254780510

254780510

hypothetical protein CLIBASIA_01985

GeneID in NCBI database:8209505Locus tag:CLIBASIA_01985
Protein GI in NCBI database:254780510Protein Accession:YP_003064923.1
Gene range:+(767134, 767547)Protein Length:137aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MRSRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDNIEQRILFNAVSRKFMSL
cccHHHHHHHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHEEcccccHHHccc
MRSRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDsinstalmNPALASHYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLeerqyddennndniEQRILFNAVSRKFMSL
MRSRKSRALYKIItaqcciksiaesnlaytiseRKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQKMASLQLVQENTllsekikidrltemKDETYLLEerqyddennndniEQRILfnavsrkfmsl
MRSRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDNIEQRILFNAVSRKFMSL
************ITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQ*****************************************DDENNNDNIEQRILFNAVSRKFMSL
********LYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDNIEQRILFNAVSRKFMSL
*****SRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDNIEQRILFNAV*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDNIEQRILFNAVSRKFMSL
MRSRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDNIEQRILFNAVSRKFMSL
MRSRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDNIEQRILFNAVSRKFMSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target137 hypothetical protein CLIBASIA_01985 [Candidatus Liberib
315122293137 hypothetical protein CKC_02725 [Candidatus Liberibacter 1 6e-49
227820884137 hypothetical protein NGR_c03030 [Sinorhizobium fredii N 1 1e-08
222147598137 hypothetical protein Avi_0774 [Agrobacterium vitis S4] 1 5e-08
307311583137 conserved hypothetical protein [Sinorhizobium meliloti 1 1e-06
116250509137 hypothetical protein RL0737 [Rhizobium leguminosarum bv 1 2e-06
15964441137 hypothetical protein SMc03056 [Sinorhizobium meliloti 1 1 2e-06
218463240137 hypothetical protein RetlK5_29119 [Rhizobium etli Kim 5 1 2e-06
241203133137 hypothetical protein Rleg_0379 [Rhizobium leguminosarum 1 4e-06
190890391137 hypothetical protein RHECIAT_CH0000766 [Rhizobium etli 1 5e-06
222084894139 hypothetical protein Arad_0922 [Agrobacterium radiobact 1 1e-05
>gi|315122293|ref|YP_004062782.1| hypothetical protein CKC_02725 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 137 Back     alignment and organism information
 Score =  196 bits (499), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 94/137 (68%), Positives = 117/137 (85%)

Query: 1   MRSRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALAS 60
           MR R S+ L+K+++ Q C+K IAE NLAYTIS+ KKINILRE+L DS+ S AL NP+LA 
Sbjct: 1   MRCRDSKTLHKLLSVQHCLKRIAEVNLAYTISQHKKINILREELIDSMYSIALQNPSLAC 60

Query: 61  HYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDN 120
           HY  F+HSLS+N++KMA LQ +QEN LLSEK+KIDRLTE+KDE YLLEERQYDDENN DN
Sbjct: 61  HYSNFHHSLSENEKKMADLQSIQENKLLSEKVKIDRLTELKDEIYLLEERQYDDENNEDN 120

Query: 121 IEQRILFNAVSRKFMSL 137
           ++QR+LF+AVSRKF++L
Sbjct: 121 VDQRVLFDAVSRKFITL 137


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820884|ref|YP_002824854.1| hypothetical protein NGR_c03030 [Sinorhizobium fredii NGR234] Length = 137 Back     alignment and organism information
>gi|222147598|ref|YP_002548555.1| hypothetical protein Avi_0774 [Agrobacterium vitis S4] Length = 137 Back     alignment and organism information
>gi|307311583|ref|ZP_07591224.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C] Length = 137 Back     alignment and organism information
>gi|116250509|ref|YP_766347.1| hypothetical protein RL0737 [Rhizobium leguminosarum bv. viciae 3841] Length = 137 Back     alignment and organism information
>gi|15964441|ref|NP_384794.1| hypothetical protein SMc03056 [Sinorhizobium meliloti 1021] Length = 137 Back     alignment and organism information
>gi|218463240|ref|ZP_03503331.1| hypothetical protein RetlK5_29119 [Rhizobium etli Kim 5] Length = 137 Back     alignment and organism information
>gi|241203133|ref|YP_002974229.1| hypothetical protein Rleg_0379 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 137 Back     alignment and organism information
>gi|190890391|ref|YP_001976933.1| hypothetical protein RHECIAT_CH0000766 [Rhizobium etli CIAT 652] Length = 137 Back     alignment and organism information
>gi|222084894|ref|YP_002543423.1| hypothetical protein Arad_0922 [Agrobacterium radiobacter K84] Length = 139 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00