254780506

254780506

methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein

GeneID in NCBI database:8209501Locus tag:CLIBASIA_01965
Protein GI in NCBI database:254780506Protein Accession:YP_003064919.1
Gene range:+(769318, 770238)Protein Length:306aa
Gene description:methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
COG prediction:[H] 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase
KEGG prediction:folD; methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein; K01491 methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
SEED prediction:Methylenetetrahydrofolate dehydrogenase (NADP+) (EC 1.5.1.5) / Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)
Pathway involved in KEGG:Glyoxylate and dicarboxylate metabolism [PATH:las00630]
One carbon pool by folate [PATH:las00670]
Subsystem involved in SEED:One-carbon metabolism by tetrahydropterines;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQSIAKKTI
ccEEEcHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHccHHHccccccHHHHHHHHccccccccccccHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHccccEEEEEEcccccHHHHHHHccEEEEcccccccccHHHcccccEEEEcccccccccccccccEEccccHHHHHHccEEccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccc
cccEEcHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHccccccccccccccccHccccccccccccccHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHcccEEEEEccccccHHHHHccccEEEEcccccccEcHHHcccccEEEEcccEEEccccccEEEEccEcHHHHcccccEEcccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEcccccc
MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVgndpascsyvsaktrmakhcgfhsvqynfpvdisqIDLENAVlslnkddsihgilvqlplpstvseQSIIQSivpekdvdglhvvNAGKVMigdfttglvpctpaGAILLIEQFkgcdlsgqhAVVIGRsnlfgkpmgqlllsrNATVTMAhsktknlpeicRTADILVVAvgrprmvqvdWIKTGSLVIDVginrinspqlgktvlVGDVADECKSVVgaitpvpggvgpMTIAMLMANTVIAAYRSlgmkspkfdaqsiakkti
mgslidgkvVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHsktknlpeicrTADILVVAVGRPRMVQVDWIKTGSLVIDVGINrinspqlgkTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGmkspkfdaqsiakkti
MGSLIDGKVVASVLTDKIAESVAFLKKETgvqvglavvlvgNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQSIAKKTI
MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQSIAKK**
MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK***********
MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQSIAKKT*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQSIAKKTI
MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQSIAKKTI
MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQSIAKKTI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target306 methylenetetrahydrofolate dehydrogenase/cyclohydrolase
315122297306 methylenetetrahydrofolate dehydrogenase/cyclohydrolase 1 1e-140
222084900299 methylenetetrahydrofolate dehydrogenase/cyclohydrolase 1 1e-105
150395517299 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 1 1e-105
227820889299 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 1 1e-104
222081892304 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 1 1e-104
163758052299 probable bifunctional protein : methylenetetrahydrofola 1 1e-103
222082166304 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 1 1e-103
15964446299 bifunctional methylenetetrahydrofolate dehydrogenase/me 1 1e-103
241203139299 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 1 1e-103
307318943299 Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium 1 1e-103
>gi|315122297|ref|YP_004062786.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 306 Back     alignment and organism information
 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 238/306 (77%), Positives = 275/306 (89%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MGSLIDGK +AS LT KIAESV  L+++TG+QVGLAV+LVGNDPAS SYVSAK  MAK C
Sbjct: 1   MGSLIDGKSIASALTKKIAESVTLLRQKTGIQVGLAVILVGNDPASSSYVSAKKSMAKSC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQYNF +DISQ +L+  +L LN+DD+IHGIL+QLPLPST+S++ +IQSI PEKDVD
Sbjct: 61  GFHSVQYNFSIDISQDELKKTILELNQDDAIHGILLQLPLPSTLSDRFLIQSIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLH+VNAGK+MIGDFTTGL+ CTPAGAILLIE+FKG DLSGQHAVVIGRSNLFGKPMGQL
Sbjct: 121 GLHIVNAGKLMIGDFTTGLISCTPAGAILLIEKFKGSDLSGQHAVVIGRSNLFGKPMGQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+RNATVTMAHSKTKNLPEICR ADILVVAVG+P MV+ DWIKTGSL+IDVGINRIN  
Sbjct: 181 LLARNATVTMAHSKTKNLPEICRMADILVVAVGQPYMVKADWIKTGSLIIDVGINRINCS 240

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQS 300
           ++GK++LVGDVA EC+S+ GAITPVPGGVGPMTIAMLMANTVIAAYR  G++ P+FDA  
Sbjct: 241 KVGKSILVGDVAVECQSIAGAITPVPGGVGPMTIAMLMANTVIAAYRFAGLEIPQFDAHL 300

Query: 301 IAKKTI 306
           + KK++
Sbjct: 301 LEKKSV 306


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084900|ref|YP_002543429.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein [Agrobacterium radiobacter K84] Length = 299 Back     alignment and organism information
>gi|150395517|ref|YP_001325984.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [Sinorhizobium medicae WSM419] Length = 299 Back     alignment and organism information
>gi|227820889|ref|YP_002824859.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [Sinorhizobium fredii NGR234] Length = 299 Back     alignment and organism information
>gi|222081892|ref|YP_002541257.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [Agrobacterium radiobacter K84] Length = 304 Back     alignment and organism information
>gi|163758052|ref|ZP_02165140.1| probable bifunctional protein : methylenetetrahydrofolate dehydrogenase ; methenyltetrahydrofolate cyclohydrolase [Hoeflea phototrophica DFL-43] Length = 299 Back     alignment and organism information
>gi|222082166|ref|YP_002541531.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [Agrobacterium radiobacter K84] Length = 304 Back     alignment and organism information
>gi|15964446|ref|NP_384799.1| bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [Sinorhizobium meliloti 1021] Length = 299 Back     alignment and organism information
>gi|241203139|ref|YP_002974235.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 299 Back     alignment and organism information
>gi|307318943|ref|ZP_07598374.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium meliloti AK83] Length = 299 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target306 methylenetetrahydrofolate dehydrogenase/cyclohydrolase
PRK14188296 PRK14188, PRK14188, bifunctional 5,10-methylene-tetrahy 1e-123
PRK14190284 PRK14190, PRK14190, bifunctional 5,10-methylene-tetrahy 8e-96
PRK14179284 PRK14179, PRK14179, bifunctional 5,10-methylene-tetrahy 7e-86
PRK14189285 PRK14189, PRK14189, bifunctional 5,10-methylene-tetrahy 3e-85
PRK10792285 PRK10792, PRK10792, bifunctional 5,10-methylene-tetrahy 4e-82
PRK14194301 PRK14194, PRK14194, bifunctional 5,10-methylene-tetrahy 1e-81
PRK14186297 PRK14186, PRK14186, bifunctional 5,10-methylene-tetrahy 4e-81
PRK14187294 PRK14187, PRK14187, bifunctional 5,10-methylene-tetrahy 1e-79
PRK14191285 PRK14191, PRK14191, bifunctional 5,10-methylene-tetrahy 1e-78
KOG4230 935 KOG4230, KOG4230, KOG4230, C1-tetrahydrofolate synthase 4e-78
PRK14184286 PRK14184, PRK14184, bifunctional 5,10-methylene-tetrahy 1e-74
PRK14168297 PRK14168, PRK14168, bifunctional 5,10-methylene-tetrahy 3e-74
PRK14193284 PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahy 6e-73
PRK14176287 PRK14176, PRK14176, bifunctional 5,10-methylene-tetrahy 4e-70
PRK14170284 PRK14170, PRK14170, bifunctional 5,10-methylene-tetrahy 2e-69
PRK14174295 PRK14174, PRK14174, bifunctional 5,10-methylene-tetrahy 2e-69
PRK14183281 PRK14183, PRK14183, bifunctional 5,10-methylene-tetrahy 2e-68
PRK14167297 PRK14167, PRK14167, bifunctional 5,10-methylene-tetrahy 4e-67
PLN02616364 PLN02616, PLN02616, tetrahydrofolate dehydrogenase/cycl 4e-67
PLN02516299 PLN02516, PLN02516, methylenetetrahydrofolate dehydroge 3e-66
KOG0089309 KOG0089, KOG0089, KOG0089, Methylenetetrahydrofolate de 1e-65
PRK14169282 PRK14169, PRK14169, bifunctional 5,10-methylene-tetrahy 1e-65
PRK14178279 PRK14178, PRK14178, bifunctional 5,10-methylene-tetrahy 2e-65
PRK14185293 PRK14185, PRK14185, bifunctional 5,10-methylene-tetrahy 5e-65
PRK14181287 PRK14181, PRK14181, bifunctional 5,10-methylene-tetrahy 9e-65
PRK14175286 PRK14175, PRK14175, bifunctional 5,10-methylene-tetrahy 6e-64
PRK14166282 PRK14166, PRK14166, bifunctional 5,10-methylene-tetrahy 9e-64
PRK14172278 PRK14172, PRK14172, bifunctional 5,10-methylene-tetrahy 1e-63
PRK14182282 PRK14182, PRK14182, bifunctional 5,10-methylene-tetrahy 1e-61
PLN02897345 PLN02897, PLN02897, tetrahydrofolate dehydrogenase/cycl 3e-60
PRK14171288 PRK14171, PRK14171, bifunctional 5,10-methylene-tetrahy 4e-60
PRK14192283 PRK14192, PRK14192, bifunctional 5,10-methylene-tetrahy 6e-60
PRK14180282 PRK14180, PRK14180, bifunctional 5,10-methylene-tetrahy 9e-57
PRK14177284 PRK14177, PRK14177, bifunctional 5,10-methylene-tetrahy 1e-56
COG0190283 COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrog 7e-96
PRK14173287 PRK14173, PRK14173, bifunctional 5,10-methylene-tetrahy 3e-76
cd01080168 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domai 2e-61
pfam02882159 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydrogenas 4e-61
cd05212140 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) bindin 2e-23
cd01079197 cd01079, NAD_bind_m-THF_DH, NAD binding domain of methy 9e-07
pfam00763117 pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydrogenase/ 1e-36
>gnl|CDD|184558 PRK14188, PRK14188, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184560 PRK14190, PRK14190, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184554 PRK14179, PRK14179, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184559 PRK14189, PRK14189, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|182735 PRK10792, PRK10792, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172682 PRK14194, PRK14194, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184557 PRK14186, PRK14186, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172675 PRK14187, PRK14187, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172679 PRK14191, PRK14191, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|39431 KOG4230, KOG4230, KOG4230, C1-tetrahydrofolate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|172672 PRK14184, PRK14184, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172656 PRK14168, PRK14168, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184562 PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184553 PRK14176, PRK14176, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172658 PRK14170, PRK14170, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172662 PRK14174, PRK14174, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184555 PRK14183, PRK14183, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184549 PRK14167, PRK14167, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|178225 PLN02616, PLN02616, tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>gnl|CDD|178131 PLN02516, PLN02516, methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>gnl|CDD|35312 KOG0089, KOG0089, KOG0089, Methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|184550 PRK14169, PRK14169, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172666 PRK14178, PRK14178, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184556 PRK14185, PRK14185, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172669 PRK14181, PRK14181, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184552 PRK14175, PRK14175, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172654 PRK14166, PRK14166, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172660 PRK14172, PRK14172, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172670 PRK14182, PRK14182, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|178485 PLN02897, PLN02897, tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>gnl|CDD|172659 PRK14171, PRK14171, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184561 PRK14192, PRK14192, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172668 PRK14180, PRK14180, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172665 PRK14177, PRK14177, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|30539 COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184551 PRK14173, PRK14173, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>gnl|CDD|145831 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain Back     alignment and domain information
>gnl|CDD|133451 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>gnl|CDD|133447 cd01079, NAD_bind_m-THF_DH, NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>gnl|CDD|144385 pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 306 methylenetetrahydrofolate dehydrogenase/cyclohydrolase
PRK10792288 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 100.0
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Meth 100.0
KOG4230 935 consensus 100.0
KOG0089309 consensus 100.0
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methy 100.0
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 100.0
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene-tetra 100.0
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o 100.0
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 98.54
pfam00763117 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrola 100.0
PRK09526342 lacI lac repressor; Reviewed 90.53
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.77
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 98.15
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.03
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 97.98
PRK12550272 shikimate 5-dehydrogenase; Reviewed 97.85
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.67
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 97.64
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 97.14
PRK13243333 glyoxylate reductase; Reviewed 97.12
PRK06487317 glycerate dehydrogenase; Provisional 97.06
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 96.5
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 94.63
pfam05221430 AdoHcyase S-adenosyl-L-homocysteine hydrolase. 98.52
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycas 98.52
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 98.5
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 98.48
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 98.45
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of amino a 98.43
PTZ00075476 S-adenosyl-L-homocysteine hydrolase; Provisional 98.42
PRK05476427 S-adenosyl-L-homocysteine hydrolase; Provisional 98.41
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 98.32
PRK13940414 glutamyl-tRNA reductase; Provisional 98.28
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabol 97.97
TIGR00936422 ahcY adenosylhomocysteinase; InterPro: IPR000043 S-aden 97.84
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 97.69
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 97.6
KOG1370434 consensus 97.45
pfam02423312 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin 97.44
PRK06823315 ornithine cyclodeaminase; Validated 97.17
PRK08291330 ornithine cyclodeaminase; Validated 97.13
PRK12480330 D-lactate dehydrogenase; Provisional 96.83
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.82
PRK06436303 glycerate dehydrogenase; Provisional 96.78
PRK06141313 ornithine cyclodeaminase; Validated 96.78
KOG0069336 consensus 96.73
PRK07589346 ornithine cyclodeaminase; Validated 96.58
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 96.43
PRK06407302 ornithine cyclodeaminase; Provisional 96.35
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 96.13
PRK06046326 alanine dehydrogenase; Validated 95.97
PRK08618325 ornithine cyclodeaminase; Validated 95.92
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 95.67
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate dehydrog 95.62
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transport and 95.52
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 95.49
PRK06719157 precorrin-2 dehydrogenase; Validated 95.44
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 95.34
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.33
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelat 95.15
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 95.06
PRK07340304 ornithine cyclodeaminase; Validated 95.06
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin homol 94.86
COG2085211 Predicted dinucleotide-binding enzymes [General functio 94.84
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 94.65
PRK06124259 gluconate 5-dehydrogenase; Provisional 94.46
PRK05579392 bifunctional phosphopantothenoylcysteine decarboxylase/ 94.39
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 94.32
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 94.24
KOG0409 327 consensus 94.12
KOG1494 345 consensus 93.85
PRK08703239 short chain dehydrogenase; Provisional 93.65
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 93.63
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.58
PRK12829264 short chain dehydrogenase; Provisional 93.46
PRK12742237 oxidoreductase; Provisional 93.46
PRK07060245 short chain dehydrogenase; Provisional 93.41
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.34
PRK12367250 short chain dehydrogenase; Provisional 93.26
PRK09564 443 coenzyme A disulfide reductase; Reviewed 93.22
PRK07890258 short chain dehydrogenase; Provisional 92.98
pfam03949255 Malic_M Malic enzyme, NAD binding domain. 92.87
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 92.85
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of malic enz 92.66
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 92.66
PRK06138252 short chain dehydrogenase; Provisional 92.64
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 92.64
PRK08628258 short chain dehydrogenase; Provisional 92.64
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 92.56
PRK12828239 short chain dehydrogenase; Provisional 92.55
PRK09496455 trkA potassium transporter peripheral membrane componen 92.52
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 92.52
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 92.4
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 92.26
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 92.25
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 92.07
PRK06841255 short chain dehydrogenase; Provisional 91.65
PRK06346251 consensus 91.57
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.52
PRK06194301 hypothetical protein; Provisional 91.28
PRK13771332 putative alcohol dehydrogenase; Provisional 91.25
TIGR01772 379 MDH_euk_gproteo malate dehydrogenase, NAD-dependent; In 91.24
PRK05876275 short chain dehydrogenase; Provisional 91.0
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 90.77
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 90.48
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 90.45
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 90.25
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 98.21
COG5322351 Predicted dehydrogenase [General function prediction on 96.92
PRK06932314 glycerate dehydrogenase; Provisional 96.72
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 96.19
TIGR02992326 ectoine_eutC ectoine utilization protein EutC; InterPro 94.46
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.01
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 92.03
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 98.17
PRK08605332 D-lactate dehydrogenase; Validated 97.1
PRK07232 753 malic enzyme; Reviewed 95.85
PRK12862 761 malic enzyme; Reviewed 95.82
COG0281432 SfcA Malic enzyme [Energy production and conversion] 95.74
PRK07200395 aspartate/ornithine carbamoyltransferase family protein 95.39
PRK12861 762 malic enzyme; Reviewed 94.6
PRK06949258 short chain dehydrogenase; Provisional 94.33
PRK06500249 short chain dehydrogenase; Provisional 94.14
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 93.88
PRK06125259 short chain dehydrogenase; Provisional 93.81
PRK12939250 short chain dehydrogenase; Provisional 93.67
PRK07097265 gluconate 5-dehydrogenase; Provisional 93.44
PRK08862227 short chain dehydrogenase; Provisional 93.38
PRK06172253 short chain dehydrogenase; Provisional 93.07
PRK07523251 gluconate 5-dehydrogenase; Provisional 93.03
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 92.42
PRK07479252 consensus 91.71
PRK07067256 sorbitol dehydrogenase; Provisional 90.96
PRK06227256 consensus 90.8
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 90.43
PRK06139324 short chain dehydrogenase; Provisional 90.11
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 98.15
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 97.82
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 97.82
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 97.41
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 97.38
PRK09424 510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 97.3
PRK07574385 formate dehydrogenase; Provisional 96.42
PRK11559295 garR tartronate semialdehyde reductase; Provisional 96.26
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.6
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 94.66
TIGR01692 290 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IP 90.11
PRK03515334 ornithine carbamoyltransferase subunit I; Provisional 97.58
PRK01713334 ornithine carbamoyltransferase; Provisional 97.32
PRK02102331 ornithine carbamoyltransferase; Validated 97.29
PRK04284332 ornithine carbamoyltransferase; Provisional 96.82
PRK08192338 aspartate carbamoyltransferase; Provisional 94.79
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid transpo 94.77
TIGR00658341 orni_carb_tr ornithine carbamoyltransferase; InterPro: 94.48
PRK12562334 ornithine carbamoyltransferase subunit F; Provisional 97.34
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members of thi 97.09
PRK02255341 putrescine carbamoyltransferase; Provisional 97.08
PRK00779308 ornithine carbamoyltransferase; Provisional 96.46
PRK00856304 pyrB aspartate carbamoyltransferase catalytic subunit; 96.39
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 95.11
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subunit; 93.57
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.87
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.06
PRK01390 457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.03
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.93
PRK04965378 nitric oxide reductase; Provisional 95.71
PRK08655 441 prephenate dehydrogenase; Provisional 95.36
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.28
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.15
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.09
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.09
PRK06545357 prephenate dehydrogenase; Validated 95.0
PRK07502307 cyclohexadienyl dehydrogenase; Validated 95.0
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 94.99
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.95
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 94.52
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 94.1
PRK12428 261 3-alpha-hydroxysteroid dehydrogenase; Provisional 93.73
PRK06720169 hypothetical protein; Provisional 93.47
PRK08818 373 prephenate dehydrogenase; Provisional 93.32
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.13
PRK07201 663 short chain dehydrogenase; Provisional 92.02
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 91.87
KOG0725 270 consensus 91.33
PTZ00082322 L-lactate dehydrogenase; Provisional 91.25
PRK06701289 short chain dehydrogenase; Provisional 91.03
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 90.85
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.14
PRK06199379 ornithine cyclodeaminase; Validated 96.74
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 95.25
PRK08339263 short chain dehydrogenase; Provisional 94.3
PRK07041240 short chain dehydrogenase; Provisional 94.27
PRK05867253 short chain dehydrogenase; Provisional 94.19
PRK07062265 short chain dehydrogenase; Provisional 94.13
PRK08277278 D-mannonate oxidoreductase; Provisional 94.11
PRK08213259 gluconate 5-dehydrogenase; Provisional 94.01
PRK05866290 short chain dehydrogenase; Provisional 93.99
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.92
PRK07035252 short chain dehydrogenase; Provisional 93.61
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.57
PRK08945245 short chain dehydrogenase; Provisional 93.52
PRK07776252 consensus 93.43
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 93.18
PRK12744257 short chain dehydrogenase; Provisional 93.11
PRK06114262 short chain dehydrogenase; Provisional 93.11
PRK09242258 tropinone reductase; Provisional 93.11
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 93.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 92.9
PRK09072262 short chain dehydrogenase; Provisional 92.86
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of malic enz 92.36
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 92.29
PRK07478254 short chain dehydrogenase; Provisional 92.05
PRK05872296 short chain dehydrogenase; Provisional 91.9
PRK07063259 short chain dehydrogenase; Provisional 91.86
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 91.77
PRK08085254 gluconate 5-dehydrogenase; Provisional 91.75
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.66
PRK07326235 short chain dehydrogenase; Provisional 91.38
PRK12935247 acetoacetyl-CoA reductase; Provisional 91.13
PRK06057255 short chain dehydrogenase; Provisional 91.08
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 90.95
PRK08264235 short chain dehydrogenase; Validated 90.88
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.88
PRK06523260 short chain dehydrogenase; Provisional 90.81
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.67
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic enzym 90.65
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 90.6
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 90.26
PRK12937245 short chain dehydrogenase; Provisional 90.08
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 96.57
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 95.44
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 93.24
PTZ00142 474 6-phosphogluconate dehydrogenase; Provisional 92.29
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 94.47
PRK07576260 short chain dehydrogenase; Provisional 94.18
PRK07774250 short chain dehydrogenase; Provisional 93.9
PRK07814263 short chain dehydrogenase; Provisional 93.75
PRK09186255 flagellin modification protein A; Provisional 93.73
PRK05875277 short chain dehydrogenase; Provisional 93.52
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 92.61
PRK08265261 short chain dehydrogenase; Provisional 92.43
PRK06196316 oxidoreductase; Provisional 92.22
PRK05717255 oxidoreductase; Validated 91.98
PRK07806248 short chain dehydrogenase; Provisional 91.65
PRK07677254 short chain dehydrogenase; Provisional 91.09
PRK08936261 glucose-1-dehydrogenase; Provisional 90.5
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 90.33
PRK12746254 short chain dehydrogenase; Provisional 90.2
PRK08278273 short chain dehydrogenase; Provisional 90.12
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.96
PRK12439340 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; P 92.23
PRK10637 457 cysG siroheme synthase; Provisional 90.84
PTZ00079469 NADP-specific glutamate dehydrogenase; Provisional 93.78
PRK07417280 arogenate dehydrogenase; Reviewed 93.78
PRK09414446 glutamate dehydrogenase; Provisional 93.53
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Ami 92.46
KOG1504346 consensus 91.03
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 93.3
PRK12827251 short chain dehydrogenase; Provisional 91.35
PRK07825273 short chain dehydrogenase; Provisional 92.45
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Energy pr 92.0
PRK07856254 short chain dehydrogenase; Provisional 92.12
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>KOG4230 consensus Back     alignment and domain information
>KOG0089 consensus Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>pfam02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215 This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium Back     alignment and domain information
>pfam00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The shikimate pathway links the metabolism of carbohydrates to the biosynthesis of aromatic compounds and is essential for the biosynthesis of aromatic amino acids and other aromatic compounds in bacteria, eukaryotic microorganisms and plants Back     alignment and domain information
>pfam05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>pfam00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PTZ00075 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase; InterPro: IPR000043 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>pfam01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>KOG1370 consensus Back     alignment and domain information
>pfam02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08291 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG0069 consensus Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>KOG0409 consensus Back     alignment and domain information
>KOG1494 consensus Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>pfam03949 Malic_M Malic enzyme, NAD binding domain Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06346 consensus Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent; InterPro: IPR010097 This entry represents the NAD-dependent malate dehydrogenase found in eukaryotes and certain gamma proteobacteria Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC; InterPro: IPR014334 Members of this entry are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, Pseudomonas putida and Sinorhizobium meliloti 1021, where it is known to be induced by ectoine) Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric; InterPro: IPR006004 One pathway for the assimilation of ammonia and glutamate biosynthesis involves homotetrameric glutamate synthase (1 Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK07232 malic enzyme; Reviewed Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07479 consensus Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06227 consensus Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IPR011548 3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase; InterPro: IPR002292 The ornithine carbamoyltransferases are a family of enzymes that catalyse the production of citrulline from carbamoyl-phosphate and ornithine Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back