254780507

254780507

hypothetical protein CLIBASIA_01970

GeneID in NCBI database:8209502Locus tag:CLIBASIA_01970
Protein GI in NCBI database:254780507Protein Accession:YP_003064920.1
Gene range:+(768513, 769043)Protein Length:176aa
Gene description:hypothetical protein
COG prediction:[O] Chaperonin GroEL (HSP60 family)
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MLKFLFSGIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASDLMTQKGSLIEKNKEPLK
cHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHcccEEEEEEEEcccEEEcccEEEEEEEEEEEEEccHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHccHHHHccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcccEEEEcEEEEEEEEccccEEEEEEEEEEEEEcHHHccccHHHHHHHHHHHHHHcccccccccccEccHHHHHHHHHHHHHHHHccccHHHHHHHcccEEcHHHHHHHHHcccccHHHHHHccccHHHccccccc
MLKFLFSGIWISVVTLISFYMLFLRSMDTMvenhvpplaikntnIIKSELVsipsvsngVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTllsgppmgdfvqikafgfDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSnclrlgsnasdlmtqkgslieknkeplk
mlkflfsgIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDlnsrlgsqfISEVLIDELNYLSIVDMRSNCLRLGSNasdlmtqkgslieknkeplk
MLKFLFSGIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASDLMTQKGSLIEKNKEPLK
MLKFLFSGIWISVVTLISFYMLF**********************IKSELVSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIV********************************
MLKFLFSGIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASDLMTQKGSLIEKNKEPLK
MLKFLFSGIWISVVTLISFYMLFLRSMDTMV*NHVPPLAIKNTNIIKSELVSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASD***QKGSLIEK******
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKFLFSGIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASDLMTQKGSLIEKNKEPLK
MLKFLFSGIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASDLMTQKGSLIEKNKEPLK
MLKFLFSGIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGVLQAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDLNSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASDLMTQKGSLIEKNKEPLK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target176 hypothetical protein CLIBASIA_01970 [Candidatus Liberib
315122296191 hypothetical protein CKC_02740 [Candidatus Liberibacter 1 4e-61
163758044185 hypothetical protein HPDFL43_00425 [Hoeflea phototrophi 1 1e-19
190890394179 hypothetical protein RHECIAT_CH0000769 [Rhizobium etli 1 3e-18
218509489179 hypothetical protein RetlB5_19254 [Rhizobium etli Brasi 1 5e-18
209547958179 hypothetical protein Rleg2_0350 [Rhizobium leguminosaru 1 9e-18
110632628161 hypothetical protein Meso_0267 [Mesorhizobium sp. BNC1] 1 2e-17
116250512179 transmembrane protein [Rhizobium leguminosarum bv. vici 1 2e-17
241203136179 hypothetical protein Rleg_0382 [Rhizobium leguminosarum 1 3e-17
86356342179 hypothetical protein RHE_CH00691 [Rhizobium etli CFN 42 1 4e-17
222084897178 hypothetical protein Arad_0927 [Agrobacterium radiobact 1 4e-17
>gi|315122296|ref|YP_004062785.1| hypothetical protein CKC_02740 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 191 Back     alignment and organism information
 Score =  237 bits (605), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 113/172 (65%), Positives = 140/172 (81%)

Query: 2   LKFLFSGIWISVVTLISFYMLFLRSMDTMVENHVPPLAIKNTNIIKSELVSIPSVSNGVL 61
           ++F FSGIWIS++T+ SFY+LFLRS+D  +E+  P    ++ ++I  ELV+IPS+SNG+L
Sbjct: 17  VEFFFSGIWISIITIASFYILFLRSVDPQIESSKPLTTEQSIHMITGELVAIPSISNGIL 76

Query: 62  QAYFLVKLSFIVNDSQERSYLKEIATDYLYTLLSGPPMGDFVQIKAFGFDNLRKKIKEDL 121
           QAYF VKLSFIVND Q + YLKEI+TDYLYTLLSGPPMGD VQIK+FG DN RKKIKEDL
Sbjct: 77  QAYFFVKLSFIVNDRQSKYYLKEISTDYLYTLLSGPPMGDIVQIKSFGMDNFRKKIKEDL 136

Query: 122 NSRLGSQFISEVLIDELNYLSIVDMRSNCLRLGSNASDLMTQKGSLIEKNKE 173
           N +LGSQFIS+VLI+ELNYLSI D+R NC  L    S+LM QK SL++K K+
Sbjct: 137 NLKLGSQFISDVLINELNYLSIADIRLNCFHLSDKESNLMAQKKSLLDKAKD 188


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163758044|ref|ZP_02165132.1| hypothetical protein HPDFL43_00425 [Hoeflea phototrophica DFL-43] Length = 185 Back     alignment and organism information
>gi|190890394|ref|YP_001976936.1| hypothetical protein RHECIAT_CH0000769 [Rhizobium etli CIAT 652] Length = 179 Back     alignment and organism information
>gi|218509489|ref|ZP_03507367.1| hypothetical protein RetlB5_19254 [Rhizobium etli Brasil 5] Length = 179 Back     alignment and organism information
>gi|209547958|ref|YP_002279875.1| hypothetical protein Rleg2_0350 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 179 Back     alignment and organism information
>gi|110632628|ref|YP_672836.1| hypothetical protein Meso_0267 [Mesorhizobium sp. BNC1] Length = 161 Back     alignment and organism information
>gi|116250512|ref|YP_766350.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 179 Back     alignment and organism information
>gi|241203136|ref|YP_002974232.1| hypothetical protein Rleg_0382 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 179 Back     alignment and organism information
>gi|86356342|ref|YP_468234.1| hypothetical protein RHE_CH00691 [Rhizobium etli CFN 42] Length = 179 Back     alignment and organism information
>gi|222084897|ref|YP_002543426.1| hypothetical protein Arad_0927 [Agrobacterium radiobacter K84] Length = 178 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 176 hypothetical protein CLIBASIA_01970 [Candidatus Liberib
PRK12785167 fliL flagellar basal body-associated protein FliL; Revi 99.88
PRK07021159 fliL flagellar basal body-associated protein FliL; Revi 99.86
pfam03748145 FliL Flagellar basal body-associated protein FliL. This 99.84
PRK07718142 fliL flagellar basal body-associated protein FliL; Revi 99.83
PRK05696168 fliL flagellar basal body-associated protein FliL; Revi 99.81
COG1580159 FliL Flagellar basal body-associated protein [Cell moti 99.74
PRK08455180 fliL flagellar basal body-associated protein FliL; Revi 99.82
PRK05697135 flagellar basal body-associated protein FliL-like prote 99.56
PRK06654177 fliL flagellar basal body-associated protein FliL; Revi 98.68
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>pfam03748 FliL Flagellar basal body-associated protein FliL Back     alignment and domain information
>PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>COG1580 FliL Flagellar basal body-associated protein [Cell motility and secretion] Back     alignment and domain information
>PRK08455 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK05697 flagellar basal body-associated protein FliL-like protein; Validated Back     alignment and domain information
>PRK06654 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00