254780509

254780509

hypothetical protein CLIBASIA_01980

GeneID in NCBI database:8209504Locus tag:CLIBASIA_01980
Protein GI in NCBI database:254780509Protein Accession:YP_003064922.1
Gene range:+(767582, 767920)Protein Length:112aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MQVLPISNISHSQSMGGNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEISK
ccEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccHHHcc
ccEEEEccccccccccccHHEEccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHccHHHcccccccHHHHHHHHHHHHHHHHHHHcEEcccccccc
mqvlpisnishsqsmggnlakisqddssfQSFLQLKDVQEacdksksvpeMTQKLQGIMFQYFIKsilpeetvkslgggfngDFWQEILAENISDVIVKQQritldlpeisk
MQVLPISNISHSQSMGGNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQqritldlpeisk
MQVLPISNISHSQSMGGNLAKIsqddssfqsflqlKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEISK
****P*************************************************LQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLP****
MQVLPISNISHSQSMGGNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEISK
*QVL*******************QDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEIS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVLPISNISHSQSMGGNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEISK
MQVLPISNISHSQSMGGNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEISK
MQVLPISNISHSQSMGGNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEISK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target112 hypothetical protein CLIBASIA_01980 [Candidatus Liberib
315122294101 hypothetical protein CKC_02730 [Candidatus Liberibacter 1 1e-31
307318939174 Flagellar protein FlgJ-like protein [Sinorhizobium meli 1 1e-06
15964442184 hypothetical protein SMc03071 [Sinorhizobium meliloti 1 1 1e-06
150395513183 hypothetical protein Smed_0286 [Sinorhizobium medicae W 1 8e-06
116250510187 hypothetical protein RL0738 [Rhizobium leguminosarum bv 1 2e-05
209547956187 hypothetical protein Rleg2_0348 [Rhizobium leguminosaru 1 6e-05
86356340187 hypothetical protein RHE_CH00689 [Rhizobium etli CFN 42 1 6e-05
218463241168 hypothetical protein RetlK5_29124 [Rhizobium etli Kim 5 1 7e-05
241203134187 hypothetical protein Rleg_0380 [Rhizobium leguminosarum 1 7e-05
190890392187 hypothetical protein RHECIAT_CH0000767 [Rhizobium etli 1 7e-05
>gi|315122294|ref|YP_004062783.1| hypothetical protein CKC_02730 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 101 Back     alignment and organism information
 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 3/101 (2%)

Query: 15  MGGNLAKISQDD---SSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEE 71
           M  NL KI  ++    SF SFLQ K+VQ+  D+SK +PE  QKLQG+MFQYFIKSILPEE
Sbjct: 1   MDSNLTKIVPNNYSSESFSSFLQTKNVQKTSDQSKYIPEAMQKLQGVMFQYFIKSILPEE 60

Query: 72  TVKSLGGGFNGDFWQEILAENISDVIVKQQRITLDLPEISK 112
           T+KSLGGGF GDFW+EILAENIS+VIVKQQRIT +L   SK
Sbjct: 61  TIKSLGGGFYGDFWKEILAENISNVIVKQQRITFNLSNTSK 101


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307318939|ref|ZP_07598370.1| Flagellar protein FlgJ-like protein [Sinorhizobium meliloti AK83] Length = 174 Back     alignment and organism information
>gi|15964442|ref|NP_384795.1| hypothetical protein SMc03071 [Sinorhizobium meliloti 1021] Length = 184 Back     alignment and organism information
>gi|150395513|ref|YP_001325980.1| hypothetical protein Smed_0286 [Sinorhizobium medicae WSM419] Length = 183 Back     alignment and organism information
>gi|116250510|ref|YP_766348.1| hypothetical protein RL0738 [Rhizobium leguminosarum bv. viciae 3841] Length = 187 Back     alignment and organism information
>gi|209547956|ref|YP_002279873.1| hypothetical protein Rleg2_0348 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 187 Back     alignment and organism information
>gi|86356340|ref|YP_468232.1| hypothetical protein RHE_CH00689 [Rhizobium etli CFN 42] Length = 187 Back     alignment and organism information
>gi|218463241|ref|ZP_03503332.1| hypothetical protein RetlK5_29124 [Rhizobium etli Kim 5] Length = 168 Back     alignment and organism information
>gi|241203134|ref|YP_002974230.1| hypothetical protein Rleg_0380 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 187 Back     alignment and organism information
>gi|190890392|ref|YP_001976934.1| hypothetical protein RHECIAT_CH0000767 [Rhizobium etli CIAT 652] Length = 187 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 112 hypothetical protein CLIBASIA_01980 [Candidatus Liberib
PRK05684 313 flgJ peptidoglycan hydrolase; Validated 99.9
PRK12709 318 flgJ peptidoglycan hydrolase; Provisional 99.89
TIGR02541 332 flagell_FlgJ flagellar rod assembly protein/muramidase 99.89
PRK12712 344 flgJ peptidoglycan hydrolase; Provisional 99.88
PRK12710 291 flgJ peptidoglycan hydrolase; Provisional 99.88
PRK12713 339 flgJ peptidoglycan hydrolase; Provisional 99.87
PRK12711 392 flgJ peptidoglycan hydrolase; Reviewed 99.84
PRK12790115 chemotactic signal-response protein CheL; Provisional 99.83
COG3951166 Rod binding protein [Cell envelope biogenesis, outer me 99.82
PRK12708134 flgJ peptidoglycan hydrolase; Reviewed 99.77
pfam1013549 Rod-binding Rod binding protein. Members of this family 99.0
>PRK05684 flgJ peptidoglycan hydrolase; Validated Back     alignment and domain information
>PRK12709 flgJ peptidoglycan hydrolase; Provisional Back     alignment and domain information
>TIGR02541 flagell_FlgJ flagellar rod assembly protein/muramidase FlgJ; InterPro: IPR013377 The N-terminal region of this protein acts directly in flagellar rod assembly, while the C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring Back     alignment and domain information
>PRK12712 flgJ peptidoglycan hydrolase; Provisional Back     alignment and domain information
>PRK12710 flgJ peptidoglycan hydrolase; Provisional Back     alignment and domain information
>PRK12713 flgJ peptidoglycan hydrolase; Provisional Back     alignment and domain information
>PRK12711 flgJ peptidoglycan hydrolase; Reviewed Back     alignment and domain information
>PRK12790 chemotactic signal-response protein CheL; Provisional Back     alignment and domain information
>COG3951 Rod binding protein [Cell envelope biogenesis, outer membrane / Cell motility and secretion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12708 flgJ peptidoglycan hydrolase; Reviewed Back     alignment and domain information
>pfam10135 Rod-binding Rod binding protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00