254780505

254780505

6-phosphogluconolactonase

GeneID in NCBI database:8209500Locus tag:CLIBASIA_01960
Protein GI in NCBI database:254780505Protein Accession:YP_003064918.1
Gene range:-(770257, 770961)Protein Length:234aa
Gene description:6-phosphogluconolactonase
COG prediction:[G] 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase
KEGG prediction:6-phosphogluconolactonase; K01057 6-phosphogluconolactonase [EC:3.1.1.31]
SEED prediction:6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type
Pathway involved in KEGG:Pentose phosphate pathway [PATH:las00030]
Subsystem involved in SEED:Pentose phosphate pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS
ccccEEEEEccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccHHHEEEEEccccccccccHHHHHHHHHHHHcccccccHHHcccccccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEcccccccHHHHHHccccccEEEEcccccccccEEEEcHHHHHcccEEEEEEEcHHHHHHHHHHHcccccccccHHHHHccccccEEEEEcc
ccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHcccccccEEEEEEcccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEccccccccccccccHHHHHHcccccccEEEEccccccccccccccHHHHHHcccEEEEEccHcHHHHHHHHHcccccccccHHHHHcccccccEEEEEc
MLQYKLYVAENKKRLAQKLAKKVAEQLSIGitnkgtasialsggltprfFLEELSIINVDWHKVVVTLVDerfvplenlrsnqsFISKFFLQnkaqkasfiplyypqktIEEAIRIANEKICQLIHFPFDVVVLgmgidghtasffpkgdtlsialdthtprsvIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKaisgddaleMPIRAILWnaqsplevhwts
mlqyklyvAENKKRLAQKLAKKVAEQLSigitnkgtasiALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSialdthtprsVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILwnaqsplevhwts
MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS
***YKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS
MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS
**QYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS
MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS
MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target234 6-phosphogluconolactonase [Candidatus Liberibacter asia
315122298234 6-phosphogluconolactonase [Candidatus Liberibacter sola 1 1e-102
209547970232 6-phosphogluconolactonase [Rhizobium leguminosarum bv. 1 3e-64
116250524232 6-phosphogluconolactonase [Rhizobium leguminosarum bv. 1 3e-61
222084911240 6-phosphogluconolactonase protein [Agrobacterium radiob 1 6e-60
325291987232 6-phosphogluconolactonase [Agrobacterium sp. H13-3] Len 1 6e-59
218463200232 6-phosphogluconolactonase [Rhizobium etli Kim 5] Length 1 4e-58
241203148232 6-phosphogluconolactonase [Rhizobium leguminosarum bv. 1 5e-58
218671226200 6-phosphogluconolactonase [Rhizobium etli GR56] Length 1 1e-57
159184382232 6-phosphogluconolactonase [Agrobacterium tumefaciens st 1 4e-57
190890409232 6-phosphogluconolactonase [Rhizobium etli CIAT 652] Len 1 2e-56
>gi|315122298|ref|YP_004062787.1| 6-phosphogluconolactonase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 234 Back     alignment and organism information
 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/233 (75%), Positives = 206/233 (88%)

Query: 1   MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVD 60
           M +Y+ ++AE+KK LAQKLA+KVA QLS+GI  +G AS+ALSGG TP+ FLEELSIIN+D
Sbjct: 1   MSKYEFHIAESKKELAQKLAQKVAIQLSMGIRKRGYASLALSGGSTPQMFLEELSIINID 60

Query: 61  WHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEK 120
           WHK+ VTLVDERFVPLE+ RSNQ+FISKFFL NKAQK+SF+ LYYPQK I+++++IANEK
Sbjct: 61  WHKITVTLVDERFVPLEDPRSNQAFISKFFLTNKAQKSSFVALYYPQKNIQKSVKIANEK 120

Query: 121 ICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMT 180
           I Q IHFPFD VVLGMGIDGHTASFFP+GDTLSIALD HTPRSVIA+KD  ++EQR+TMT
Sbjct: 121 ISQFIHFPFDAVVLGMGIDGHTASFFPQGDTLSIALDPHTPRSVIALKDQYTHEQRITMT 180

Query: 181 FSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWT 233
           FSALHDAQFLALHIEG QKK+ LE AISG DA EMPIRAILW+A SPL ++WT
Sbjct: 181 FSALHDAQFLALHIEGIQKKNALETAISGYDATEMPIRAILWHANSPLAIYWT 233


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209547970|ref|YP_002279887.1| 6-phosphogluconolactonase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 232 Back     alignment and organism information
>gi|116250524|ref|YP_766362.1| 6-phosphogluconolactonase [Rhizobium leguminosarum bv. viciae 3841] Length = 232 Back     alignment and organism information
>gi|222084911|ref|YP_002543440.1| 6-phosphogluconolactonase protein [Agrobacterium radiobacter K84] Length = 240 Back     alignment and organism information
>gi|325291987|ref|YP_004277851.1| 6-phosphogluconolactonase [Agrobacterium sp. H13-3] Length = 232 Back     alignment and organism information
>gi|218463200|ref|ZP_03503291.1| 6-phosphogluconolactonase [Rhizobium etli Kim 5] Length = 232 Back     alignment and organism information
>gi|241203148|ref|YP_002974244.1| 6-phosphogluconolactonase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 232 Back     alignment and organism information
>gi|218671226|ref|ZP_03520897.1| 6-phosphogluconolactonase [Rhizobium etli GR56] Length = 200 Back     alignment and organism information
>gi|159184382|ref|NP_353625.2| 6-phosphogluconolactonase [Agrobacterium tumefaciens str. C58] Length = 232 Back     alignment and organism information
>gi|190890409|ref|YP_001976951.1| 6-phosphogluconolactonase [Rhizobium etli CIAT 652] Length = 232 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target234 6-phosphogluconolactonase [Candidatus Liberibacter asia
COG0363238 COG0363, NagB, 6-phosphogluconolactonase/Glucosamine-6- 2e-41
TIGR01198233 TIGR01198, pgl, 6-phosphogluconolactonase 3e-38
KOG3147252 KOG3147, KOG3147, KOG3147, 6-phosphogluconolactonase - 4e-20
PLN02360268 PLN02360, PLN02360, probable 6-phosphogluconolactonase 2e-12
cd01399232 cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamin 4e-07
PRK09762232 PRK09762, PRK09762, galactosamine-6-phosphate isomerase 7e-04
cd01400219 cd01400, 6PGL, 6PGL: 6-Phosphogluconolactonase (6PGL) s 7e-48
PRK00443261 PRK00443, nagB, glucosamine-6-phosphate deaminase; Prov 0.001
>gnl|CDD|30712 COG0363, NagB, 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|162247 TIGR01198, pgl, 6-phosphogluconolactonase Back     alignment and domain information
>gnl|CDD|38357 KOG3147, KOG3147, KOG3147, 6-phosphogluconolactonase - like protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|166001 PLN02360, PLN02360, probable 6-phosphogluconolactonase Back     alignment and domain information
>gnl|CDD|73165 cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium Back     alignment and domain information
>gnl|CDD|182064 PRK09762, PRK09762, galactosamine-6-phosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|73166 cd01400, 6PGL, 6PGL: 6-Phosphogluconolactonase (6PGL) subfamily; 6PGL catalyzes the second step of the oxidative phase of the pentose phosphate pathway, the hydrolyzation of 6-phosphoglucono-1,5-lactone (delta form) to 6-phosphogluconate Back     alignment and domain information
>gnl|CDD|179028 PRK00443, nagB, glucosamine-6-phosphate deaminase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 234 6-phosphogluconolactonase [Candidatus Liberibacter asia
TIGR01198251 pgl 6-phosphogluconolactonase; InterPro: IPR005900 6-ph 100.0
cd01400219 6PGL 6PGL: 6-Phosphogluconolactonase (6PGL) subfamily; 100.0
COG0363238 NagB 6-phosphogluconolactonase/Glucosamine-6-phosphate 100.0
PRK00443264 nagB glucosamine-6-phosphate deaminase; Provisional 100.0
PTZ00285253 glucosamine-6-phosphate isomerase; Provisional 100.0
PRK09762236 galactosamine-6-phosphate isomerase; Provisional 100.0
KOG3147252 consensus 100.0
cd01399232 GlcN6P_deaminase GlcN6P_deaminase: Glucosamine-6-phosph 100.0
PRK12358239 putative 6-phosphogluconolactonase; Provisional 100.0
TIGR00502260 nagB glucosamine-6-phosphate isomerase; InterPro: IPR00 100.0
PRK02122 660 glucosamine-6-phosphate deaminase-like protein; Validat 100.0
pfam01182236 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-ph 100.0
KOG3148273 consensus 99.98
pfam04198255 Sugar-bind Putative sugar-binding domain. This probable 98.35
COG2390321 DeoR Transcriptional regulator, contains sigma factor-r 98.21
cd00458169 SugarP_isomerase SugarP_isomerase: Sugar Phosphate Isom 100.0
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 96.26
>TIGR01198 pgl 6-phosphogluconolactonase; InterPro: IPR005900 6-phosphogluconolactonase (3 Back     alignment and domain information
>cd01400 6PGL 6PGL: 6-Phosphogluconolactonase (6PGL) subfamily; 6PGL catalyzes the second step of the oxidative phase of the pentose phosphate pathway, the hydrolyzation of 6-phosphoglucono-1,5-lactone (delta form) to 6-phosphogluconate Back     alignment and domain information
>COG0363 NagB 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00443 nagB glucosamine-6-phosphate deaminase; Provisional Back     alignment and domain information
>PTZ00285 glucosamine-6-phosphate isomerase; Provisional Back     alignment and domain information
>PRK09762 galactosamine-6-phosphate isomerase; Provisional Back     alignment and domain information
>KOG3147 consensus Back     alignment and domain information
>cd01399 GlcN6P_deaminase GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium Back     alignment and domain information
>PRK12358 putative 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR00502 nagB glucosamine-6-phosphate isomerase; InterPro: IPR004547 Glucosamine-6-phosphate isomerase (3 Back     alignment and domain information
>PRK02122 glucosamine-6-phosphate deaminase-like protein; Validated Back     alignment and domain information
>pfam01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase Back     alignment and domain information
>KOG3148 consensus Back     alignment and domain information
>pfam04198 Sugar-bind Putative sugar-binding domain Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>cd00458 SugarP_isomerase SugarP_isomerase: Sugar Phosphate Isomerase family; includes type A ribose 5-phosphate isomerase (RPI_A), glucosamine-6-phosphate (GlcN6P) deaminase, and 6-phosphogluconolactonase (6PGL) Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR014155 This entry contains VirB11, a protein that is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target234 6-phosphogluconolactonase [Candidatus Liberibacter asia
3nwp_A233 Crystal Structure Of A 6-Phosphogluconolactonase (S 3e-41
3lhi_A232 Crystal Structure Of Putative 6- Phosphogluconolact 8e-38
3lwd_A226 Crystal Structure Of Putative 6-Phosphogluconolacto 1e-35
3ico_A268 Crystal Structure Of 6-Phosphogluconolactonase From 2e-35
2bkv_A242 Structure And Kinetics Of A Monomeric Glucosamine-6 6e-35
2ri1_A235 Crystal Structure Of Glucosamine 6-Phosphate Deamin 2e-30
2ri0_A234 Crystal Structure Of Glucosamine 6-Phosphate Deamin 3e-30
1vl1_A232 Crystal Structure Of 6-Phosphogluconolactonase (Tm1 1e-29
1ne7_A289 Human Glucosamine-6-Phosphate Deaminase Isomerase A 4e-29
1pbt_A244 The Crystal Structure Of Tm1154, Oxidoreductase, So 1e-28
1y89_A238 Crystal Structure Of Devb Protein Length = 238 3e-28
3hn6_A289 Crystal Structure Of Glucosamine-6-Phosphate Deamin 3e-28
1hor_A266 Structure And Catalytic Mechanism Of Glucosamine 6- 7e-28
1jt9_A266 Structure Of The Mutant F174a T Form Of The Glucosa 1e-27
2j0e_A266 Three Dimensional Structure And Catalytic Mechanism 2e-25
3e7f_A265 Crystal Structure Of 6-Phosphogluconolactonase From 5e-25
3css_A267 Crystal Structure Of 6-Phosphogluconolactonase From 2e-24
3ch7_A266 Crystal Structure Of 6-Phosphogluconolactonase From 5e-24
3oc6_A248 Crystal Structure Of 6-Phosphogluconolactonase From 1e-23
3e15_A312 6-Phosphogluconolactonase From Plasmodium Vivax Len 2e-17
>gi|301598829|pdb|3NWP|A Chain A, Crystal Structure Of A 6-Phosphogluconolactonase (Sbal_2240) From Shewanella Baltica Os155 At 1.40 A Resolution Length = 233 Back     alignment and structure
 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 82/226 (36%), Positives = 121/226 (53%), Gaps = 3/226 (1%)

Query: 9   AENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTL 68
            +    L Q+LA K+A QL   +  +G AS+ +SGG TP    + LS  ++DW  V +TL
Sbjct: 11  FDTPSALEQQLASKIASQLQEAVDARGKASLVVSGGSTPLKLFQLLSXKSIDWSDVYITL 70

Query: 69  VDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFP 128
            DER+V  +   SN+  + +  LQN+A  A F  L     T E     A E +       
Sbjct: 71  ADERWVEADADASNERLVREHLLQNRASNAKFRGLKNXFSTAEAGADXAAESLSNFPRP- 129

Query: 129 FDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSALHDAQ 188
           FDVVVLG G DGHT S+FP    L  AL   T    +A    T+   R+T++ SA+ +++
Sbjct: 130 FDVVVLGXGNDGHTCSWFPCSAELENALT--TQALCVATNPTTAPHGRITLSKSAILNSR 187

Query: 189 FLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS 234
            + LH+ G QK  V  +A+  DD    PIRA+L   ++P++V W++
Sbjct: 188 QIYLHLVGEQKLSVYRQALESDDVHAXPIRAVLAQRKTPVDVFWSA 233


>gi|289526918|pdb|3LHI|A Chain A, Crystal Structure Of Putative 6- Phosphogluconolactonase(Yp_207848.1) From Neisseria Gonorrhoeae Fa 1090 At 1.33 A Resolution Length = 232 Back     alignment and structure
>gi|293651989|pdb|3LWD|A Chain A, Crystal Structure Of Putative 6-Phosphogluconolactonase (Yp_574786.1) From Chromohalobacter Salexigens Dsm 3043 At 1.88 A Resolution Length = 226 Back     alignment and structure
>gi|254839712|pdb|3ICO|A Chain A, Crystal Structure Of 6-Phosphogluconolactonase From Mycobacterium Tuberculosis Length = 268 Back     alignment and structure
gi|62739000|pdb|2BKV|A Chain A, Structure And Kinetics Of A Monomeric Glucosamine-6- Phosphate Deaminase: Missing Link Of The Nagb Superfamily Length = 242 Back     alignment and structure
>gi|170785027|pdb|2RI1|A Chain A, Crystal Structure Of Glucosamine 6-Phosphate Deaminase (Nagb) With Glcn6p From S. Mutans Length = 235 Back     alignment and structure
>gi|170785025|pdb|2RI0|A Chain A, Crystal Structure Of Glucosamine 6-Phosphate Deaminase (Nagb) From S. Mutans Length = 234 Back     alignment and structure
>gi|52696138|pdb|1VL1|A Chain A, Crystal Structure Of 6-Phosphogluconolactonase (Tm1154) From Thermotoga Maritima At 1.70a Resolution Length = 232 Back     alignment and structure
gi|37926898|pdb|1NE7|A Chain A, Human Glucosamine-6-Phosphate Deaminase Isomerase At 1.75 A Resolution Complexed With N-Acetyl-Glucosamine-6-Phosphate And 2-Deoxy-2-Amino-Glucitol-6-Phosphate Length = 289 Back     alignment and structure
>gi|37927458|pdb|1PBT|A Chain A, The Crystal Structure Of Tm1154, Oxidoreductase, SolDEVB Family From Thermotoga Maritima Length = 244 Back     alignment and structure
>gi|60594159|pdb|1Y89|A Chain A, Crystal Structure Of Devb Protein Length = 238 Back     alignment and structure
>gi|239782191|pdb|3HN6|A Chain A, Crystal Structure Of Glucosamine-6-Phosphate Deaminase From Borrelia Burgdorferi Length = 289 Back     alignment and structure
gi|1310837|pdb|1HOR|A Chain A, Structure And Catalytic Mechanism Of Glucosamine 6- Phosphate Deaminase From Escherichia Coli At 2.1 Angstroms Resolution Length = 266 Back     alignment and structure
>gi|20150540|pdb|1JT9|A Chain A, Structure Of The Mutant F174a T Form Of The Glucosamine-6- Phosphate Deaminase From E.Coli Length = 266 Back     alignment and structure
>gi|126030893|pdb|2J0E|A Chain A, Three Dimensional Structure And Catalytic Mechanism Of 6- Phosphogluconolactonase From Trypanosoma Brucei Length = 266 Back     alignment and structure
>gi|238537773|pdb|3E7F|A Chain A, Crystal Structure Of 6-Phosphogluconolactonase From Trypanosoma Brucei Complexed With 6-Phosphogluconic Acid Length = 265 Back     alignment and structure
>gi|185178037|pdb|3CSS|A Chain A, Crystal Structure Of 6-Phosphogluconolactonase From Leishmania Guyanensis Length = 267 Back     alignment and structure
>gi|170292557|pdb|3CH7|A Chain A, Crystal Structure Of 6-Phosphogluconolactonase From Leishmania Braziliensis Length = 266 Back     alignment and structure
>gi|303325211|pdb|3OC6|A Chain A, Crystal Structure Of 6-Phosphogluconolactonase From Mycobacterium Smegmatis, Apo Form Length = 248 Back     alignment and structure
>gi|197107499|pdb|3E15|A Chain A, 6-Phosphogluconolactonase From Plasmodium Vivax Length = 312 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target234 6-phosphogluconolactonase [Candidatus Liberibacter asia
3lhi_A232 Putative 6-phosphogluconolactonase; structural genomics 5e-45
3nwp_A233 6-phosphogluconolactonase; structural genomics, joint c 1e-44
3lwd_A226 6-phosphogluconolactonase; structural genomics, joint c 3e-44
3ico_A268 6PGL, 6-phosphogluconolactonase; ssgcid, infectious dis 3e-36
3oc6_A248 6-phosphogluconolactonase; ssgcid, structural genomics, 3e-34
3eb9_A266 6-phosphogluconolactonase; catalytic mechanism, pentose 2e-30
1vl1_A232 6PGL, 6-phosphogluconolactonase; TM1154, structural gen 5e-29
3css_A267 6-phosphogluconolactonase; structural genomics, medical 2e-28
3e15_A312 Glucose-6-phosphate 1-dehydrogenase; 6-phosphogluconola 4e-28
3hn6_A289 Glucosamine-6-phosphate deaminase; niaid, ssgcid, decod 2e-27
1ne7_A289 Glucosamine-6-phosphate isomerase; V-type like alloster 2e-26
1fs5_A266 Glucosamine-6-phosphate deaminase; allosteric enzyme, e 2e-26
2bkx_A242 Glucosamine-6-phosphate deaminase; hydrolase, substrate 3e-26
1y89_A238 DEVB protein; structural genomics, protein structure in 9e-26
2ri0_A234 Glucosamine-6-phosphate deaminase; carbohydrate metabol 3e-24
2o0m_A345 Transcriptional regulator, SORC family; structural geno 6e-05
>3lhi_A Putative 6-phosphogluconolactonase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.33A {Neisseria gonorrhoeae} Length = 232 Back     alignment and structure
 Score =  176 bits (446), Expect = 5e-45
 Identities = 80/232 (34%), Positives = 118/232 (50%), Gaps = 3/232 (1%)

Query: 1   MLQYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVD 60
           M  +  Y  EN    AQ LA  VA+ L   +  KG A +A+SGG +P  F   LS  ++D
Sbjct: 2   MFVWHEY--ENAAEAAQSLADAVADALQGALDEKGGAVLAVSGGRSPIAFFNALSQKDLD 59

Query: 61  WHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEK 120
           W  V +TL DER VP  +  SN   + ++ L+NKA  A +IP+    KT  E    A   
Sbjct: 60  WKNVGITLADERIVPTNHADSNTGLVREYLLKNKAAAAVWIPMVEDGKTETELHPDAVVD 119

Query: 121 ICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMT 180
                +   DV++LGMG DGHTAS FPK      A+D     +++     T+  +R++MT
Sbjct: 120 YALKHYKQPDVLILGMGNDGHTASIFPKAPQFQTAIDGSAGVALVHTTPVTAPHERISMT 179

Query: 181 FSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHW 232
             A+     + L I+G +KK V ++A  G++  E PI  +L +      V +
Sbjct: 180 LDAIAHTGHVFLAIQGEEKKAVFDQAAQGENR-EYPISLVLNHQGVNCHVFY 230


>3nwp_A 6-phosphogluconolactonase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE P6G PG4; 1.40A {Shewanella baltica} Length = 233 Back     alignment and structure
>3lwd_A 6-phosphogluconolactonase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.75A {Chromohalobacter salexigens} Length = 226 Back     alignment and structure
>3ico_A 6PGL, 6-phosphogluconolactonase; ssgcid, infectious disease, niaid, hydrolase, structural genomics; 2.15A {Mycobacterium tuberculosis} Length = 268 Back     alignment and structure
>3oc6_A 6-phosphogluconolactonase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, carboxylic ester hydrolase; 2.10A {Mycobacterium smegmatis} Length = 248 Back     alignment and structure
>3eb9_A 6-phosphogluconolactonase; catalytic mechanism, pentose phosphate pathway, hydrolase, zinc binding site; HET: FLC; 2.00A {Trypanosoma brucei} PDB: 2j0e_A* 3e7f_A* Length = 266 Back     alignment and structure
>1vl1_A 6PGL, 6-phosphogluconolactonase; TM1154, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: CIT; 1.55A {Thermotoga maritima} SCOP: c.124.1.1 PDB: 1pbt_A Length = 232 Back     alignment and structure
>3css_A 6-phosphogluconolactonase; structural genomics, medical structural genomics of pathogenic protozoa consortium, SGPP, leishmaniasis; 1.70A {Leishmania braziliensismhom} PDB: 3ch7_A Length = 267 Back     alignment and structure
>3e15_A Glucose-6-phosphate 1-dehydrogenase; 6-phosphogluconolactonase, malaria, carbohydrate metabolism, glucose metabolism, NADP, oxidoreductase,; HET: MSE; 2.00A {Plasmodium vivax} Length = 312 Back     alignment and structure
>3hn6_A Glucosamine-6-phosphate deaminase; niaid, ssgcid, decode, UW, SBRI, infectious disease, LYME disease, non-hodgkin lymphomas; 2.20A {Borrelia burgdorferi B31} Length = 289 Back     alignment and structure
>1ne7_A Glucosamine-6-phosphate isomerase; V-type like allosteric enzyme, conformational disorder, conformational differences, hydrolase; HET: GLC 16G AGP; 1.75A {Homo sapiens} SCOP: c.124.1.1 Length = 289 Back     alignment and structure
>1fs5_A Glucosamine-6-phosphate deaminase; allosteric enzyme, entropic effects, aldose-ketose isomerase, multiple conformers; HET: 16G TLA; 1.73A {Escherichia coli} SCOP: c.124.1.1 PDB: 1cd5_A 1fqo_A* 1frz_A* 1dea_A* 1fs6_A 1fsf_A 1hor_A* 1hot_A* 2wu1_A* 1jt9_A Length = 266 Back     alignment and structure
>2bkx_A Glucosamine-6-phosphate deaminase; hydrolase, substrate inhibition, fructose-6-phosphate; HET: F6R; 1.4A {Bacillus subtilis} PDB: 2bkv_A* Length = 242 Back     alignment and structure
>1y89_A DEVB protein; structural genomics, protein structure initiative, PSI, midwest center for structural genomics, MCSG; HET: 2PE; 2.00A {Vibrio cholerae o1 biovar eltor str} Length = 238 Back     alignment and structure
>2ri0_A Glucosamine-6-phosphate deaminase; carbohydrate metabolism, hydrolase; HET: BTB; 1.60A {Streptococcus mutans} PDB: 2ri1_A* Length = 234 Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, PSI-2, protein structure initiative; 1.60A {Enterococcus faecalis V583} SCOP: c.124.1.8 Length = 345 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target234 6-phosphogluconolactonase [Candidatus Liberibacter asia
3nwp_A233 6-phosphogluconolactonase; structural genomics, joint c 100.0
3lhi_A232 Putative 6-phosphogluconolactonase; structural genomics 100.0
3ico_A268 6PGL, 6-phosphogluconolactonase; ssgcid, infectious dis 100.0
3lwd_A226 6-phosphogluconolactonase; structural genomics, joint c 100.0
3oc6_A248 6-phosphogluconolactonase; ssgcid, structural genomics, 100.0
3e15_A312 Glucose-6-phosphate 1-dehydrogenase; 6-phosphogluconola 100.0
1vl1_A232 6PGL, 6-phosphogluconolactonase; TM1154, structural gen 100.0
1y89_A238 DEVB protein; structural genomics, protein structure in 100.0
3css_A267 6-phosphogluconolactonase; structural genomics, medical 100.0
3hn6_A289 Glucosamine-6-phosphate deaminase; niaid, ssgcid, decod 100.0
3eb9_A266 6-phosphogluconolactonase; catalytic mechanism, pentose 100.0
1fs5_A266 Glucosamine-6-phosphate deaminase; allosteric enzyme, e 100.0
1ne7_A289 Glucosamine-6-phosphate isomerase; V-type like alloster 100.0
2bkx_A242 Glucosamine-6-phosphate deaminase; hydrolase, substrate 100.0
2ri0_A234 Glucosamine-6-phosphate deaminase; carbohydrate metabol 100.0
2o0m_A345 Transcriptional regulator, SORC family; structural geno 99.58
2okg_A255 Central glycolytic gene regulator; alpha/beta/alpha san 99.58
2gnp_A266 Transcriptional regulator; structural genomics, MCSG, A 99.15
3nze_A267 Putative transcriptional regulator, sugar-binding; stru 99.01
3efb_A266 Probable SOR-operon regulator; alpha-beta-alpha sandwic 98.99
2w48_A315 Sorbitol operon regulator; SORC, activator, repressor, 98.84
3kv1_A267 Transcriptional repressor; alpha-beta structure, struct 98.31
2r5f_A264 Transcriptional regulator, putative; transcription regu 98.22
>3nwp_A 6-phosphogluconolactonase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE P6G PG4; 1.40A {Shewanella baltica} Back     alignment and structure
Probab=100.00  E-value=0  Score=399.07  Aligned_cols=231  Identities=37%  Similarity=0.574  Sum_probs=210.2

Q ss_pred             CCC-CEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCC
Q ss_conf             987-2899948989999999999999999999728977999879864699998787630795323899813210035673
Q gi|254780505|r    1 MLQ-YKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENL   79 (234)
Q Consensus         1 M~~-~~i~i~~~~~~l~~~~a~~i~~~i~~~i~~~~~~~i~lsGGstp~~~y~~L~~~~~~w~kv~~~~~DER~V~~~~~   79 (234)
                      |+. ..+++|+|.+++++.+|+.+++.++++++++|.|+|+||||+||+.+|+.|++..+||+||++|++|||||+.+|+
T Consensus         2 m~~~~~~~~f~~~~~l~~~la~~i~~~l~~~i~~~~~~~l~lsGGstp~~ly~~L~~~~i~w~~v~~~~~DEr~v~~~~~   81 (233)
T 3nwp_A            2 MIKETVFKSFDTPSALEQQLASKIASQLQEAVDARGKASLVVSGGSTPLKLFQLLSMKSIDWSDVYITLADERWVEADAD   81 (233)
T ss_dssp             CCCCCCEEEESSHHHHHHHHHHHHHHHHHHHHHHHSCEEEEECCSSTTHHHHHHHHHCCSCGGGEEEEESEEESSCTTST
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHCCCCHHCEEEEEEEECCCCCCC
T ss_conf             97677277369999999999999999999999867988999768821999999987344892435487314762676654


Q ss_pred             CCHHHHHHHHHHCCCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCEEEECCCCCCCEEECCCC
Q ss_conf             20278899976235677632144458878989999999999963158776489944788771434027864100221566
Q gi|254780505|r   80 RSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTH  159 (234)
Q Consensus        80 ~Sn~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dl~lLGiG~DGH~ASlFP~~~~l~~~~~~~  159 (234)
                      +||+++++++|+++.+.+..+++......+++.+++.|++.+.... ++||+++||||+||||||||||++.+.....  
T Consensus        82 ~Sn~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~Dl~lLG~G~DGHiAslfP~~~~~~~~~~--  158 (233)
T 3nwp_A           82 ASNERLVREHLLQNRASNAKFRGLKNMFSTAEAGADMAAESLSNFP-RPFDVVVLGMGNDGHTCSWFPCSAELENALT--  158 (233)
T ss_dssp             TCHHHHHHHHTSSGGGGGSEECCSCCSSSSHHHHHHHHHHHTTTSC-SSBSEEEECCCTTSCBTTBCTTCTTHHHHHH--
T ss_pred             CHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC-CCCCEEEECCCCCCCEEECCCCCHHHHHCCC--
T ss_conf             1069999997523788742224778865588999999999986069-9875898667898745346899766653124--


Q ss_pred             CCCCEEEECCCCCCCEEEEECHHHHHCCCEEEEEEECHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCEEEEECC
Q ss_conf             743189953899872158708788841582999981834899999998089832060899961899968998339
Q gi|254780505|r  160 TPRSVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWTS  234 (234)
Q Consensus       160 ~~~~~~~~~~~~~p~~RITlt~~~l~~a~~i~ll~~G~~K~~al~~~l~~~~~~~~Pas~ll~~~~~~~~V~W~~  234 (234)
                      ....++.+..+++|++|||||++.|++|++|+|+++|++|+++++++++++++..|||++|+.|.++++.|||++
T Consensus       159 ~~~~~~~~~~~~~p~~RITltl~~i~~ak~i~ll~~G~~K~~~~~~~l~~~~~~~~Pas~l~~~~~~~v~v~w~~  233 (233)
T 3nwp_A          159 TQALCVATNPTTAPHGRITLSKSAILNSRQIYLHLVGEQKLSVYRQALESDDVHAMPIRAVLAQRKTPVDVFWSA  233 (233)
T ss_dssp             CCSSEEEECCSSSSSCEEEECHHHHHSBSCEEEEEESHHHHHHHHHHHTCCCTTTCTTHHHHSCSSSCEEEEEEC
T ss_pred             CCEEEECCCCCCCCCCEEECCHHHHHHCCEEEEEEECHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCEEEEECC
T ss_conf             532684478888997289888999971385899996889999999998289931252899974799987999619



>3lhi_A Putative 6-phosphogluconolactonase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.33A {Neisseria gonorrhoeae} Back     alignment and structure
>3ico_A 6PGL, 6-phosphogluconolactonase; ssgcid, infectious disease, niaid, hydrolase, structural genomics; 2.15A {Mycobacterium tuberculosis} Back     alignment and structure
>3lwd_A 6-phosphogluconolactonase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.75A {Chromohalobacter salexigens} Back     alignment and structure
>3oc6_A 6-phosphogluconolactonase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, carboxylic ester hydrolase; 2.10A {Mycobacterium smegmatis} Back     alignment and structure
>3e15_A Glucose-6-phosphate 1-dehydrogenase; 6-phosphogluconolactonase, malaria, carbohydrate metabolism, glucose metabolism, NADP, oxidoreductase,; HET: MSE; 2.00A {Plasmodium vivax} Back     alignment and structure
>1vl1_A 6PGL, 6-phosphogluconolactonase; TM1154, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: CIT; 1.55A {Thermotoga maritima} SCOP: c.124.1.1 PDB: 1pbt_A Back     alignment and structure
>1y89_A DEVB protein; structural genomics, protein structure initiative, PSI, midwest center for structural genomics, MCSG; HET: 2PE; 2.00A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>3css_A 6-phosphogluconolactonase; structural genomics, medical structural genomics of pathogenic protozoa consortium, SGPP, leishmaniasis; 1.70A {Leishmania braziliensismhom} PDB: 3ch7_A Back     alignment and structure
>3hn6_A Glucosamine-6-phosphate deaminase; niaid, ssgcid, decode, UW, SBRI, infectious disease, LYME disease, non-hodgkin lymphomas; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>3eb9_A 6-phosphogluconolactonase; catalytic mechanism, pentose phosphate pathway, hydrolase, zinc binding site; HET: FLC; 2.00A {Trypanosoma brucei} PDB: 2j0e_A* 3e7f_A* Back     alignment and structure
>1fs5_A Glucosamine-6-phosphate deaminase; allosteric enzyme, entropic effects, aldose-ketose isomerase, multiple conformers; HET: 16G TLA; 1.73A {Escherichia coli} SCOP: c.124.1.1 PDB: 1cd5_A 1fqo_A* 1frz_A* 1dea_A* 1fs6_A 1fsf_A 1hor_A* 1hot_A* 2wu1_A* 1jt9_A Back     alignment and structure
>1ne7_A Glucosamine-6-phosphate isomerase; V-type like allosteric enzyme, conformational disorder, conformational differences, hydrolase; HET: GLC 16G AGP; 1.75A {Homo sapiens} SCOP: c.124.1.1 Back     alignment and structure
>2bkx_A Glucosamine-6-phosphate deaminase; hydrolase, substrate inhibition, fructose-6-phosphate; HET: F6R; 1.4A {Bacillus subtilis} PDB: 2bkv_A* Back     alignment and structure
>2ri0_A Glucosamine-6-phosphate deaminase; carbohydrate metabolism, hydrolase; HET: BTB; 1.60A {Streptococcus mutans} PDB: 2ri1_A* Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, PSI-2, protein structure initiative; 1.60A {Enterococcus faecalis V583} SCOP: c.124.1.8 Back     alignment and structure
>2okg_A Central glycolytic gene regulator; alpha/beta/alpha sandwich, rossmann-like fold, structural genomics, PSI-2, protein structure initiative; HET: MSE G3H; 1.65A {Bacillus subtilis} SCOP: c.124.1.8 PDB: 3bxe_A* 3bxf_A* 3bxg_A* 3bxh_A* Back     alignment and structure
>2gnp_A Transcriptional regulator; structural genomics, MCSG, APC84799, PSI, protein structure initiative; 1.65A {Streptococcus pneumoniae TIGR4} SCOP: c.124.1.8 Back     alignment and structure
>3nze_A Putative transcriptional regulator, sugar-binding; structural genomics, PSI-2, protein structure initiative; 1.70A {Arthrobacter aurescens TC1} Back     alignment and structure
>3efb_A Probable SOR-operon regulator; alpha-beta-alpha sandwich, center for structural genomics of infectious diseases, csgid, transcription; HET: MSE; 2.00A {Shigella flexneri 2a str} SCOP: c.124.1.8 Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3kv1_A Transcriptional repressor; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.70A {Vibrio fischeri ES114} Back     alignment and structure
>2r5f_A Transcriptional regulator, putative; transcription regulator, sugar-binding domain, structural genomics, PFAM04198, PSI-2; 2.10A {Pseudomonas syringae PV} SCOP: c.124.1.8 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 234 6-phosphogluconolactonase [Candidatus Liberibacter asia
d1vl1a_218 c.124.1.1 (A:) 6-phosphogluconolactonase {Thermotoga ma 2e-27
d1ne7a_281 c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomer 2e-23
d1fsfa_266 c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomer 1e-22
d3efba1255 c.124.1.8 (A:11-265) Sor-operon regulator SorC {Shigell 1e-04
d2okga1250 c.124.1.8 (A:89-338) Central glycolytic gene regulator 5e-04
>d1vl1a_ c.124.1.1 (A:) 6-phosphogluconolactonase {Thermotoga maritima [TaxId: 2336]} Length = 218 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: NagB-like
domain: 6-phosphogluconolactonase
species: Thermotoga maritima [TaxId: 2336]
 Score =  116 bits (290), Expect = 2e-27
 Identities = 53/228 (23%), Positives = 95/228 (41%), Gaps = 14/228 (6%)

Query: 5   KLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKV 64
           K  +   +      + +K+  ++   +  K    + L+GG TP    E+L+     W+++
Sbjct: 1   KTVIYLLEDGYVDFVVEKIRTKMEKLLEEKDKIFVVLAGGRTPLPVYEKLAEQKFPWNRI 60

Query: 65  VVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQL 124
              L DER+VPL++ +SN   I++         +  +        IE+A     E+  + 
Sbjct: 61  HFFLSDERYVPLDSDQSNFRNINEVLFSRAKIPSGNVHYVDTSLPIEKACE-KYEREIRS 119

Query: 125 IHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSAL 184
               FD+ +LGMG DGH AS F         L T T  S            R+T+TF AL
Sbjct: 120 ATDQFDLAILGMGPDGHVASIFDLETGNKDNLVTFTDPS------GDPKVPRVTLTFRAL 173

Query: 185 HDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHW 232
           + + ++   I G +K + L + +       +P   +    +   +  W
Sbjct: 174 NTSLYVLFLIRGKEKINRLTEILKDTP---LPAYFV----RGKEKTVW 214


>d1ne7a_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Human (Homo sapiens) [TaxId: 9606]} Length = 281 Back     information, alignment and structure
>d1fsfa_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]} Length = 266 Back     information, alignment and structure
>d3efba1 c.124.1.8 (A:11-265) Sor-operon regulator SorC {Shigella flexneri [TaxId: 623]} Length = 255 Back     information, alignment and structure
>d2okga1 c.124.1.8 (A:89-338) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]} Length = 250 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target234 6-phosphogluconolactonase [Candidatus Liberibacter asia
d1vl1a_218 6-phosphogluconolactonase {Thermotoga maritima [TaxId: 100.0
d1ne7a_281 Glucosamine 6-phosphate deaminase/isomerase NagB {Human 100.0
d1fsfa_266 Glucosamine 6-phosphate deaminase/isomerase NagB {Esche 100.0
d2o0ma1247 Transcriptional regulator EF1965 {Enterococcus faecalis 99.86
d3efba1255 Sor-operon regulator SorC {Shigella flexneri [TaxId: 62 99.65
d2okga1250 Central glycolytic gene regulator CggR {Bacillus subtil 99.63
d2gnpa1262 Transcriptional regulator SP0247 {Streptococcus pneumon 99.51
d2r5fa1258 Transcriptional regulator PSPTO2395 {Pseudomonas syring 99.1
>d1vl1a_ c.124.1.1 (A:) 6-phosphogluconolactonase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: NagB-like
domain: 6-phosphogluconolactonase
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=0  Score=363.98  Aligned_cols=215  Identities=23%  Similarity=0.314  Sum_probs=190.6

Q ss_pred             EEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCHHH
Q ss_conf             89994898999999999999999999972897799987986469999878763079532389981321003567320278
Q gi|254780505|r    5 KLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSNQS   84 (234)
Q Consensus         5 ~i~i~~~~~~l~~~~a~~i~~~i~~~i~~~~~~~i~lsGGstp~~~y~~L~~~~~~w~kv~~~~~DER~V~~~~~~Sn~~   84 (234)
                      |..||.+.+++...+++.|.+.++++++++++++|+||||+||..+|+.|++..+||+||++|++||||||.+|++||++
T Consensus         1 ~~~i~~~~~~~~~~~a~~i~~~~~~~~~~~~~~~i~lsGG~tp~~~y~~L~~~~~~w~kv~~~~~DER~V~~~~~~Sn~~   80 (218)
T d1vl1a_           1 KTVIYLLEDGYVDFVVEKIRTKMEKLLEEKDKIFVVLAGGRTPLPVYEKLAEQKFPWNRIHFFLSDERYVPLDSDQSNFR   80 (218)
T ss_dssp             CEEEEEESSCHHHHHHHHHHHHHHHHHHHCSCEEEEECCSTTHHHHHHHHTTSCCCGGGEEEEESEEESSCTTSTTCHHH
T ss_pred             CEEEEECHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHCCCCCCEEEEEECCEECCCCCCCCCHHH
T ss_conf             93999777899999999999999999985899899978980599999999834998004899861201136776303699


Q ss_pred             HHHHHHHCCCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCEEEECCCCCCCEEECCCCCCCCE
Q ss_conf             89997623567763214445887898999999999996315877648994478877143402786410022156674318
Q gi|254780505|r   85 FISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSV  164 (234)
Q Consensus        85 ~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dl~lLGiG~DGH~ASlFP~~~~l~~~~~~~~~~~~  164 (234)
                      +++++|+++..++..+++++....+++++++.|++.+.... ++||+++||||+|||||||||+++...       +..+
T Consensus        81 ~~~~~l~~~~~i~~~~i~~~~~~~~~~~~~~~y~~~i~~~~-~~~Dl~lLG~G~DGHiASlFp~~~~~~-------~~~~  152 (218)
T d1vl1a_          81 NINEVLFSRAKIPSGNVHYVDTSLPIEKACEKYEREIRSAT-DQFDLAILGMGPDGHVASIFDLETGNK-------DNLV  152 (218)
T ss_dssp             HHHHHTTTTSCCCGGGEECCCTTSCHHHHHHHHHHHHHHHC-SSCSEEEECCCTTSCBTTBCSHHHHTC-------SSSE
T ss_pred             HHHHHHHHHCCCCHHEEEECCCCCCHHHHHHHHHHHHHCCC-CCEEEEEECCCCCCCCCCCCCCCCCCC-------CCEE
T ss_conf             99987634214542115534665628999998655430235-421588716788886434578764432-------2537


Q ss_pred             EEECC-CCCCCEEEEECHHHHHCCCEEEEEEECHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCEEE
Q ss_conf             99538-9987215870878884158299998183489999999808983206089996189996899
Q gi|254780505|r  165 IAIKD-YTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEV  230 (234)
Q Consensus       165 ~~~~~-~~~p~~RITlt~~~l~~a~~i~ll~~G~~K~~al~~~l~~~~~~~~Pas~ll~~~~~~~~V  230 (234)
                      ..+.. +.+|++|||||++.|++|++|+|+++|++|+++++++++++   .|||++|+.|.++.++|
T Consensus       153 ~~~~~~~~~~~~RITltl~~i~~ak~i~ll~~G~~K~~~l~~~~~~~---~~Pa~~l~~~~~~~~~~  216 (218)
T d1vl1a_         153 TFTDPSGDPKVPRVTLTFRALNTSLYVLFLIRGKEKINRLTEILKDT---PLPAYFVRGKEKTVWFV  216 (218)
T ss_dssp             EECSSBTTTTBCEEEECHHHHTTCSEEEEEEESHHHHHHHHHHHTTC---CCGGGGCCCSSEEEEEE
T ss_pred             EEECCCCCCCCCEEECCHHHHHCCCEEEEEECCHHHHHHHHHHHCCC---CCCHHHHCCCCCEEEEE
T ss_conf             84145558997766357777630177999976889999999996099---98858866799879997



>d1ne7a_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fsfa_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o0ma1 c.124.1.8 (A:95-341) Transcriptional regulator EF1965 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3efba1 c.124.1.8 (A:11-265) Sor-operon regulator SorC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2okga1 c.124.1.8 (A:89-338) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gnpa1 c.124.1.8 (A:56-317) Transcriptional regulator SP0247 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2r5fa1 c.124.1.8 (A:59-316) Transcriptional regulator PSPTO2395 {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 234 6-phosphogluconolactonase [Candidatus Liberibacter
3lhi_A_232 (A:) Putative 6-phosphogluconolactonase; structura 1e-38
3e15_A_312 (A:) Glucose-6-phosphate 1-dehydrogenase; 6-phosph 1e-32
1vl1_A_232 (A:) 6PGL, 6-phosphogluconolactonase; TM1154, stru 1e-32
3css_A_267 (A:) 6-phosphogluconolactonase; structural genomic 4e-32
1y89_A_238 (A:) DEVB protein; structural genomics, protein st 7e-31
3hn6_A_289 (A:) Glucosamine-6-phosphate deaminase; niaid, ssg 2e-30
2bkx_A_242 (A:) Glucosamine-6-phosphate deaminase; hydrolase, 2e-29
1ne7_A_289 (A:) Glucosamine-6-phosphate isomerase; V-type lik 3e-29
3eb9_A_266 (A:) 6-phosphogluconolactonase; catalytic mechanis 3e-29
3ico_A_268 (A:) 6PGL, 6-phosphogluconolactonase; ssgcid, infe 4e-29
1fs5_A_266 (A:) Glucosamine-6-phosphate deaminase; allosteric 5e-28
2ri0_A_234 (A:) Glucosamine-6-phosphate deaminase; carbohydra 1e-26
3kv1_A_267 (A:) Transcriptional repressor; alpha-beta structu 5e-17
2gnp_A_266 (A:) Transcriptional regulator; structural genomic 1e-14
2r5f_A_264 (A:) Transcriptional regulator, putative; transcri 1e-14
2w48_A_55-315261 (A:55-315) Sorbitol operon regulator; SORC, activa 5e-14
2okg_A_255 (A:) Central glycolytic gene regulator; alpha/beta 8e-14
3efb_A_266 (A:) Probable SOR-operon regulator; alpha-beta-alp 2e-12
2o0m_A_345 (A:) Transcriptional regulator, SORC family; struc 2e-12
>3lhi_A (A:) Putative 6-phosphogluconolactonase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.33A {Neisseria gonorrhoeae}Length = 232 Back     alignment and structure
 Score =  154 bits (390), Expect = 1e-38
 Identities = 76/229 (33%), Positives = 114/229 (49%), Gaps = 1/229 (0%)

Query: 4   YKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHK 63
           +  +  EN    AQ LA  VA+ L   +  KG A +A+SGG +P  F   LS  ++DW  
Sbjct: 3   FVWHEYENAAEAAQSLADAVADALQGALDEKGGAVLAVSGGRSPIAFFNALSQKDLDWKN 62

Query: 64  VVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQ 123
           V +TL DER VP  +  SN   + ++ L+NKA  A +IP     KT  E    A      
Sbjct: 63  VGITLADERIVPTNHADSNTGLVREYLLKNKAAAAVWIPXVEDGKTETELHPDAVVDYAL 122

Query: 124 LIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSA 183
             +   DV++LG G DGHTAS FPK      A+D     +++     T+  +R++ T  A
Sbjct: 123 KHYKQPDVLILGXGNDGHTASIFPKAPQFQTAIDGSAGVALVHTTPVTAPHERISXTLDA 182

Query: 184 LHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHW 232
           +     + L I+G +KK V ++A  G++  E PI  +L +      V +
Sbjct: 183 IAHTGHVFLAIQGEEKKAVFDQAAQGENR-EYPISLVLNHQGVNCHVFY 230


>3e15_A (A:) Glucose-6-phosphate 1-dehydrogenase; 6-phosphogluconolactonase, malaria, carbohydrate metabolism, glucose metabolism, NADP, oxidoreductase,; HET: MSE; 2.00A {Plasmodium vivax}Length = 312 Back     alignment and structure
>1vl1_A (A:) 6PGL, 6-phosphogluconolactonase; TM1154, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: CIT; 1.55A {Thermotoga maritima}Length = 232 Back     alignment and structure
>3css_A (A:) 6-phosphogluconolactonase; structural genomics, medical structural genomics of pathogenic protozoa consortium, SGPP, leishmaniasis; 1.70A {Leishmania braziliensismhom} PDB: 3ch7_ALength = 267 Back     alignment and structure
>1y89_A (A:) DEVB protein; structural genomics, protein structure initiative, PSI, midwest center for structural genomics, MCSG; HET: 2PE; 2.00A {Vibrio cholerae o1 biovar eltor str}Length = 238 Back     alignment and structure
>3hn6_A (A:) Glucosamine-6-phosphate deaminase; niaid, ssgcid, decode, UW, SBRI, infectious disease, LYME disease, non-hodgkin lymphomas; 2.20A {Borrelia burgdorferi B31}Length = 289 Back     alignment and structure
>2bkx_A (A:) Glucosamine-6-phosphate deaminase; hydrolase, substrate inhibition, fructose-6-phosphate; HET: F6R; 1.4A {Bacillus subtilis} PDB: 2bkv_A*Length = 242 Back     alignment and structure
>1ne7_A (A:) Glucosamine-6-phosphate isomerase; V-type like allosteric enzyme, conformational disorder, conformational differences, hydrolase; HET: GLC 16G AGP; 1.75A {Homo sapiens}Length = 289 Back     alignment and structure
>3eb9_A (A:) 6-phosphogluconolactonase; catalytic mechanism, pentose phosphate pathway, hydrolase, zinc binding site; HET: FLC; 2.00A {Trypanosoma brucei} PDB: 2j0e_A* 3e7f_A*Length = 266 Back     alignment and structure
>3ico_A (A:) 6PGL, 6-phosphogluconolactonase; ssgcid, infectious disease, niaid, hydrolase, structural genomics; 2.15A {Mycobacterium tuberculosis}Length = 268 Back     alignment and structure
>1fs5_A (A:) Glucosamine-6-phosphate deaminase; allosteric enzyme, entropic effects, aldose-ketose isomerase, multiple conformers; HET: 16G TLA; 1.73A {Escherichia coli}Length = 266 Back     alignment and structure
>2ri0_A (A:) Glucosamine-6-phosphate deaminase; carbohydrate metabolism, hydrolase; HET: BTB; 1.60A {Streptococcus mutans} PDB: 2ri1_A*Length = 234 Back     alignment and structure
>3kv1_A (A:) Transcriptional repressor; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.70A {Vibrio fischeri ES114}Length = 267 Back     alignment and structure
>2gnp_A (A:) Transcriptional regulator; structural genomics, MCSG, APC84799, PSI, protein structure initiative; 1.65A {Streptococcus pneumoniae TIGR4}Length = 266 Back     alignment and structure
>2r5f_A (A:) Transcriptional regulator, putative; transcription regulator, sugar-binding domain, structural genomics, PFAM04198, PSI-2; 2.10A {Pseudomonas syringae PV}Length = 264 Back     alignment and structure
>2w48_A (A:55-315) Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae}Length = 261 Back     alignment and structure
>2okg_A (A:) Central glycolytic gene regulator; alpha/beta/alpha sandwich, rossmann-like fold, structural genomics, PSI-2, protein structure initiative; HET: MSE G3H; 1.65A {Bacillus subtilis}Length = 255 Back     alignment and structure
>3efb_A (A:) Probable SOR-operon regulator; alpha-beta-alpha sandwich, center for structural genomics of infectious diseases, csgid, transcription; HET: MSE; 2.00A {Shigella flexneri 2a str}Length = 266 Back     alignment and structure
>2o0m_A (A:) Transcriptional regulator, SORC family; structural genomics, PSI-2, protein structure initiative; 1.60A {Enterococcus faecalis V583}Length = 345 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target234 6-phosphogluconolactonase [Candidatus Liberibacter asia
3lhi_A_232 Putative 6-phosphogluconolactonase; structural gen 100.0
3css_A_267 6-phosphogluconolactonase; structural genomics, me 100.0
3eb9_A_266 6-phosphogluconolactonase; catalytic mechanism, pe 100.0
1vl1_A_232 6PGL, 6-phosphogluconolactonase; TM1154, structura 100.0
3e15_A_312 Glucose-6-phosphate 1-dehydrogenase; 6-phosphogluc 100.0
3hn6_A_289 Glucosamine-6-phosphate deaminase; niaid, ssgcid, 100.0
1ne7_A_289 Glucosamine-6-phosphate isomerase; V-type like all 100.0
1y89_A_238 DEVB protein; structural genomics, protein structu 100.0
3ico_A_268 6PGL, 6-phosphogluconolactonase; ssgcid, infectiou 100.0
1fs5_A_266 Glucosamine-6-phosphate deaminase; allosteric enzy 100.0
2bkx_A_242 Glucosamine-6-phosphate deaminase; hydrolase, subs 100.0
2ri0_A_234 Glucosamine-6-phosphate deaminase; carbohydrate me 100.0
2w48_A_55-315261 Sorbitol operon regulator; SORC, activator, repres 99.96
2gnp_A_266 Transcriptional regulator; structural genomics, MC 99.96
2r5f_A_264 Transcriptional regulator, putative; transcription 99.96
3efb_A_266 Probable SOR-operon regulator; alpha-beta-alpha sa 99.96
3kv1_A_267 Transcriptional repressor; alpha-beta structure, s 99.95
2o0m_A_345 Transcriptional regulator, SORC family; structural 99.95
2okg_A_255 Central glycolytic gene regulator; alpha/beta/alph 99.94
1ct9_A_200-553 354 Asparagine synthetase B; amidotransferase, substra 92.28
>3lhi_A (A:) Putative 6-phosphogluconolactonase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.33A {Neisseria gonorrhoeae} Back     alignment and structure
Probab=100.00  E-value=0  Score=378.45  Aligned_cols=228  Identities=32%  Similarity=0.487  Sum_probs=209.0

Q ss_pred             CCEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCH
Q ss_conf             72899948989999999999999999999728977999879864699998787630795323899813210035673202
Q gi|254780505|r    3 QYKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIINVDWHKVVVTLVDERFVPLENLRSN   82 (234)
Q Consensus         3 ~~~i~i~~~~~~l~~~~a~~i~~~i~~~i~~~~~~~i~lsGGstp~~~y~~L~~~~~~w~kv~~~~~DER~V~~~~~~Sn   82 (234)
                      ++|+++|+|.+++++.+|++|++.+++.+++++.++|+||||+||..+|+.|++..++|+||+||++||||||.+|++||
T Consensus         2 ~mk~~~~~~~~~~~~~~a~~i~~~i~~~~~~~~~~~i~lsGGstp~~ly~~L~~~~i~w~~v~~f~~DEr~v~~~~~~Sn   81 (232)
T 3lhi_A            2 XFVWHEYENAAEAAQSLADAVADALQGALDEKGGAVLAVSGGRSPIAFFNALSQKDLDWKNVGITLADERIVPTNHADSN   81 (232)
T ss_dssp             CEEEEEESSHHHHHHHHHHHHHHHHHHHHHHHSCEEEEECCSSTTHHHHHHHHTSCCCGGGEEEEESEEESSCTTSTTCH
T ss_pred             CCEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCEECCCCCCHHHH
T ss_conf             72699769999999999999999999999977998999879752999999998747980016999521454798662738


Q ss_pred             HHHHHHHHHCCCCCCCCEEECCCCC--CCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCEEEECCCCCCCEEECCCCC
Q ss_conf             7889997623567763214445887--89899999999999631587764899447887714340278641002215667
Q gi|254780505|r   83 QSFISKFFLQNKAQKASFIPLYYPQ--KTIEEAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHT  160 (234)
Q Consensus        83 ~~~~~~~ll~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~Dl~lLGiG~DGH~ASlFP~~~~l~~~~~~~~  160 (234)
                      +++++++|+++..++..+++.+.+.  .+.+.++..|+..+...  ++||+++||||+||||||||||++.++...++..
T Consensus        82 ~~~~~~~l~~~~~i~~~~i~~~~~~~~~~~~~~~~~~~~~i~~~--~~~Dl~lLGiG~DGHiaslfP~~~~~~~~~~t~~  159 (232)
T 3lhi_A           82 TGLVREYLLKNKAAAAVWIPXVEDGKTETELHPDAVVDYALKHY--KQPDVLILGXGNDGHTASIFPKAPQFQTAIDGSA  159 (232)
T ss_dssp             HHHHHHHTSSGGGGGSEECCSSCTTCCGGGCCHHHHHHHHHHHC--CCCSEEEECCCTTSCBTTBCTTCTTHHHHHCCTT
T ss_pred             HHHHHHHHHCCCCCCHHHEECCCCCCCCHHHHHHHHHHHHHHCC--CCCCEEEECCCCCCCEEECCCCCCHHHHHHCCCC
T ss_conf             99999986147785555500357877606789999999887306--9988899755788744860699804433320156


Q ss_pred             CCCEEEECCCCCCCEEEEECHHHHHCCCEEEEEEECHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCEEEEEC
Q ss_conf             4318995389987215870878884158299998183489999999808983206089996189996899833
Q gi|254780505|r  161 PRSVIAIKDYTSNEQRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHWT  233 (234)
Q Consensus       161 ~~~~~~~~~~~~p~~RITlt~~~l~~a~~i~ll~~G~~K~~al~~~l~~~~~~~~Pas~ll~~~~~~~~V~W~  233 (234)
                      ....+....+.+|++|||||++.|++|++++|+++|++|+.+++++++++ +.++||++++.|+++++.+||.
T Consensus       160 ~~~~~~~~~~~~p~~riTlt~~~l~~A~~i~~~~~G~~K~~~v~~~l~~~-~~~~Pas~l~~~~~~~~~~~~D  231 (232)
T 3lhi_A          160 GVALVHTTPVTAPHERISXTLDAIAHTGHVFLAIQGEEKKAVFDQAAQGE-NREYPISLVLNHQGVNCHVFYA  231 (232)
T ss_dssp             CCCEEEECCSSSSSCEEEECHHHHHTCSEEEEEEESHHHHHHHHHHHTSC-CTTSTHHHHHTSTTCCEEEEEE
T ss_pred             CEEEEECCCCCCCCEEEECCHHHHHHHCEEEEEEECHHHHHHHHHHHHCC-CCCCCHHHHHHCCCCEEEEEEC
T ss_conf             61477327899998579758999995092899998889999999997189-8446288994289975999951



>3css_A (A:) 6-phosphogluconolactonase; structural genomics, medical structural genomics of pathogenic protozoa consortium, SGPP, leishmaniasis; 1.70A {Leishmania braziliensismhom} PDB: 3ch7_A Back     alignment and structure
>3eb9_A (A:) 6-phosphogluconolactonase; catalytic mechanism, pentose phosphate pathway, hydrolase, zinc binding site; HET: FLC; 2.00A {Trypanosoma brucei} PDB: 2j0e_A* 3e7f_A* Back     alignment and structure
>1vl1_A (A:) 6PGL, 6-phosphogluconolactonase; TM1154, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: CIT; 1.55A {Thermotoga maritima} Back     alignment and structure
>3e15_A (A:) Glucose-6-phosphate 1-dehydrogenase; 6-phosphogluconolactonase, malaria, carbohydrate metabolism, glucose metabolism, NADP, oxidoreductase,; HET: MSE; 2.00A {Plasmodium vivax} Back     alignment and structure
>3hn6_A (A:) Glucosamine-6-phosphate deaminase; niaid, ssgcid, decode, UW, SBRI, infectious disease, LYME disease, non-hodgkin lymphomas; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>1ne7_A (A:) Glucosamine-6-phosphate isomerase; V-type like allosteric enzyme, conformational disorder, conformational differences, hydrolase; HET: GLC 16G AGP; 1.75A {Homo sapiens} Back     alignment and structure
>1y89_A (A:) DEVB protein; structural genomics, protein structure initiative, PSI, midwest center for structural genomics, MCSG; HET: 2PE; 2.00A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>3ico_A (A:) 6PGL, 6-phosphogluconolactonase; ssgcid, infectious disease, niaid, hydrolase, structural genomics; 2.15A {Mycobacterium tuberculosis} Back     alignment and structure
>1fs5_A (A:) Glucosamine-6-phosphate deaminase; allosteric enzyme, entropic effects, aldose-ketose isomerase, multiple conformers; HET: 16G TLA; 1.73A {Escherichia coli} Back     alignment and structure
>2bkx_A (A:) Glucosamine-6-phosphate deaminase; hydrolase, substrate inhibition, fructose-6-phosphate; HET: F6R; 1.4A {Bacillus subtilis} PDB: 2bkv_A* Back     alignment and structure
>2ri0_A (A:) Glucosamine-6-phosphate deaminase; carbohydrate metabolism, hydrolase; HET: BTB; 1.60A {Streptococcus mutans} PDB: 2ri1_A* Back     alignment and structure
>2w48_A (A:55-315) Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>2gnp_A (A:) Transcriptional regulator; structural genomics, MCSG, APC84799, PSI, protein structure initiative; 1.65A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>2r5f_A (A:) Transcriptional regulator, putative; transcription regulator, sugar-binding domain, structural genomics, PFAM04198, PSI-2; 2.10A {Pseudomonas syringae PV} Back     alignment and structure
>3efb_A (A:) Probable SOR-operon regulator; alpha-beta-alpha sandwich, center for structural genomics of infectious diseases, csgid, transcription; HET: MSE; 2.00A {Shigella flexneri 2a str} Back     alignment and structure
>3kv1_A (A:) Transcriptional repressor; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.70A {Vibrio fischeri ES114} Back     alignment and structure
>2o0m_A (A:) Transcriptional regulator, SORC family; structural genomics, PSI-2, protein structure initiative; 1.60A {Enterococcus faecalis V583} Back     alignment and structure
>2okg_A (A:) Central glycolytic gene regulator; alpha/beta/alpha sandwich, rossmann-like fold, structural genomics, PSI-2, protein structure initiative; HET: MSE G3H; 1.65A {Bacillus subtilis} Back     alignment and structure
>1ct9_A (A:200-553) Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis; HET: AMP GLN; 2.00A {Escherichia coli} Back     alignment and structure