254780521

254780521

flagellar biosynthesis repressor FlbT

GeneID in NCBI database:8209516Locus tag:CLIBASIA_02040
Protein GI in NCBI database:254780521Protein Accession:YP_003064934.1
Gene range:+(761186, 761647)Protein Length:153aa
Gene description:flagellar biosynthesis repressor FlbT
COG prediction:none
KEGG prediction:flbT; flagellar biosynthesis repressor FlbT; K06601 flagellar protein FlbT
SEED prediction:putative flagellum biosynthesis repressor protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP3 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEIKSWKSTQK
ccccEEEEEccccEEEEccEEEEEccEEEEEEEccccEEEHHHcccHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcc
ccccEEEEEccccEEEEEcEEEEcccEEEEEEEccccHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccc
MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEhhvireeeaitpfHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNirtlsfidnidpngsAIFASIFQSIRQEIKSWKSTQK
mnsplrislkageriflngavVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEIKSWKSTQK
MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYinilfniiqnqqlilalkniESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEIKSWKSTQK
***PLRI*LKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDN****************************
MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQE*********
**SPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEIKSW*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEIKSWKSTQK
MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEIKSWKSTQK
MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEIKSWKSTQK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target153 flagellar biosynthesis repressor FlbT [Candidatus Liber
315122288153 flagellar biosynthesis repressor FlbT [Candidatus Liber 1 3e-62
241203128149 flagellar biosynthesis repressor FlbT [Rhizobium legumi 1 2e-33
116250504149 flagellar biosynthesis repressor FlbT [Rhizobium legumi 1 2e-33
86356334149 flagellar biosynthesis repressor FlbT [Rhizobium etli C 1 2e-33
209547950149 flagellar biosynthesis repressor FlbT [Rhizobium legumi 1 3e-33
190890386149 flagellin synthesis regulator (repressor) protein [Rhiz 1 3e-33
218462421149 flagellar biosynthesis repressor FlbT [Rhizobium etli K 1 7e-33
150395507149 flagellar biosynthesis repressor FlbT [Sinorhizobium me 1 3e-32
325291966149 flagellar biosynthesis repressor FlbT [Agrobacterium sp 1 6e-32
163758036149 flagellum biosynthesis repressor [Hoeflea phototrophica 1 7e-32
>gi|315122288|ref|YP_004062777.1| flagellar biosynthesis repressor FlbT [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 153 Back     alignment and organism information
 Score =  241 bits (614), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 116/153 (75%), Positives = 134/153 (87%)

Query: 1   MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLI 60
           MNSPLRISL+AGERIFLNGA+VRVN+KV+LELLNDITFILE HVIREEEAITP  QLYLI
Sbjct: 1   MNSPLRISLRAGERIFLNGAIVRVNSKVMLELLNDITFILEQHVIREEEAITPLRQLYLI 60

Query: 61  VQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTL 120
           VQM+FLVP KKD  IDL RRYI +L N ++N+Q++LALKNIE L+ SGRFFEALK IRTL
Sbjct: 61  VQMVFLVPAKKDSSIDLCRRYIAVLLNSMRNEQMVLALKNIEFLVASGRFFEALKTIRTL 120

Query: 121 SFIDNIDPNGSAIFASIFQSIRQEIKSWKSTQK 153
             I++++P+G AIFASIFQ IRQEI+SWK  QK
Sbjct: 121 YLIESMEPSGDAIFASIFQCIRQEIESWKLIQK 153


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203128|ref|YP_002974224.1| flagellar biosynthesis repressor FlbT [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 149 Back     alignment and organism information
>gi|116250504|ref|YP_766342.1| flagellar biosynthesis repressor FlbT [Rhizobium leguminosarum bv. viciae 3841] Length = 149 Back     alignment and organism information
>gi|86356334|ref|YP_468226.1| flagellar biosynthesis repressor FlbT [Rhizobium etli CFN 42] Length = 149 Back     alignment and organism information
>gi|209547950|ref|YP_002279867.1| flagellar biosynthesis repressor FlbT [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 149 Back     alignment and organism information
>gi|190890386|ref|YP_001976928.1| flagellin synthesis regulator (repressor) protein [Rhizobium etli CIAT 652] Length = 149 Back     alignment and organism information
>gi|218462421|ref|ZP_03502512.1| flagellar biosynthesis repressor FlbT [Rhizobium etli Kim 5] Length = 149 Back     alignment and organism information
>gi|150395507|ref|YP_001325974.1| flagellar biosynthesis repressor FlbT [Sinorhizobium medicae WSM419] Length = 149 Back     alignment and organism information
>gi|325291966|ref|YP_004277830.1| flagellar biosynthesis repressor FlbT [Agrobacterium sp. H13-3] Length = 149 Back     alignment and organism information
>gi|163758036|ref|ZP_02165124.1| flagellum biosynthesis repressor [Hoeflea phototrophica DFL-43] Length = 149 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target153 flagellar biosynthesis repressor FlbT [Candidatus Liber
PRK00794132 PRK00794, flbT, flagellar biosynthesis repressor FlbT; 2e-30
pfam07378126 pfam07378, FlbT, Flagellar protein FlbT 1e-24
PRK12791131 PRK12791, flbT, flagellar biosynthesis repressor FlbT; 2e-05
COG5443148 COG5443, FlbT, Flagellar biosynthesis regulator FlbT [C 5e-32
>gnl|CDD|179127 PRK00794, flbT, flagellar biosynthesis repressor FlbT; Reviewed Back     alignment and domain information
>gnl|CDD|148792 pfam07378, FlbT, Flagellar protein FlbT Back     alignment and domain information
>gnl|CDD|183748 PRK12791, flbT, flagellar biosynthesis repressor FlbT; Reviewed Back     alignment and domain information
>gnl|CDD|35002 COG5443, FlbT, Flagellar biosynthesis regulator FlbT [Cell motility and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 153 flagellar biosynthesis repressor FlbT [Candidatus Liber
PRK00794133 flbT flagellar biosynthesis repressor FlbT; Reviewed 100.0
COG5443148 FlbT Flagellar biosynthesis regulator FlbT [Cell motili 100.0
pfam07378126 FlbT Flagellar protein FlbT. This family consists of se 100.0
PRK12791113 flbT flagellar biosynthesis repressor FlbT; Reviewed 100.0
TIGR00266230 TIGR00266 conserved hypothetical protein TIGR00266; Int 90.59
>PRK00794 flbT flagellar biosynthesis repressor FlbT; Reviewed Back     alignment and domain information
>COG5443 FlbT Flagellar biosynthesis regulator FlbT [Cell motility and secretion] Back     alignment and domain information
>pfam07378 FlbT Flagellar protein FlbT Back     alignment and domain information
>PRK12791 flbT flagellar biosynthesis repressor FlbT; Reviewed Back     alignment and domain information
>TIGR00266 TIGR00266 conserved hypothetical protein TIGR00266; InterPro: IPR002838 The proteins in this family have no known function Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00