [Agrobacterium tume 1 1e-152
209547971491 glucose-6-phosphate 1-dehydrogenase [Rhizobium legumino 1 1e-152
86356355491 glucose-6-phosphate 1-dehydrogenase [Rhizobium etli CFN 1 1e-152
150395527491 glucose-6-phosphate 1-dehydrogenase [Sinorhizobium medi 1 1e-151
190890410491 glucose-6-phosphate 1-dehydrogenase [Rhizobium etli CIA 1 1e-151
>gi|315122299|ref|YP_004062788.1| glucose-6-phosphate 1-dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 493 Back     alignment and organism information
 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/491 (74%), Positives = 429/491 (87%)

Query: 1   MQNHTPNIHNSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESY 60
           M  H  +I+N DF+IFGGTGDLAKRKL PALYNNY N+EE  +SSRIIG+CR+KMTV+ Y
Sbjct: 1   MPKHATHIYNFDFVIFGGTGDLAKRKLLPALYNNYVNKEECHVSSRIIGVCRVKMTVDKY 60

Query: 61  RSFVDKELQRYLKDGEYNPLKVQKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFY 120
           RSFV+KEL+++LK+ EYN LKV++FLSLI YINLD+E NYGW+ L + L+ ++ RIRVFY
Sbjct: 61  RSFVNKELKKHLKNDEYNSLKVKRFLSLISYINLDIEHNYGWKELKEKLEGNQKRIRVFY 120

Query: 121 LAMSSAFFGKISQRIHANNLVTEHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRID 180
           LA+SS FFGKIS +I+ N LVTEHTR+V+EKPIG++L SAQ+IHAIT KIFKE QIFRID
Sbjct: 121 LAVSSIFFGKISLKIYENQLVTEHTRIVIEKPIGNDLISAQKIHAITSKIFKEHQIFRID 180

Query: 181 HYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMI 240
           HYLGKE VQGLMVFRFANTFYE LWNNKYID++QITTAETIG+E+RVDYYN TGALRDMI
Sbjct: 181 HYLGKETVQGLMVFRFANTFYECLWNNKYIDNIQITTAETIGIENRVDYYNKTGALRDMI 240

Query: 241 QNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGI 300
           QNHLLQLLCLVAMEMP S+E+ +I+NEKIKVL+AL+MI+ ++VQ+LTVRGQYQSGIINGI
Sbjct: 241 QNHLLQLLCLVAMEMPISIESTAIQNEKIKVLKALKMISIDDVQQLTVRGQYQSGIINGI 300

Query: 301 PVKGYLEEIPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPC 360
           P+KGYLE++PLG+SDTETFVAIKA+IDN RW G+PFYLRTGK LAKH+SEIVI+ KPAPC
Sbjct: 301 PIKGYLEKVPLGVSDTETFVAIKASIDNLRWYGVPFYLRTGKCLAKHVSEIVISFKPAPC 360

Query: 361 TIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRTPD 420
            IF  Q+S +  NKLIL LQNNG+IEQFI TKDHSTS +KLK  AL ICC  +   R PD
Sbjct: 361 PIFAPQLSNVGANKLILHLQNNGKIEQFIITKDHSTSGIKLKKNALGICCSEEIKMRNPD 420

Query: 421 GYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVL 480
           GYERL+ D+I+ANQTLFMGYDEVEE+WKWSDSIL+SWQ + QKVD YAAGTWGP +S  L
Sbjct: 421 GYERLITDVINANQTLFMGYDEVEESWKWSDSILQSWQTVGQKVDGYAAGTWGPTKSHTL 480

Query: 481 LQKDGRRWHNN 491
           LQKDGR+WH N
Sbjct: 481 LQKDGRKWHEN 491


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084912|ref|YP_002543441.1| glucose-6-phosphate 1-dehydrogenase [Agrobacterium radiobacter K84] Length = 491 Back     alignment and organism information
>gi|116250525|ref|YP_766363.1| glucose-6-phosphate 1-dehydrogenase [Rhizobium leguminosarum bv. viciae 3841] Length = 491 Back     alignment and organism information
>gi|241203149|ref|YP_002974245.1| glucose-6-phosphate 1-dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 491 Back     alignment and organism information
>gi|325291988|ref|YP_004277852.1| Glucose-6-phosphate 1-dehydrogenase [Agrobacterium sp. H13-3] Length = 502 Back     alignment and organism information
>gi|159184383|ref|NP_353626.2| glucose-6-phosphate 1-dehydrogenase [Agrobacterium tumefaciens str. C58] Length = 491 Back     alignment and organism information
>gi|209547971|ref|YP_002279888.1| glucose-6-phosphate 1-dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 491 Back     alignment and organism information
>gi|86356355|ref|YP_468247.1| glucose-6-phosphate 1-dehydrogenase [Rhizobium etli CFN 42] Length = 491 Back     alignment and organism information
>gi|150395527|ref|YP_001325994.1| glucose-6-phosphate 1-dehydrogenase [Sinorhizobium medicae WSM419] Length = 491 Back     alignment and organism information
>gi|190890410|ref|YP_001976952.1| glucose-6-phosphate 1-dehydrogenase [Rhizobium etli CIAT 652] Length = 491 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target492 glucose-6-phosphate 1-dehydrogenase [Candidatus Liberib
PRK05722495 PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase 0.0
PRK12853482 PRK12853, PRK12853, glucose-6-phosphate 1-dehydrogenase 1e-162
TIGR00871482 TIGR00871, zwf, glucose-6-phosphate 1-dehydrogenase 1e-139
PRK12854484 PRK12854, PRK12854, glucose-6-phosphate 1-dehydrogenase 1e-111
KOG0563499 KOG0563, KOG0563, KOG0563, Glucose-6-phosphate 1-dehydr 2e-98
PTZ00309542 PTZ00309, PTZ00309, glucose-6-phosphate 1-dehydrogenase 3e-92
PLN02539491 PLN02539, PLN02539, glucose-6-phosphate 1-dehydrogenase 5e-85
PLN02333604 PLN02333, PLN02333, glucose-6-phosphate 1-dehydrogenase 2e-74
PLN02640573 PLN02640, PLN02640, glucose-6-phosphate 1-dehydrogenase 8e-70
COG0364483 COG0364, Zwf, Glucose-6-phosphate 1-dehydrogenase [Carb 1e-158
pfam02781294 pfam02781, G6PD_C, Glucose-6-phosphate dehydrogenase, C 2e-83
pfam00479183 pfam00479, G6PD_N, Glucose-6-phosphate dehydrogenase, N 6e-51
>gnl|CDD|180222 PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183793 PRK12853, PRK12853, glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162079 TIGR00871, zwf, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>gnl|CDD|183794 PRK12854, PRK12854, glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|35783 KOG0563, KOG0563, KOG0563, Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|185548 PTZ00309, PTZ00309, glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178154 PLN02539, PLN02539, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>gnl|CDD|177967 PLN02333, PLN02333, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>gnl|CDD|178246 PLN02640, PLN02640, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>gnl|CDD|30713 COG0364, Zwf, Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|145765 pfam02781, G6PD_C, Glucose-6-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|144172 pfam00479, G6PD_N, Glucose-6-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 492 glucose-6-phosphate 1-dehydrogenase [Candidatus Liberib
TIGR00871498 zwf glucose-6-phosphate 1-dehydrogenase; InterPro: IPR0 100.0
COG0364483 Zwf Glucose-6-phosphate 1-dehydrogenase [Carbohydrate t 100.0
PRK05722495 glucose-6-phosphate 1-dehydrogenase; Validated 100.0
PRK12853486 glucose-6-phosphate 1-dehydrogenase; Provisional 100.0
PTZ00309556 glucose-6-phosphate dehydrogenase; Provisional 100.0
PRK12854475 glucose-6-phosphate 1-dehydrogenase; Provisional 100.0
KOG0563499 consensus 100.0
pfam02781294 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal do 100.0
pfam00479183 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding d 100.0
PRK11579346 putative oxidoreductase; Provisional 94.21
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 96.87
PRK10206345 putative dehydrogenase; Provisional 94.46
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 95.58
>TIGR00871 zwf glucose-6-phosphate 1-dehydrogenase; InterPro: IPR001282 Glucose-6-phosphate dehydrogenase (1 Back     alignment and domain information
>COG0364 Zwf Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05722 glucose-6-phosphate 1-dehydrogenase; Validated Back     alignment and domain information
>PRK12853 glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00309 glucose-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12854 glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>KOG0563 consensus Back     alignment and domain information
>pfam02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>pfam00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>PRK10206 putative dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target492 glucose-6-phosphate 1-dehydrogenase [Candidatus Liberib
2bh9_A489 X-Ray Structure Of A Deletion Variant Of Human Gluc 1e-156
1qki_A514 X-Ray Structure Of Human Glucose 6-Phosphate Dehydr 1e-156
1h93_A485 Active Mutant (S215->c) Of Glucose 6-Phosphate Dehy 1e-124
1e77_A485 Complex Of Active Mutant (Q365->c) Of Glucose 6-Pho 1e-124
1dpg_A485 Glucose 6-Phosphate Dehydrogenase From Leuconostoc 1e-123
1e7m_A485 Active Site Mutant (D177->n) Of Glucose 6-Phosphate 1e-123
2dpg_A485 Complex Of Inactive Mutant (H240->n) Of Glucose 6-P 1e-122
>gi|66361514|pdb|2BH9|A Chain A, X-Ray Structure Of A Deletion Variant Of Human Glucose 6- Phosphate Dehydrogenase Complexed With Structural And Coenzyme Nadp Length = 489 Back     alignment and structure
 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 153/487 (31%), Positives = 253/487 (51%), Gaps = 20/487 (4%)

Query: 9   HNSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESYRSFVDKEL 68
               FII G +GDLAK+K++P ++  + +    + +  I+G  R ++TV      + K+ 
Sbjct: 4   DTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTF-IVGYARSRLTVAD----IRKQS 58

Query: 69  QRYLKDGEYNPLKVQKFLSLIFYINLDVEKNYGWELLGKL---LDIDKTRIRVFYLAMSS 125
           + + K      LK++ F +   Y+    +    ++ L      L +     R+FYLA+  
Sbjct: 59  EPFFKATPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYLALPP 118

Query: 126 AFFGKISQRIHANNLVT-EHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDHYLG 184
             +  +++ IH + +      R+++EKP G +L S+  +      +F+E QI+RIDHYLG
Sbjct: 119 TVYEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRIDHYLG 178

Query: 185 KEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHL 244
           KE VQ LMV RFAN  +  +WN   I  V +T  E  G E R  Y++  G +RD++QNHL
Sbjct: 179 KEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHL 238

Query: 245 LQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIIN-GIPVK 303
           LQ+LCLVAME P S  +  +++EK+KVL+ +     E      V GQY       G   K
Sbjct: 239 LQMLCLVAMEKPASTNSDDVRDEKVKVLKCIS----EVQANNVVLGQYVGNPDGEGEATK 294

Query: 304 GYLEEIPLGI-SDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCTI 362
           GYL++  +   S T TF A+   ++N RW G+PF LR GK L +  +E+ +        I
Sbjct: 295 GYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDVAGDI 354

Query: 363 FDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIK-RTPDG 421
           F  Q  +   N+L++R+Q N  +   + TK         + + L +   ++    + PD 
Sbjct: 355 FHQQCKR---NELVIRVQPNEAVYTKMMTKKPGMF-FNPEESELDLTYGNRYKNVKLPDA 410

Query: 422 YERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLL 481
           YERL++D+   +Q  F+  DE+ E W+    +L   ++   K   Y  G+ GP ++D L+
Sbjct: 411 YERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELM 470

Query: 482 QKDGRRW 488
           ++ G ++
Sbjct: 471 KRVGFQY 477


>gi|7546523|pdb|1QKI|A Chain A, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase (Variant Canton R459l) Complexed With Structural Nadp+ Length = 514 Back     alignment and structure
>gi|14278141|pdb|1H93|A Chain A, Active Mutant (S215->c) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides Length = 485 Back     alignment and structure
>gi|12084544|pdb|1E77|A Chain A, Complex Of Active Mutant (Q365->c) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides With Substrate Length = 485 Back     alignment and structure
>gi|1421566|pdb|1DPG|A Chain A, Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides Length = 485 Back     alignment and structure
>gi|12084545|pdb|1E7M|A Chain A, Active Site Mutant (D177->n) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides Length = 485 Back     alignment and structure
>gi|157834793|pdb|2DPG|A Chain A, Complex Of Inactive Mutant (H240->n) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides With Nadp+ Length = 485 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target492 glucose-6-phosphate 1-dehydrogenase [Candidatus Liberib
1dpg_A485 G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase 1e-158
2bh9_A489 G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreducta 1e-132
>1dpg_A G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase, NADP/NAD, glucose metabolism, oxidoreductase (CHOH(D) - NAD(P)); 2.00A {Leuconostoc mesenteroides} SCOP: c.2.1.3 d.81.1.5 PDB: 1e7y_A* 1e7m_A* 1h93_A 1h94_A* 1h9a_A* 1e77_A* 1h9b_A 2dpg_A* Length = 485 Back     alignment and structure
 Score =  553 bits (1427), Expect = e-158
 Identities = 155/489 (31%), Positives = 253/489 (51%), Gaps = 24/489 (4%)

Query: 13  FIIFGGTGDLAKRKLFPALYNNYTNREENQISS--RIIGICRIKMTVESYRSFVDKELQR 70
              FGGTGDLAKRKL+P+++N Y   ++  +     I+G  R  +  + ++  V   ++ 
Sbjct: 8   VTFFGGTGDLAKRKLYPSVFNLY---KKGYLQKHFAIVGTARQALNDDEFKQLVRDCIKD 64

Query: 71  YLKDGEYNPLKVQKFLSLIFYINLDVEKNYGWELLGKLLD-----IDKTRIRVFYLAMSS 125
           +  D      + + F+    Y   DV     + +L + ++      D    R+FY++++ 
Sbjct: 65  FTDDQA----QAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAP 120

Query: 126 AFFGKISQRIHANNLVTE--HTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDHYL 183
            FFG I++ + +  L+ +  + R+++EKP G++  +A E+       F ++Q+FRIDHYL
Sbjct: 121 RFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYL 180

Query: 184 GKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNH 243
           GKE VQ +   RF N  +++ WN  YI +VQ+T +E +GVE+R  YY+  GAL DMIQNH
Sbjct: 181 GKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNH 240

Query: 244 LLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIINGIPVK 303
            +Q++  +AME P S   K I+  K     AL++     V K  VR QY +G  +    K
Sbjct: 241 TMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAG--DSADFK 298

Query: 304 GYLEE--IPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCT 361
            YLEE  +P   S   TF+A +   D PRW G+PFY+R+GK LA   + + I  K     
Sbjct: 299 PYLEELDVPAD-SKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFN 357

Query: 362 IFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRTPDG 421
               Q  + +   L + +   G IE  +  K    +    +T  L      +  K TP+ 
Sbjct: 358 FGSEQ--EAQEAVLSIIIDPKGAIELKLNAKSVEDA-FNTRTIDLGWTVSDEDKKNTPEP 414

Query: 422 YERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLL 481
           YER++ D ++ + + F  ++ V   WK+ D+I   +      ++ Y +G+ GP+ SD LL
Sbjct: 415 YERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLL 474

Query: 482 QKDGRRWHN 490
             +G  W  
Sbjct: 475 AANGDAWVF 483


>2bh9_A G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreductase, oxidoreductase (CHOH(D)-NADP), carbohydrate metabolism, glucose metabolism; HET: NAP; 2.5A {Homo sapiens} PDB: 2bhl_A* 1qki_A* Length = 489 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target492 glucose-6-phosphate 1-dehydrogenase [Candidatus Liberib
2bh9_A489 G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreducta 100.0
1dpg_A485 G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase 100.0
3btv_A438 Galactose/lactose metabolism regulatory protein GAL80; 98.03
2nvw_A479 Galactose/lactose metabolism regulatory protein GAL80; 97.44
2o4u_X334 Dimeric dihydrodiol dehydrogenase; NADP-binding rossman 97.42
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreducta 97.4
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreductase 97.17
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO- 97.11
3db2_A354 Putative NADPH-dependent oxidoreductase; ZP_01370612.1, 97.06
1tlt_A319 Putative oxidoreductase (virulence factor MVIM homolog) 97.05
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, MCSG 96.96
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, PSI- 96.93
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI- 96.73
1ydw_A362 AX110P-like protein; structural genomics, protein struc 96.62
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; reductive methylat 96.57
3kux_A352 Putative oxidoreductase; oxidoreductase family, csgid, 96.39
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural genomic 96.35
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxidoreduc 95.72
3euw_A344 MYO-inositol dehydrogenase; protein structure initiativ 95.58
3ezy_A344 Dehydrogenase; structural genomics, unknown function, P 93.88
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural genomi 97.36
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, 94.1
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrrole, b 91.75
1zh8_A340 Oxidoreductase; TM0312, structural genomics, joint cent 97.27
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI- 97.2
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 97.09
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 96.86
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 96.63
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, structural 97.25
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural genomics 95.23
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependent red 94.42
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, P 96.27
3ec7_A357 Putative dehydrogenase; alpha-beta, structural genomics 95.99
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI-2, p 95.18
3oqb_A383 Oxidoreductase; structural genomics, protein structure 93.93
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase 92.54
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; prot 95.69
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, HAEM d 91.14
>2bh9_A G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreductase, oxidoreductase (CHOH(D)-NADP), carbohydrate metabolism, glucose metabolism; HET: NAP; 2.5A {Homo sapiens} PDB: 2bhl_A* 1qki_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=1310.64  Aligned_cols=471  Identities=32%  Similarity=0.594  Sum_probs=446.2

Q ss_pred             CCCCCEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
Q ss_conf             98987899864435667657799999997289875781799998886998899999999998742346799899998985
Q gi|254780504|r    8 IHNSDFIIFGGTGDLAKRKLFPALYNNYTNREENQISSRIIGICRIKMTVESYRSFVDKELQRYLKDGEYNPLKVQKFLS   87 (492)
Q Consensus         8 ~~~~~lVIFGATGDLA~RKL~PALf~L~~~~~l~~~~~~IiG~aR~~~~~e~fr~~v~~~l~~~~~~~~~~~~~~~~F~~   87 (492)
                      .+|++|||||||||||+||||||||+|+++|++|+ +++|||+||+++++++|++.+++.++.    ...++..|++|++
T Consensus         3 ~d~~i~VIFGaTGDLA~RKL~PAL~~L~~~g~Lp~-~~~IiG~aR~~~~~e~fr~~~~~~~~~----~~~~~~~~~~F~~   77 (489)
T 2bh9_A            3 SDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPE-NTFIVGYARSRLTVADIRKQSEPFFKA----TPEEKLKLEDFFA   77 (489)
T ss_dssp             CCCEEEEEETTTSHHHHHTHHHHHHHHHHTTCSCS-SEEEEEEESSCCCHHHHHHHHGGGSCC----CGGGHHHHHHHHH
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCC-CCEEEEEECCCCCHHHHHHHHHHHHHC----CCCCHHHHHHHHH
T ss_conf             89957999734118876079999999998099999-978999989979989999999998502----8644899999981


Q ss_pred             HCCEEECCCCCHHHHHHHHHHHCC---CCCCCEEEEECCCHHHHHHHHHHHHHHCCC-CCCCEEEEECCCCCCHHHHHHH
Q ss_conf             165786467897789988887405---767846998406956866677777772587-6443577605667898899999
Q gi|254780504|r   88 LIFYINLDVEKNYGWELLGKLLDI---DKTRIRVFYLAMSSAFFGKISQRIHANNLV-TEHTRVVLEKPIGSNLSSAQEI  163 (492)
Q Consensus        88 ~~~Y~~~d~~~~~~y~~L~~~l~~---~~~~~rifYLAiPP~~f~~i~~~L~~~~l~-~~~~RiViEKPFG~Dl~SA~eL  163 (492)
                      +++|+++|++++++|..|++.++.   ....+|||||||||++|+.||++|+++||+ .+|+|||||||||+||+||++|
T Consensus        78 ~~~Y~~~d~~~~~~y~~L~~~l~~~~~~~~~~rifYLAvPP~~f~~i~~~L~~~~l~~~~~~RvVvEKPFG~Dl~SA~~l  157 (489)
T 2bh9_A           78 RNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYLALPPTVYEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRL  157 (489)
T ss_dssp             TEEEEECCSSCHHHHHHHHHHHHTTTTTTTSEEEEEECSCTTSHHHHHHHHHHHSCCSSSCEEEEECSCSCSSHHHHHHH
T ss_pred             HCCEECCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH
T ss_conf             18898168898789999999999874288875389994598999999999998467756771488845877866889999


Q ss_pred             HHHHHHHCCHHHEEECCCHHHHHHHHHHHHHHHCCCCCHHHHCCCCEEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99998738968835124201256877778877477520025280333079999984677024555532200178876558
Q gi|254780504|r  164 HAITRKIFKESQIFRIDHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNH  243 (492)
Q Consensus       164 n~~l~~~f~E~qiyRIDHYLGKe~vqnil~lRFaN~~~e~~WNr~~I~~VqIt~~E~~gvegR~~yyD~~GaiRDmvQNH  243 (492)
                      |+.|+++|+|+||||||||||||||||||+|||+|++|||+|||+||++||||++|++|||||++|||++||||||||||
T Consensus       158 n~~l~~~f~E~qIyRIDHYLGKe~Vqnil~lRfaN~~~e~lWN~~~I~~VqI~~~E~~gvegR~~yYD~~GaiRDmvQNH  237 (489)
T 2bh9_A          158 SNHISSLFREDQIYRIDHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNH  237 (489)
T ss_dssp             HHHHTTTSCGGGEEECCGGGGCHHHHHHHHHHHSCGGGSTTCSTTTEEEEEEEEECSCCCTTCHHHHTTTHHHHHTTTTH
T ss_pred             HHHHHHHCCCHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCEEEEEEECCCCCCCHHHHHHCCHHHHHHHHHH
T ss_conf             99999756913320002566599999999999716424334340355368999617887664221322013578877728


Q ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHCCCCEEEECCCCCCC-CCEECCCCCCCCCCCC-CCCCCEEE
Q ss_conf             999999987185445885899999999997306888112236136521366776-8734334101479886-64874389
Q gi|254780504|r  244 LLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGII-NGIPVKGYLEEIPLGI-SDTETFVA  321 (492)
Q Consensus       244 llQlL~lvAMe~P~~~~~~~ir~eK~kvlk~~r~~~~~~v~~~~v~GQY~~~~~-~~~~v~gY~~e~~v~~-S~TeTfaa  321 (492)
                      |||||||||||||.++++++||+||+|||||+||++++++    |+|||.++.. .|+.++||++|+||++ |+||||||
T Consensus       238 LlQlL~lvaME~P~~~~~~~ir~eK~kvL~al~~i~~~~v----v~gqy~~~~~~~~~~~~gY~~e~gV~~~S~TeTfaa  313 (489)
T 2bh9_A          238 LLQMLCLVAMEKPASTNSDDVRDEKVKVLKCISEVQANNV----VLGQYVGNPDGEGEATKGYLDDPTVPRGSTTATFAA  313 (489)
T ss_dssp             HHHHHHHHHCCCCSSSSHHHHHHHHHHHHTTBCCCCGGGE----EEEEEECCTTSCSTTSSCGGGCTTSCTTCCCCSEEE
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCC----CCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             9999999985688999989999999999971676875443----135274254125740366234679877788630036


Q ss_pred             EEEEECCCCCCCCEEEEEECCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEEEECCCCCCCCEE
Q ss_conf             99997085867857775513346885179999985488643766654789856999971796504443312688877445
Q gi|254780504|r  322 IKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKL  401 (492)
Q Consensus       322 ~~l~idn~RW~gVPF~lrtGK~l~~k~~eI~i~FK~~p~~~f~~~~~~~~~N~Lvi~iqP~~~i~l~~~~K~pg~~~~~~  401 (492)
                      ++++||||||+||||||||||+|++|+|||+|+||++|+.+|...   +.+|+|||+|||+++|.+++++|.||. .+.+
T Consensus       314 ~~l~Idn~RW~GVPF~lrtGK~L~~~~teI~i~Fk~~~~~~f~~~---~~~n~lv~~iqP~e~i~l~~~~k~pg~-~~~~  389 (489)
T 2bh9_A          314 VVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDVAGDIFHQQ---CKRNELVIRVQPNEAVYTKMMTKKPGM-FFNP  389 (489)
T ss_dssp             EEEEBCSTTTTTCEEEEEEESSCSSCEEEEEEEECCCSSCCSTTC---CCCCEEEEEEESSCEEEEEEEEECTTT-CCSE
T ss_pred             EEEEECCCCCCCCCEEEECCCCCCCCEEEEEEEECCCCCCCCCCC---CCCCEEEEEECCCCCCCEEEECCCCCC-CCCE
T ss_conf             789862773079758997367756554799999757885301357---788869998469753412110238988-8732


Q ss_pred             EEEEEEEEECCCCC-CCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             46666553022345-68986248999999879833586989999845884699998873489874579889971889999
Q gi|254780504|r  402 KTTALRICCCSKRI-KRTPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVL  480 (492)
Q Consensus       402 ~~~~l~~~~~~~~~-~~~pdaYe~Ll~D~i~Gd~tlF~r~dEve~sWrivdpiL~~~~~~~~~~~~Y~~GS~GP~~a~~l  480 (492)
                      .++.|++++.+.+. ...|||||+||+|||+||||+|+|+||||+||+||||||+.|+.++++|.+|++|||||++|++|
T Consensus       390 ~~~~l~~~~~~~~~~~~~~daYe~Ll~d~~~Gd~tlF~~~deve~sW~i~dpil~~~~~~~~~~~~Y~~Gs~GP~~a~~l  469 (489)
T 2bh9_A          390 EESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADEL  469 (489)
T ss_dssp             EEEEEEEETTTSSSSSCCCCHHHHHHHHHHHTCCTTSCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEETTSSSCHHHHHH
T ss_pred             EEEEECCCHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHH
T ss_conf             56650361420258998887199999999779965689989999999999999999975799887889999799999999


Q ss_pred             HHHCCCCCCCC
Q ss_conf             99818844778
Q gi|254780504|r  481 LQKDGRRWHNN  491 (492)
Q Consensus       481 ~~~~g~~W~~~  491 (492)
                      ++|+|++|+++
T Consensus       470 l~~~g~~w~~~  480 (489)
T 2bh9_A          470 MKRVGFQYEGT  480 (489)
T ss_dssp             HHHHTCCCCSC
T ss_pred             HHHHCCCCCCC
T ss_conf             99509896899



>1dpg_A G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase, NADP/NAD, glucose metabolism, oxidoreductase (CHOH(D) - NAD(P)); 2.00A {Leuconostoc mesenteroides} SCOP: c.2.1.3 d.81.1.5 PDB: 1e7y_A* 1e7m_A* 1h93_A 1h94_A* 1h9a_A* 1e77_A* 1h9b_A 2dpg_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3btu_A Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>2o4u_X Dimeric dihydrodiol dehydrogenase; NADP-binding rossmann-fold domain, predominantly anti- parallel beta sheet, oxidoreductase; 2.00A {Macaca fascicularis} PDB: 2o48_X 2poq_X* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase family, NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase family, NAD-binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum ms-1} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; ZP_01370612.1, structural genomics, joint center for structural genomics, JCSG; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM homolog); structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2ho3_A Oxidoreductase, GFO/IDH/MOCA family; reductive methylation, structural genomics, PSI 2, protein structure initiative; HET: MLY; 2.00A {Streptococcus pneumoniae} PDB: 2ho5_A Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center for structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MSE NAP; 2.50A {Thermotoga maritima MSB8} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genomics, protein structure initiative, PSI; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium LT2} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 492 glucose-6-phosphate 1-dehydrogenase [Candidatus Liberib
d1qkia2297 d.81.1.5 (A:200-434,A:450-511) Glucose 6-phosphate dehy 4e-88
d1h9aa2290 d.81.1.5 (A:182-412,A:427-485) Glucose 6-phosphate dehy 1e-84
d1qkia1203 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate dehydr 1e-39
d1h9aa1195 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydro 2e-39
>d1qkia2 d.81.1.5 (A:200-434,A:450-511) Glucose 6-phosphate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: Glucose 6-phosphate dehydrogenase-like
domain: Glucose 6-phosphate dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  319 bits (818), Expect = 4e-88
 Identities = 100/313 (31%), Positives = 156/313 (49%), Gaps = 22/313 (7%)

Query: 180 DHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDM 239
           DHYLGKE VQ LMV RFAN  +  +WN   I  V +T  E  G E R  Y++  G +RD+
Sbjct: 1   DHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDV 60

Query: 240 IQNHLLQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGIING 299
           +QNHLLQ+LCLVAME P S  +  +++EK+KVL+ +  +   NV      G        G
Sbjct: 61  MQNHLLQMLCLVAMEKPASTNSDDVRDEKVKVLKCISEVQANNVVLGQYVGN---PDGEG 117

Query: 300 IPVKGYLEEIPLGI-SDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPA 358
              KGYL++  +   S T TF A+   ++N RW G+PF LR GK L +  +E+ +     
Sbjct: 118 EATKGYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDV 177

Query: 359 PCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKRT 418
              IF  Q    + N+L++R+Q N  +   + TK         + + L +          
Sbjct: 178 AGDIFHQQ---CKRNELVIRVQPNEAVYTKMMTKKPGMF-FNPEESELDLTY-------- 225

Query: 419 PDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSD 478
            + Y+ + +         F+  DE+ E W+    +L   ++   K   Y  G+ GP ++D
Sbjct: 226 GNRYKNVKLP------MHFVRSDELLEAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEAD 279

Query: 479 VLLQKDGRRWHNN 491
            L+++ G ++   
Sbjct: 280 ELMKRVGFQYEGT 292


>d1h9aa2 d.81.1.5 (A:182-412,A:427-485) Glucose 6-phosphate dehydrogenase {Leuconostoc mesenteroides [TaxId: 1245]} Length = 290 Back     information, alignment and structure
>d1qkia1 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Back     information, alignment and structure
>d1h9aa1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]} Length = 195 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target492 glucose-6-phosphate 1-dehydrogenase [Candidatus Liberib
d1qkia2297 Glucose 6-phosphate dehydrogenase {Human (Homo sapiens) 100.0
d1h9aa2290 Glucose 6-phosphate dehydrogenase {Leuconostoc mesenter 100.0
d1h9aa1195 Glucose 6-phosphate dehydrogenase, N-terminal domain {L 100.0
d1qkia1203 Glucose 6-phosphate dehydrogenase, N-terminal domain {H 100.0
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 562]} 96.69
d2nvwa1237 Galactose/lactose metabolism regulatory protein GAL80 { 97.28
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [TaxId 97.14
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain {Zym 97.0
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId 96.86
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Arabido 95.81
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 1 93.43
>d1qkia2 d.81.1.5 (A:200-434,A:450-511) Glucose 6-phosphate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: Glucose 6-phosphate dehydrogenase-like
domain: Glucose 6-phosphate dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=858.67  Aligned_cols=290  Identities=36%  Similarity=0.628  Sum_probs=276.0

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCHHHHCCCCEEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             42012568777788774775200252803330799999846770245555322001788765589999999871854458
Q gi|254780504|r  180 DHYLGKEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSV  259 (492)
Q Consensus       180 DHYLGKe~vqnil~lRFaN~~~e~~WNr~~I~~VqIt~~E~~gvegR~~yyD~~GaiRDmvQNHllQlL~lvAMe~P~~~  259 (492)
                      |||||||||||||+|||||++|||+|||+||++||||++|++||||||+|||++|||||||||||||||||+|||||.++
T Consensus         1 DHYLGKe~Vqnil~lRfaN~~fe~lWN~~~I~~VqIt~~E~~gve~R~~yYd~~GalRDmvQNHllQll~lvaME~P~~~   80 (297)
T d1qkia2           1 DHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPAST   80 (297)
T ss_dssp             CGGGGSHHHHHHHHHHHSCSTTTTTSSTTTEEEEEEEEECSSCCCSCHHHHTTTHHHHHTTTTHHHHHHHHHHCCCCSSS
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             97546899999999997345535454634513799997067674721323304464998888899999999986796647


Q ss_pred             CHHHHHHHHHHHHHHHCCCCHHHCCCCEEEECCCCCC-CCCEECCCCCCCCCCCC-CCCCCEEEEEEEECCCCCCCCEEE
Q ss_conf             8589999999999730688811223613652136677-68734334101479886-648743899999708586785777
Q gi|254780504|r  260 EAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSGI-INGIPVKGYLEEIPLGI-SDTETFVAIKANIDNPRWSGIPFY  337 (492)
Q Consensus       260 ~~~~ir~eK~kvlk~~r~~~~~~v~~~~v~GQY~~~~-~~~~~v~gY~~e~~v~~-S~TeTfaa~~l~idn~RW~gVPF~  337 (492)
                      ++++||+||+|||+|+|+++++++    ++|||.++. ..|+.++||++|+||++ |+||||||+|++||||||+|||||
T Consensus        81 ~~~~ir~eK~kvL~alr~~~~~~v----~~gqy~~~~~~~g~~~~gY~~e~gV~~~S~TeTfaa~kl~Idn~RW~GVPFy  156 (297)
T d1qkia2          81 NSDDVRDEKVKVLKCISEVQANNV----VLGQYVGNPDGEGEATKGYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFI  156 (297)
T ss_dssp             CHHHHHHHHHHHHTTBCCCCGGGE----EEEEEECCTTSCGGGGCCSTTCTTSCTTCCCCSEEEEEEEBCSTTTTTCEEE
T ss_pred             CHHHHHHHHHHHHHHCCCCCHHHH----HHCEEECCCCCCCCCCCCHHCCCCCCCCCCCCCEEEEEEEEECCCCCCCEEE
T ss_conf             879999999999962575874341----0104532542358645550015678767776622799999817654786788


Q ss_pred             EEECCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEEEECCCCCCCCEEEEEEEEEEECCCCCCC
Q ss_conf             55133468851799999854886437666547898569999717965044433126888774454666655302234568
Q gi|254780504|r  338 LRTGKYLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRIKR  417 (492)
Q Consensus       338 lrtGK~l~~k~~eI~i~FK~~p~~~f~~~~~~~~~N~Lvi~iqP~~~i~l~~~~K~pg~~~~~~~~~~l~~~~~~~~~~~  417 (492)
                      |||||+|++|.|||+|+||++|+.+|...   +.+|+|||+|||+++|.+++++|.||. .+.+.++.|+++|.      
T Consensus       157 lRTGKrL~~k~teI~I~FK~~p~~~f~~~---~~~N~Lvi~iqP~egi~l~~~~K~PG~-~~~~~~~~l~~~~~------  226 (297)
T d1qkia2         157 LRCGKALNERKAEVRLQFHDVAGDIFHQQ---CKRNELVIRVQPNEAVYTKMMTKKPGM-FFNPEESELDLTYG------  226 (297)
T ss_dssp             EEEESSCSCCEEEEEEEECCCSSCSSTTC---CCCCEEEEEEESSCEEEEEEEEECSSS-CCSEEEEEEEEEHH------
T ss_pred             EEECCCCCCCEEEEEEEECCCCCCCCCCC---CCCCEEEEEECCCHHHHHHHHCCCCCC-CCCEEEEECCCCHH------
T ss_conf             76245356764899998426876433446---788856985358424544554067877-75147875032133------


Q ss_pred             CCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             98624899999987983358698999984588469999887348987457988997188999999818844778
Q gi|254780504|r  418 TPDGYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLLQKDGRRWHNN  491 (492)
Q Consensus       418 ~pdaYe~Ll~D~i~Gd~tlF~r~dEve~sWrivdpiL~~~~~~~~~~~~Y~~GS~GP~~a~~l~~~~g~~W~~~  491 (492)
                        +|||+|++|      ++|+|+||||+||+||||||++|+.++++|.+|++|||||++|++|++++|++|+++
T Consensus       227 --~aye~l~~~------~~F~r~DEve~sW~ivdpil~~w~~~~~~~~~Y~~GS~GP~~a~~Ll~~~G~~W~~~  292 (297)
T d1qkia2         227 --NRYKNVKLP------MHFVRSDELLEAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGT  292 (297)
T ss_dssp             --HHTCSCCCC------GGSBCHHHHHHHHHHHHHHHHHHHHHCCCCEEEETTSCCCHHHHHHHHHTTCCCCSC
T ss_pred             --HHHCCCCCC------CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCC
T ss_conf             --331134786------233686999999998589999998579988787989979899999999639884899



>d1h9aa2 d.81.1.5 (A:182-412,A:427-485) Glucose 6-phosphate dehydrogenase {Leuconostoc mesenteroides [TaxId: 1245]} Back     information, alignment and structure
>d1h9aa1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]} Back     information, alignment and structure
>d1qkia1 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 492 glucose-6-phosphate 1-dehydrogenase [Candidatus Li
2bh9_A_179-489311 (A:179-489) G6PD, glucose-6-phosphate 1-dehydrogen 2e-94
1dpg_A_205-485281 (A:205-485) G6PD, glucose 6-phosphate dehydrogenas 1e-85
1dpg_A_1-182182 (A:1-182) G6PD, glucose 6-phosphate dehydrogenase; 8e-43
2bh9_A_1-178178 (A:1-178) G6PD, glucose-6-phosphate 1-dehydrogenas 1e-41
>2bh9_A (A:179-489) G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreductase, oxidoreductase (CHOH(D)-NADP), carbohydrate metabolism, glucose metabolism; HET: NAP; 2.5A {Homo sapiens} PDB: 2bhl_A* 1qki_A*Length = 311 Back     alignment and structure
 Score =  340 bits (874), Expect = 2e-94
 Identities = 107/311 (34%), Positives = 165/311 (53%), Gaps = 13/311 (4%)

Query: 185 KEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHL 244
           KE VQ LMV RFAN  +  +WN   I  V +T  E  G E R  Y++  G +RD++QNHL
Sbjct: 1   KEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHL 60

Query: 245 LQLLCLVAMEMPPSVEAKSIKNEKIKVLQALQMITPENVQKLTVRGQYQSG-IINGIPVK 303
           LQ+LCLVAME P S  +  +++EK+KVL+ +  +   NV    V GQY       G   K
Sbjct: 61  LQMLCLVAMEKPASTNSDDVRDEKVKVLKCISEVQANNV----VLGQYVGNPDGEGEATK 116

Query: 304 GYLEE--IPLGISDTETFVAIKANIDNPRWSGIPFYLRTGKYLAKHISEIVIALKPAPCT 361
           GYL++  +P G S T TF A+   ++N RW G+PF LR GK L +  +E+ +        
Sbjct: 117 GYLDDPTVPRG-STTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDVAGD 175

Query: 362 IFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRIC-CCSKRIKRTPD 420
           IF  Q    + N+L++R+Q N  +   + TK         + + L +      +  + PD
Sbjct: 176 IFHQQC---KRNELVIRVQPNEAVYTKMMTKK-PGMFFNPEESELDLTYGNRYKNVKLPD 231

Query: 421 GYERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVL 480
            YERL++D+   +Q  F+  DE+ E W+    +L   ++   K   Y  G+ GP ++D L
Sbjct: 232 AYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADEL 291

Query: 481 LQKDGRRWHNN 491
           +++ G ++   
Sbjct: 292 MKRVGFQYEGT 302


>1dpg_A (A:205-485) G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase, NADP/NAD, glucose metabolism, oxidoreductase (CHOH(D) - NAD(P)); 2.00A {Leuconostoc mesenteroides}Length = 281 Back     alignment and structure
>1dpg_A (A:1-182) G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase, NADP/NAD, glucose metabolism, oxidoreductase (CHOH(D) - NAD(P)); 2.00A {Leuconostoc mesenteroides}Length = 182 Back     alignment and structure
>2bh9_A (A:1-178) G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreductase, oxidoreductase (CHOH(D)-NADP), carbohydrate metabolism, glucose metabolism; HET: NAP; 2.5A {Homo sapiens} PDB: 2bhl_A* 1qki_A*Length = 178 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target492 glucose-6-phosphate 1-dehydrogenase [Candidatus Liberib
2bh9_A_179-489311 G6PD, glucose-6-phosphate 1-dehydrogenase; oxidore 100.0
1dpg_A_205-485281 G6PD, glucose 6-phosphate dehydrogenase; oxidoredu 100.0
1dpg_A_1-182182 G6PD, glucose 6-phosphate dehydrogenase; oxidoredu 100.0
2bh9_A_1-178178 G6PD, glucose-6-phosphate 1-dehydrogenase; oxidore 100.0
3btv_A_1-156_361-438234 Galactose/lactose metabolism regulatory protein GA 97.53
2nvw_A_1-176_396-479260 Galactose/lactose metabolism regulatory protein GA 97.42
1xea_A_1-123_263-323184 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.76
1tlt_A_1-126_262-319184 Putative oxidoreductase (virulence factor MVIM hom 96.44
3i23_A_1-125125 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.37
3e82_A_1-127127 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 96.33
3ec7_A_1-149149 Putative dehydrogenase; alpha-beta, structural gen 96.3
1h6d_A_1-210210 Precursor form of glucose-fructose oxidoreductase; 96.15
1zh8_A_1-143143 Oxidoreductase; TM0312, structural genomics, joint 96.1
2fp4_A_1-130130 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 96.04
3f4l_A_1-125125 Putative oxidoreductase YHHX; structural genomics, 95.72
3kux_A_1-127127 Putative oxidoreductase; oxidoreductase family, cs 95.46
3cea_A_1-132132 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 95.44
3fhl_A_1-126126 Putative oxidoreductase; NAD-binding domain, PSI-2 95.04
3gdo_A_1-126126 Uncharacterized oxidoreductase YVAA; structural ge 94.9
2yv2_A_1-129129 Succinyl-COA synthetase alpha chain; COA-binding d 94.69
2yv1_A_1-128128 Succinyl-COA ligase [ADP-forming] subunit alpha; C 94.31
1oi7_A_1-122122 Succinyl-COA synthetase alpha chain; SCS, ligase, 92.91
2nu8_A_1-122122 Succinyl-COA ligase [ADP-forming] subunit alpha; c 91.89
2o4u_X_1-127_278-334184 Dimeric dihydrodiol dehydrogenase; NADP-binding ro 96.25
3e9m_A_1-127_277-330181 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 95.29
3db2_A_1-127_299-354183 Putative NADPH-dependent oxidoreductase; ZP_013706 95.23
3dty_A_1-146_319-398226 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 94.66
1ydw_A_1-133_305-362191 AX110P-like protein; structural genomics, protein 94.56
3ezy_A_1-125_255-302173 Dehydrogenase; structural genomics, unknown functi 94.34
2p2s_A_1-127127 Putative oxidoreductase; YP_050235.1, structural g 93.71
2glx_A_1-122122 1,5-anhydro-D-fructose reductase; NADP(H) dependen 93.33
3ip3_A_1-129129 Oxidoreductase, putative; structural genomics, PSI 93.3
3e18_A_1-125125 Oxidoreductase; dehydrogenase, NAD-binding, struct 92.94
3evn_A_1-128_277-329181 Oxidoreductase, GFO/IDH/MOCA family; structural ge 92.91
3c1a_A_1-130_276-315170 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 91.79
2ho3_A_1-123123 Oxidoreductase, GFO/IDH/MOCA family; reductive met 90.78
1lc0_A_1-126_244-294177 Biliverdin reductase A; oxidoreductase, tetrapyrro 92.97
>2bh9_A (A:179-489) G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreductase, oxidoreductase (CHOH(D)-NADP), carbohydrate metabolism, glucose metabolism; HET: NAP; 2.5A {Homo sapiens} PDB: 2bhl_A* 1qki_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=854.38  Aligned_cols=299  Identities=35%  Similarity=0.622  Sum_probs=287.6

Q ss_pred             HHHHHHHHHHHHCCCCCHHHHCCCCEEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHH
Q ss_conf             56877778877477520025280333079999984677024555532200178876558999999987185445885899
Q gi|254780504|r  185 KEAVQGLMVFRFANTFYESLWNNKYIDHVQITTAETIGVEDRVDYYNNTGALRDMIQNHLLQLLCLVAMEMPPSVEAKSI  264 (492)
Q Consensus       185 Ke~vqnil~lRFaN~~~e~~WNr~~I~~VqIt~~E~~gvegR~~yyD~~GaiRDmvQNHllQlL~lvAMe~P~~~~~~~i  264 (492)
                      ||||||||+|||||++|||+|||+||++||||++|++||||||+|||++|||||||||||||||||+|||||.++++++|
T Consensus         1 Ke~Vqnll~lRfaN~~~e~iWNr~~I~~VqIt~~E~~gvegR~~yYd~~GaiRDmvQNHllQlLalvAMe~P~~~~~~~i   80 (311)
T 2bh9_A            1 KEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPASTNSDDV   80 (311)
T ss_dssp             CHHHHHHHHHHHSCGGGSTTCSTTTEEEEEEEEECSCCCTTCHHHHTTTHHHHHTTTTHHHHHHHHHHCCCCSSSSHHHH
T ss_pred             HHHHHHHHHHHHCCCCCHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHH
T ss_conf             88999999998614110224420560259999768987462012445428998765788999999998387456997999


Q ss_pred             HHHHHHHHHHHCCCCHHHCCCCEEEECCCCCCC-CCEECCCCCCCCCCCC-CCCCCEEEEEEEECCCCCCCCEEEEEECC
Q ss_conf             999999997306888112236136521366776-8734334101479886-64874389999970858678577755133
Q gi|254780504|r  265 KNEKIKVLQALQMITPENVQKLTVRGQYQSGII-NGIPVKGYLEEIPLGI-SDTETFVAIKANIDNPRWSGIPFYLRTGK  342 (492)
Q Consensus       265 r~eK~kvlk~~r~~~~~~v~~~~v~GQY~~~~~-~~~~v~gY~~e~~v~~-S~TeTfaa~~l~idn~RW~gVPF~lrtGK  342 (492)
                      |+||+|||||+||++++++    |||||++|.. .|++++||++|+||++ |+||||||++++||||||+||||||||||
T Consensus        81 r~eK~kvL~~~~~~~~~~~----v~GQY~~~~~~~~~~~~gY~~e~gv~~dS~TeTfaa~~l~idn~RW~GVPF~lrtGK  156 (311)
T 2bh9_A           81 RDEKVKVLKCISEVQANNV----VLGQYVGNPDGEGEATKGYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFILRCGK  156 (311)
T ss_dssp             HHHHHHHHTTBCCCCGGGE----EEEEEECCTTSCSTTSSCGGGCTTSCTTCCCCSEEEEEEEBCSTTTTTCEEEEEEES
T ss_pred             HHHHHHHHHHCCCCCCCCC----CCCEEECCCCCCCCCCCCHHHCCCCCCCCCCCCEEEEEEEEECCCCCCCEEEEEECC
T ss_conf             9999999972675870011----113462232244655643420467766776540168899980755478678997557


Q ss_pred             CCCCCEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEEEECCCCCCCCEEEEEEEEEEECCCCC-CCCCCH
Q ss_conf             4688517999998548864376665478985699997179650444331268887744546666553022345-689862
Q gi|254780504|r  343 YLAKHISEIVIALKPAPCTIFDHQMSKIETNKLILRLQNNGEIEQFITTKDHSTSNMKLKTTALRICCCSKRI-KRTPDG  421 (492)
Q Consensus       343 ~l~~k~~eI~i~FK~~p~~~f~~~~~~~~~N~Lvi~iqP~~~i~l~~~~K~pg~~~~~~~~~~l~~~~~~~~~-~~~pda  421 (492)
                      +|++|.+||+|+||++|+++|...   +.+|+|||+|||+++|.+++++|.||. ++.+.++.|++++...+. ...|||
T Consensus       157 ~L~~~~~eI~i~fk~~~~~~~~~~---~~~N~Lv~~iqP~e~I~l~~~~K~pg~-~~~~~~~~l~l~~~~~~~~~~~pda  232 (311)
T 2bh9_A          157 ALNERKAEVRLQFHDVAGDIFHQQ---CKRNELVIRVQPNEAVYTKMMTKKPGM-FFNPEESELDLTYGNRYKNVKLPDA  232 (311)
T ss_dssp             SCSSCEEEEEEEECCCSSCCSTTC---CCCCEEEEEEESSCEEEEEEEEECTTT-CCSEEEEEEEEETTTSSSSSCCCCH
T ss_pred             CCCCCEEEEEEEECCCCCCCCCCC---CCCCEEEEEECCCCCCCHHHHCCCCCC-CCCEEEEECCCCHHHCCCCCCCCCH
T ss_conf             667760899987136875201357---789858998568754410321448988-8740476415644212689988870


Q ss_pred             HHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             4899999987983358698999984588469999887348987457988997188999999818844778
Q gi|254780504|r  422 YERLLMDIIHANQTLFMGYDEVEETWKWSDSILKSWQIINQKVDYYAAGTWGPDQSDVLLQKDGRRWHNN  491 (492)
Q Consensus       422 Ye~Ll~D~i~Gd~tlF~r~dEve~sWrivdpiL~~~~~~~~~~~~Y~~GS~GP~~a~~l~~~~g~~W~~~  491 (492)
                      ||+||+|||+||+++|+|+|||++||+||||||++|+.++.+|++|++|||||++|++|++++|++|+++
T Consensus       233 YErLl~dv~~Gd~~lF~r~dEve~sW~ivdpIL~~~~~~~~~~~~Y~~Gs~GP~~a~~ll~~~g~~W~~~  302 (311)
T 2bh9_A          233 YERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGT  302 (311)
T ss_dssp             HHHHHHHHHHTCCTTSCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEETTSSSCHHHHHHHHHHTCCCCSC
T ss_pred             HHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCC
T ss_conf             8999999977997568997999999999899999997579988788999979999999999619885899



>1dpg_A (A:205-485) G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase, NADP/NAD, glucose metabolism, oxidoreductase (CHOH(D) - NAD(P)); 2.00A {Leuconostoc mesenteroides} Back     alignment and structure
>1dpg_A (A:1-182) G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase, NADP/NAD, glucose metabolism, oxidoreductase (CHOH(D) - NAD(P)); 2.00A {Leuconostoc mesenteroides} Back     alignment and structure
>2bh9_A (A:1-178) G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreductase, oxidoreductase (CHOH(D)-NADP), carbohydrate metabolism, glucose metabolism; HET: NAP; 2.5A {Homo sapiens} PDB: 2bhl_A* 1qki_A* Back     alignment and structure
>3btv_A (A:1-156,A:361-438) Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3btu_A Back     alignment and structure
>2nvw_A (A:1-176,A:396-479) Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} Back     alignment and structure
>1xea_A (A:1-123,A:263-323) Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} Back     alignment and structure
>1tlt_A (A:1-126,A:262-319) Putative oxidoreductase (virulence factor MVIM homolog); structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} Back     alignment and structure
>3i23_A (A:1-125) Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3e82_A (A:1-127) Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ec7_A (A:1-149) Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium LT2} Back     alignment and structure
>1h6d_A (A:1-210) Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} Back     alignment and structure
>1zh8_A (A:1-143) Oxidoreductase; TM0312, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MSE NAP; 2.50A {Thermotoga maritima MSB8} Back     alignment and structure
>2fp4_A (A:1-130) Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} Back     alignment and structure
>3f4l_A (A:1-125) Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3kux_A (A:1-127) Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center for structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3cea_A (A:1-132) MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase family, NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3fhl_A (A:1-126) Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3gdo_A (A:1-126) Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>2yv2_A (A:1-129) Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix K1} Back     alignment and structure
>2yv1_A (A:1-128) Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1oi7_A (A:1-122) Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} Back     alignment and structure
>2nu8_A (A:1-122) Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, rossmann fold; HET: COA; 2.15A {Escherichia coli} Back     alignment and structure
>2o4u_X (X:1-127,X:278-334) Dimeric dihydrodiol dehydrogenase; NADP-binding rossmann-fold domain, predominantly anti- parallel beta sheet, oxidoreductase; 2.00A {Macaca fascicularis} PDB: 2o48_X 2poq_X* Back     alignment and structure
>3e9m_A (A:1-127,A:277-330) Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3db2_A (A:1-127,A:299-354) Putative NADPH-dependent oxidoreductase; ZP_01370612.1, structural genomics, joint center for structural genomics, JCSG; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3dty_A (A:1-146,A:319-398) Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1ydw_A (A:1-133,A:305-362) AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} Back     alignment and structure
>3ezy_A (A:1-125,A:255-302) Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2p2s_A (A:1-127) Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2glx_A (A:1-122) 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3ip3_A (A:1-129) Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3e18_A (A:1-125) Oxidoreductase; dehydrogenase, NAD-binding, structural genomics, protein structure initiative, PSI; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure