254780508

254780508

hypothetical protein CLIBASIA_01975

GeneID in NCBI database:8209503Locus tag:CLIBASIA_01975
Protein GI in NCBI database:254780508Protein Accession:YP_003064921.1
Gene range:+(767996, 768367)Protein Length:123aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MSTSSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPCKTTT
ccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccccc
cccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
MSTSSDYRIQTVLKRVIAVIDNenknlknnsqfdisisndhkgrcLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQeidadgtyhdgfceslnpckttt
mstssdyriqTVLKRVIAVIDnenknlknnsqFDISISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEidadgtyhdgfceslnpckttt
MSTSSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPCKTTT
******Y**QTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPC****
MSTSSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPCKTTT
****SDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPC****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTSSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPCKTTT
MSTSSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPCKTTT
MSTSSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPCKTTT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target123 hypothetical protein CLIBASIA_01975 [Candidatus Liberib
315122295123 hypothetical protein CKC_02735 [Candidatus Liberibacter 1 9e-44
325291973122 hypothetical protein AGROH133_04008 [Agrobacterium sp. 1 6e-23
159184376122 hypothetical protein Atu0585 [Agrobacterium tumefaciens 1 1e-22
86356341121 hypothetical protein RHE_CH00690 [Rhizobium etli CFN 42 1 3e-22
116250511144 hypothetical protein RL0739 [Rhizobium leguminosarum bv 1 3e-22
327193071143 hypothetical protein RHECNPAF_1760072 [Rhizobium etli C 1 3e-22
222147600121 hypothetical protein Avi_0777 [Agrobacterium vitis S4] 1 4e-22
218463242121 hypothetical protein RetlK5_29129 [Rhizobium etli Kim 5 1 4e-22
190890393121 hypothetical protein RHECIAT_CH0000768 [Rhizobium etli 1 4e-22
241203135121 hypothetical protein Rleg_0381 [Rhizobium leguminosarum 1 4e-22
>gi|315122295|ref|YP_004062784.1| hypothetical protein CKC_02735 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 123 Back     alignment and organism information
 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 101/121 (83%)

Query: 1   MSTSSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEIS 60
           MST +DYRIQTVLKRVI VIDNENKNLK N QFDIS SND+KGRCLHELSV ++SC+ IS
Sbjct: 1   MSTLNDYRIQTVLKRVIEVIDNENKNLKTNKQFDISASNDNKGRCLHELSVFLISCKYIS 60

Query: 61  WDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPCK 120
            DH EQIR L EKLALNSSLLESYL+AARVVADLFKK+LQ+ID DGTY +G     +  K
Sbjct: 61  CDHSEQIRILQEKLALNSSLLESYLNAARVVADLFKKRLQDIDTDGTYSNGCSGFFDTSK 120

Query: 121 T 121
           T
Sbjct: 121 T 121


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325291973|ref|YP_004277837.1| hypothetical protein AGROH133_04008 [Agrobacterium sp. H13-3] Length = 122 Back     alignment and organism information
>gi|159184376|ref|NP_353611.2| hypothetical protein Atu0585 [Agrobacterium tumefaciens str. C58] Length = 122 Back     alignment and organism information
>gi|86356341|ref|YP_468233.1| hypothetical protein RHE_CH00690 [Rhizobium etli CFN 42] Length = 121 Back     alignment and organism information
>gi|116250511|ref|YP_766349.1| hypothetical protein RL0739 [Rhizobium leguminosarum bv. viciae 3841] Length = 144 Back     alignment and organism information
>gi|327193071|gb|EGE59983.1| hypothetical protein RHECNPAF_1760072 [Rhizobium etli CNPAF512] Length = 143 Back     alignment and organism information
>gi|222147600|ref|YP_002548557.1| hypothetical protein Avi_0777 [Agrobacterium vitis S4] Length = 121 Back     alignment and organism information
>gi|218463242|ref|ZP_03503333.1| hypothetical protein RetlK5_29129 [Rhizobium etli Kim 5] Length = 121 Back     alignment and organism information
>gi|190890393|ref|YP_001976935.1| hypothetical protein RHECIAT_CH0000768 [Rhizobium etli CIAT 652] Length = 121 Back     alignment and organism information
>gi|241203135|ref|YP_002974231.1| hypothetical protein Rleg_0381 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 121 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 123 hypothetical protein CLIBASIA_01975 [Candidatus Liberib
pfam05130140 FlgN FlgN protein. This family includes the FlgN protei 96.97
>pfam05130 FlgN FlgN protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target123 hypothetical protein CLIBASIA_01975 [Candidatus Liberib
3opc_A154 Uncharacterized protein; structural genomics, PSI-2, pr 95.28
2fup_A157 Hypothetical protein PA3352; structural genomics, PSI, 93.83
>3opc_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, chaperone; HET: MSE; 2.09A {Bordetella pertussis} Back     alignment and structure
Probab=95.28  E-value=0.075  Score=30.94  Aligned_cols=91  Identities=11%  Similarity=0.120  Sum_probs=70.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCC-HHHHHHHHHHHHHHHHHHHCCH----HH---------------CCH-------
Q ss_conf             99999999999999999985178888-7998987778999999982499----88---------------196-------
Q gi|254780508|r    9 IQTVLKRVIAVIDNENKNLKNNSQFD-ISISNDHKGRCLHELSVLILSC----EE---------------ISW-------   61 (123)
Q Consensus         9 i~s~i~RLe~vId~Et~aL~~~~~~D-l~e~N~rKSr~LlELtrl~r~~----~~---------------~~~-------   61 (123)
                      -..++..|..+++.|..+|..+..+| |...+..|..-+-.+..+-+..    ..               ..+       
T Consensus        16 e~~~~~~L~~lL~~E~~aL~~~~~~~~L~~l~~~K~~ll~~l~~~~~~R~~~l~~~g~~~~~~~~~~~~~~~~~l~~~w~   95 (154)
T 3opc_A           16 ENALVVEFLHALEAETEALMDRRAHESLQAAVQRKETLADDLAQLGAERDALLSGAGLASGPAGTDAAAAAHPELGPLWQ   95 (154)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSHHHHHHHHHHHCGGGHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCHHHHHHHH
T ss_conf             99999999999999999987399769999999999999999999999999999981899871245532004699999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             77999999999999999999999999999999999999
Q gi|254780508|r   62 DHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQL   99 (123)
Q Consensus        62 ~~~~~L~~Lr~KL~rN~~~L~~HL~AVreVa~ii~~Ai   99 (123)
                      .+...+..+|+.=.+|..+++.+++-++..-.+|..+.
T Consensus        96 ~l~~ll~~~~~~N~~Ng~Li~~~l~~~~~~l~~L~~~~  133 (154)
T 3opc_A           96 ALQANAAQAREHNQRNGTLIAVNLRHTQESLDALRQAA  133 (154)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC--
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999999999999999987415



>2fup_A Hypothetical protein PA3352; structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; 1.48A {Pseudomonas aeruginosa} SCOP: a.47.5.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00