254780522

254780522

flagellar biosynthesis regulatory protein FlaF

GeneID in NCBI database:8209517Locus tag:CLIBASIA_02045
Protein GI in NCBI database:254780522Protein Accession:YP_003064935.1
Gene range:+(760845, 761189)Protein Length:114aa
Gene description:flagellar biosynthesis regulatory protein FlaF
COG prediction:none
KEGG prediction:flaF; flagellar biosynthesis regulatory protein FlaF; K06602 flagellar protein FlaF
SEED prediction:putative flagellar synthesis related protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MRQYYHETIQESSIECRKREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK
cHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcc
ccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccc
MRQYYHETIQESSIECRKREHWILDRSISLLSIahkslpnsKQAVEALFYTSRVWVVFIQDLvsednhlpqeVKLNLISIGLWVLKECERIRrnksnsyqdIIDVISIVRDGLK
mrqyyhetiqessiecrkREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIrrnksnsyqdiidvisivrdglk
MRQYYHETIQESSIECRKREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK
**QYYHE*************HWILDRSISLLS***********AVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERI****SNSYQDIIDVISIVRDGLK
MRQYYHETIQESSIECRKREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK
MRQYYHETIQESSIECRKREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRQYYHETIQESSIECRKREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK
MRQYYHETIQESSIECRKREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK
MRQYYHETIQESSIECRKREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target114 flagellar biosynthesis regulatory protein FlaF [Candida
254781134 320 hypothetical protein CLIBASIA_05180 [Candidatus Li 0.015
>gi|254781134|ref|YP_003065547.1| hypothetical protein CLIBASIA_05180 [Candidatus Liberibacter asiaticus str. psy62] Length = 320 Back     alignment
 Score = 29.6 bits (65), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 27 SISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNL 77
          S SL +I H   P  K+A+  +F  + VW+     L+S  N L QE K NL
Sbjct: 47 SFSLKAIYHIGRPLGKRAI--VFVKNDVWIATNNGLISMKNILLQEEKTNL 95

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target114 flagellar biosynthesis regulatory protein FlaF [Candida
315122287114 flagellar biosynthesis regulatory protein FlaF [Candida 1 2e-44
222084888115 flagellin synthesis regulator protein [Agrobacterium ra 1 5e-29
116250503115 flagellar biosynthesis regulatory protein FlaF [Rhizobi 1 3e-28
209547949115 flagellar biosynthesis regulatory protein FlaF [Rhizobi 1 9e-28
86356333115 flagellar biosynthesis regulatory protein FlaF [Rhizobi 1 2e-27
222147592115 flagellar biosynthesis regulatory protein FlaF [Agrobac 1 3e-27
218462422115 flagellar biosynthesis regulatory protein FlaF [Rhizobi 1 4e-27
241203127115 flagellar biosynthesis regulatory protein FlaF [Rhizobi 1 5e-27
190890385115 flagellin synthesis regulator protein [Rhizobium etli C 1 5e-27
13472595115 flagellar biosynthesis regulatory protein FlaF [Mesorhi 1 2e-24
>gi|315122287|ref|YP_004062776.1| flagellar biosynthesis regulatory protein FlaF [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 114 Back     alignment and organism information
 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 102/114 (89%)

Query: 1   MRQYYHETIQESSIECRKREHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFIQ 60
           MRQYY+E +QESS+E RKRE WIL++SISLLS A +S PNS++ VEAL+YT+RVWVVFIQ
Sbjct: 1   MRQYYNEIVQESSVESRKREFWILNKSISLLSSAQQSKPNSREVVEALYYTNRVWVVFIQ 60

Query: 61  DLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK 114
           DLVSE N L +EVKLNLISIGLW+L+ECERIRRN+SN+YQ IIDV S+VRDGLK
Sbjct: 61  DLVSESNQLTEEVKLNLISIGLWILEECERIRRNESNNYQAIIDVTSVVRDGLK 114


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084888|ref|YP_002543417.1| flagellin synthesis regulator protein [Agrobacterium radiobacter K84] Length = 115 Back     alignment and organism information
>gi|116250503|ref|YP_766341.1| flagellar biosynthesis regulatory protein FlaF [Rhizobium leguminosarum bv. viciae 3841] Length = 115 Back     alignment and organism information
>gi|209547949|ref|YP_002279866.1| flagellar biosynthesis regulatory protein FlaF [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 115 Back     alignment and organism information
>gi|86356333|ref|YP_468225.1| flagellar biosynthesis regulatory protein FlaF [Rhizobium etli CFN 42] Length = 115 Back     alignment and organism information
>gi|222147592|ref|YP_002548549.1| flagellar biosynthesis regulatory protein FlaF [Agrobacterium vitis S4] Length = 115 Back     alignment and organism information
>gi|218462422|ref|ZP_03502513.1| flagellar biosynthesis regulatory protein FlaF [Rhizobium etli Kim 5] Length = 115 Back     alignment and organism information
>gi|241203127|ref|YP_002974223.1| flagellar biosynthesis regulatory protein FlaF [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 115 Back     alignment and organism information
>gi|190890385|ref|YP_001976927.1| flagellin synthesis regulator protein [Rhizobium etli CIAT 652] Length = 115 Back     alignment and organism information
>gi|13472595|ref|NP_104162.1| flagellar biosynthesis regulatory protein FlaF [Mesorhizobium loti MAFF303099] Length = 115 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target114 flagellar biosynthesis regulatory protein FlaF [Candida
PRK12793115 PRK12793, flaF, flagellar biosynthesis regulatory prote 1e-33
pfam07309113 pfam07309, FlaF, Flagellar protein FlaF 1e-25
COG5442115 COG5442, FlaF, Flagellar biosynthesis regulator FlaF [C 5e-27
PRK12794122 PRK12794, flaF, flagellar biosynthesis regulatory prote 2e-07
>gnl|CDD|183750 PRK12793, flaF, flagellar biosynthesis regulatory protein FlaF; Reviewed Back     alignment and domain information
>gnl|CDD|148743 pfam07309, FlaF, Flagellar protein FlaF Back     alignment and domain information
>gnl|CDD|35001 COG5442, FlaF, Flagellar biosynthesis regulator FlaF [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183751 PRK12794, flaF, flagellar biosynthesis regulatory protein FlaF; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 114 flagellar biosynthesis regulatory protein FlaF [Candida
PRK12793115 flaF flagellar biosynthesis regulatory protein FlaF; Re 100.0
pfam07309113 FlaF Flagellar protein FlaF. This family consists of se 100.0
PRK12794122 flaF flagellar biosynthesis regulatory protein FlaF; Re 100.0
COG5442115 FlaF Flagellar biosynthesis regulator FlaF [Cell motili 100.0
pfam02561122 FliS Flagellar protein FliS. FliS is coded for by the F 96.09
COG1516132 FliS Flagellin-specific chaperone FliS [Cell motility a 93.33
>PRK12793 flaF flagellar biosynthesis regulatory protein FlaF; Reviewed Back     alignment and domain information
>pfam07309 FlaF Flagellar protein FlaF Back     alignment and domain information
>PRK12794 flaF flagellar biosynthesis regulatory protein FlaF; Reviewed Back     alignment and domain information
>COG5442 FlaF Flagellar biosynthesis regulator FlaF [Cell motility and secretion] Back     alignment and domain information
>pfam02561 FliS Flagellar protein FliS Back     alignment and domain information
>COG1516 FliS Flagellin-specific chaperone FliS [Cell motility and secretion / Intracellular trafficking and secretion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target114 flagellar biosynthesis regulatory protein FlaF [Candida
1vh6_A145 Flagellar protein FLIS; structural genomics, unknown fu 95.65
3iqc_A131 FLIS, flagellar protein; chaperone, flagellum; 2.70A {H 92.11
>1vh6_A Flagellar protein FLIS; structural genomics, unknown function; HET: MSE; 2.50A {Bacillus subtilis} SCOP: a.24.19.1 Back     alignment and structure
Probab=95.65  E-value=0.11  Score=28.81  Aligned_cols=105  Identities=9%  Similarity=0.145  Sum_probs=82.8

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             2699999972237979999999999999999998368--88399999999999999999999609889989899999999
Q gi|254780522|r    2 RQYYHETIQESSIECRKREHWILDRSISLLSIAHKSL--PNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLIS   79 (114)
Q Consensus         2 r~~Y~~~~~~s~~~~R~~E~~~l~~~~~~L~~A~~~~--~~~~~~~eAL~~N~rLWt~~~~dl~~~~N~LP~~LRa~Lis   79 (114)
                      +++|.++.-. +.+|-+.=-.+|..+...|..|....  .+..+..+++..-+.+-.-+..+|-. +    .++-.+|.+
T Consensus         9 ~~aY~~~~v~-tasp~~Li~mLyd~ai~~l~~a~~ai~~~d~~~~~~~l~ka~~Ii~eL~~~Ld~-~----geiA~nL~~   82 (145)
T 1vh6_A            9 YTAYQQNSVN-TATPGELTLMLYNGCLKFIRLAAQAIENDDMERKNENLIKAQNIIQELNFTLNR-N----IELSASMGA   82 (145)
T ss_dssp             ------------CCTTHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHH-H----HHHTTHHHH
T ss_pred             HHHHHHHHHC-CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCC-C----HHHHHHHHH
T ss_conf             9999986050-599999999999999999999999998579999999999999999998753226-8----189999999


Q ss_pred             HHHHHHHHH-HHHHCCCCCCHHHHHHHHHHHHHH
Q ss_conf             999999999-999547843127999999999951
Q gi|254780522|r   80 IGLWVLKEC-ERIRRNKSNSYQDIIDVISIVRDG  112 (114)
Q Consensus        80 L~~fv~~~t-~~v~~~~~~~l~~LI~IN~~I~~G  112 (114)
                      |-.|+.++. ...+..+.+.++..+.|=..|++|
T Consensus        83 lY~y~~~~L~~a~~~~d~~~l~~v~~il~~l~ea  116 (145)
T 1vh6_A           83 MYDYMYRRLVQANIKNDTGMLAEVEGYVTDFRDA  116 (145)
T ss_dssp             HHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             9999999999998758999999999999999999



>3iqc_A FLIS, flagellar protein; chaperone, flagellum; 2.70A {Helicobacter pylori} PDB: 3k1i_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target114 flagellar biosynthesis regulatory protein FlaF [Candida
1vh6_A_145 Flagellar protein FLIS; structural genomics, unkno 91.77
>1vh6_A (A:) Flagellar protein FLIS; structural genomics, unknown function; HET: MSE; 2.50A {Bacillus subtilis} Back     alignment and structure
Probab=91.77  E-value=0.9  Score=24.25  Aligned_cols=105  Identities=9%  Similarity=0.131  Sum_probs=84.7

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             2699999972237979999999999999999998368--88399999999999999999999609889989899999999
Q gi|254780522|r    2 RQYYHETIQESSIECRKREHWILDRSISLLSIAHKSL--PNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLIS   79 (114)
Q Consensus         2 r~~Y~~~~~~s~~~~R~~E~~~l~~~~~~L~~A~~~~--~~~~~~~eAL~~N~rLWt~~~~dl~~~~N~LP~~LRa~Lis   79 (114)
                      .++|.++.- .+.+|=+.=-.+|..+...|..|....  .+..+..++|..-+.+-+-|..-|-..     .++=.+|.+
T Consensus         9 ~~aY~~~~v-~tasp~~Li~mLyd~ai~~l~~a~~ai~~~~~~~~~~~l~ka~~Ii~eL~~sLd~~-----~eiA~~L~~   82 (145)
T 1vh6_A            9 YTAYQQNSV-NTATPGELTLXLYNGCLKFIRLAAQAIENDDXERKNENLIKAQNIIQELNFTLNRN-----IELSASXGA   82 (145)
T ss_dssp             ------------CCTTHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHTTHHHH
T ss_pred             HHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCC-----HHHHHHHHH
T ss_conf             999998535-04999999999999999999999999985799999999999999999988652468-----089999999


Q ss_pred             HHHHHHHHH-HHHHCCCCCCHHHHHHHHHHHHHH
Q ss_conf             999999999-999547843127999999999951
Q gi|254780522|r   80 IGLWVLKEC-ERIRRNKSNSYQDIIDVISIVRDG  112 (114)
Q Consensus        80 L~~fv~~~t-~~v~~~~~~~l~~LI~IN~~I~~G  112 (114)
                      |-.|+.++. ...+..+.+.++..+.|=..+.+|
T Consensus        83 LY~y~~~~L~~A~~~~d~~~i~ev~~il~~L~ea  116 (145)
T 1vh6_A           83 XYDYXYRRLVQANIKNDTGXLAEVEGYVTDFRDA  116 (145)
T ss_dssp             HHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             9999999999998869999999999999999999