254780523

254780523

flagellar hook-associated protein FlgL

GeneID in NCBI database:8209518Locus tag:CLIBASIA_02050
Protein GI in NCBI database:254780523Protein Accession:YP_003064936.1
Gene range:+(759741, 760814)Protein Length:357aa
Gene description:flagellar hook-associated protein FlgL
COG prediction:[N] Flagellin and related hook-associated proteins
KEGG prediction:flgL; flagellar hook-associated protein FlgL; K02397 flagellar hook-associated protein 3 FlgL
SEED prediction:putative flagellar hook-associated protein
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL
ccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcc
cccEEHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccHHHcccccHHHHHHHHHHHHHccccccHHHccccHHHccccHHHHHHHHHcccccccccccccccccccccccEEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcc
MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVtgqssdyglQLGARVTSILEWEQEKNHIaerlhsnslVTKRLSTSQAHLSSMQKIVQDMVGPLVILlegktdnnkfpinagmlrdSYESFVTfanmtdegqylfsginssekplngyftkdslaKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEdkfsddeywannwsnasdhnikyrikdtegidvsanvnmrgiRDIMFVAVIGTEFlsknltdgARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL
mkttgistssifERMNILTKELNKDSVKLHEEMVtgqssdyglQLGARVTSILEWEQEKNHIaerlhsnslvTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNwsnasdhnikyRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTklqklsilnyl
MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL
***TGISTSSI*************************QSSDYGLQLGARVTSILEWEQEKNH**ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMV*************************SYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTE***********NVLTKKMLSTVQQGLSGIIEQRAVLGISEKNI************IIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL
MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL
*KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL
MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL
MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target357 flagellar hook-associated protein FlgL [Candidatus Libe
315122286356 flagellar hook-associated protein FlgL [Candidatus Libe 1 1e-109
163758034350 flagellar hook-associated protein L [Hoeflea phototroph 1 1e-43
222147591355 flagellar hook-associated protein FlgL [Agrobacterium v 1 1e-42
227820877350 flagellar hook-associated protein FlgL [Sinorhizobium f 1 2e-42
307318931347 flagellar hook-associated 3 family protein [Sinorhizobi 1 3e-42
10998530345 FlgL [Sinorhizobium meliloti] Length = 345 1 1e-41
15964434345 flagellar hook-associated protein FlgL [Sinorhizobium m 1 4e-41
150395505350 flagellar hook-associated protein FlgL [Sinorhizobium m 1 2e-39
110632638349 flagellar hook-associated protein FlgL [Mesorhizobium s 1 6e-37
15887921367 flagellar hook-associated protein FlgL [Agrobacterium t 1 4e-35
>gi|315122286|ref|YP_004062775.1| flagellar hook-associated protein FlgL [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 356 Back     alignment and organism information
 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/357 (56%), Positives = 259/357 (72%), Gaps = 1/357 (0%)

Query: 1   MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKN 60
           MK TG+STSSI +RMNILTK+L+ +  KL  E +TGQ  DYGLQLG++VT I+E+EQEKN
Sbjct: 1   MKITGVSTSSILDRMNILTKDLSNNMEKLQHESITGQCWDYGLQLGSKVTDIIEFEQEKN 60

Query: 61  HIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDS 120
           H+ ERL  + LV  RLS  Q H+  +  + Q+ +  +  LL+G  D +       +L+DS
Sbjct: 61  HVTERLRGSELVKTRLSILQKHVEKIDDVYQNALQKMP-LLQGNEDKHAIAQVVSLLQDS 119

Query: 121 YESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
           ++S + F N T+ G+YLFSGIN+SEKPL  YF KDSLAK+SFDQML+ FL+ENSK+L  G
Sbjct: 120 FQSTIEFFNTTEGGKYLFSGINTSEKPLQDYFAKDSLAKQSFDQMLKDFLKENSKNLPVG 179

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM 240
           Q+L+VSSMN  QM DFI +LE+KFS+DEYW+ NWSNASD NIKY   +   ++VS NVN 
Sbjct: 180 QNLDVSSMNGHQMADFINKLEEKFSNDEYWSKNWSNASDQNIKYHSSNAGNLEVSVNVNS 239

Query: 241 RGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINE 300
             IR+ M  +VIG EFL+K+LT  +RNVL  KM S + QG+  +  Q A LG SEK I E
Sbjct: 240 DAIRNFMLFSVIGVEFLNKDLTTESRNVLNNKMASFIGQGVQDLNHQSAFLGFSEKRIEE 299

Query: 301 ERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           E  FLQ+K NIIDTYI KS+ V+Q+ A   L+ LINKI+MSYMIT KLQKLS+LNYL
Sbjct: 300 EIKFLQDKMNIIDTYILKSVSVDQYKASVGLTELINKIDMSYMITAKLQKLSLLNYL 356


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163758034|ref|ZP_02165122.1| flagellar hook-associated protein L [Hoeflea phototrophica DFL-43] Length = 350 Back     alignment and organism information
>gi|222147591|ref|YP_002548548.1| flagellar hook-associated protein FlgL [Agrobacterium vitis S4] Length = 355 Back     alignment and organism information
>gi|227820877|ref|YP_002824847.1| flagellar hook-associated protein FlgL [Sinorhizobium fredii NGR234] Length = 350 Back     alignment and organism information
>gi|307318931|ref|ZP_07598362.1| flagellar hook-associated 3 family protein [Sinorhizobium meliloti AK83] Length = 347 Back     alignment and organism information
>gi|10998530|gb|AAG25960.1|AF300968_2 FlgL [Sinorhizobium meliloti] Length = 345 Back     alignment and organism information
>gi|15964434|ref|NP_384787.1| flagellar hook-associated protein FlgL [Sinorhizobium meliloti 1021] Length = 345 Back     alignment and organism information
>gi|150395505|ref|YP_001325972.1| flagellar hook-associated protein FlgL [Sinorhizobium medicae WSM419] Length = 350 Back     alignment and organism information
>gi|110632638|ref|YP_672846.1| flagellar hook-associated protein FlgL [Mesorhizobium sp. BNC1] Length = 349 Back     alignment and organism information
>gi|15887921|ref|NP_353602.1| flagellar hook-associated protein FlgL [Agrobacterium tumefaciens str. C58] Length = 367 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target357 flagellar hook-associated protein FlgL [Candidatus Libe
PRK06008348 PRK06008, flgL, flagellar hook-associated protein FlgL; 1e-57
COG1344360 COG1344, FlgL, Flagellin and related hook-associated pr 7e-09
pfam0070084 pfam00700, Flagellin_C, Bacterial flagellin C-terminal 2e-06
pfam00669139 pfam00669, Flagellin_N, Bacterial flagellin N-terminal 1e-04
PRK07192305 PRK07192, flgL, flagellar hook-associated protein FlgL; 2e-04
PRK08913301 PRK08913, flgL, flagellar hook-associated protein FlgL; 3e-04
>gnl|CDD|168344 PRK06008, flgL, flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>gnl|CDD|31535 COG1344, FlgL, Flagellin and related hook-associated proteins [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|144340 pfam00700, Flagellin_C, Bacterial flagellin C-terminal helical region Back     alignment and domain information
>gnl|CDD|144315 pfam00669, Flagellin_N, Bacterial flagellin N-terminal helical region Back     alignment and domain information
>gnl|CDD|180872 PRK07192, flgL, flagellar hook-associated protein FlgL; Reviewed Back     alignment and domain information
>gnl|CDD|181581 PRK08913, flgL, flagellar hook-associated protein FlgL; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 357 flagellar hook-associated protein FlgL [Candidatus Libe
PRK08870403 flgL flagellar hook-associated protein FlgL; Reviewed 100.0
PRK12717523 flgL flagellar hook-associated protein FlgL; Provisiona 100.0
PRK06663420 flagellar hook-associated protein FlgL; Validated 100.0
PRK07192305 flgL flagellar hook-associated protein FlgL; Reviewed 100.0
PRK12718510 flgL flagellar hook-associated protein FlgL; Provisiona 100.0
PRK07701301 flgL flagellar hook-associated protein FlgL; Validated 100.0
PRK08073287 flgL flagellar hook-associated protein FlgL; Validated 100.0
PRK08027317 flgL flagellar hook-associated protein FlgL; Reviewed 100.0
PRK08913302 flgL flagellar hook-associated protein FlgL; Validated 100.0
PRK06008348 flgL flagellar hook-associated protein FlgL; Validated 100.0
pfam07164347 consensus 100.0
COG1344360 FlgL Flagellin and related hook-associated proteins [Ce 100.0
PRK06819371 flagellin; Validated 100.0
PRK08869377 flagellin; Reviewed 100.0
PRK12804307 flagellin; Provisional 100.0
PRK12803335 flagellin; Provisional 100.0
PRK12807287 flagellin; Provisional 100.0
PRK12802282 flagellin; Provisional 100.0
PRK12805287 flagellin; Provisional 100.0
PRK12808460 flagellin; Provisional 100.0
PRK13588514 flagellin B; Provisional 100.0
PRK12806475 flagellin; Provisional 100.0
PRK12584510 flagellin A; Reviewed 100.0
TIGR02550393 flagell_flgL flagellar hook-associated protein 3; Inter 100.0
PRK12687311 flagellin; Reviewed 100.0
PRK08412 777 flgL flagellar hook-associated protein FlgL; Validated 100.0
PRK08026 566 flagellin; Validated 100.0
PRK08411 573 flagellin; Reviewed 100.0
PRK13589 573 flagellin; Provisional 100.0
pfam00669139 Flagellin_N Bacterial flagellin N-terminal helical regi 100.0
pfam0070084 Flagellin_C Bacterial flagellin C-terminal helical regi 99.81
PRK07191456 flgK flagellar hook-associated protein FlgK; Validated 97.39
PRK07521482 flgK flagellar hook-associated protein FlgK; Validated 97.23
PRK06799431 flgK flagellar hook-associated protein FlgK; Validated 96.97
PRK06665628 flgK flagellar hook-associated protein FlgK; Validated 96.63
PRK12714624 flgK flagellar hook-associated protein FlgK; Provisiona 96.56
PRK06945649 flgK flagellar hook-associated protein FlgK; Validated 96.48
PRK05683676 flgK flagellar hook-associated protein FlgK; Validated 96.39
PRK12715649 flgK flagellar hook-associated protein FlgK; Provisiona 96.21
PRK07739500 flgK flagellar hook-associated protein FlgK; Validated 96.1
PRK08871626 flgK flagellar hook-associated protein FlgK; Validated 95.99
TIGR02492495 flgK_ends flagellar hook-associated protein FlgK; Inter 95.94
PRK12688888 flagellin; Reviewed 95.83
PRK08147547 flgK flagellar hook-associated protein FlgK; Validated 95.59
PRK12688 888 flagellin; Reviewed 98.45
>PRK08870 flgL flagellar hook-associated protein FlgL; Reviewed Back     alignment and domain information
>PRK12717 flgL flagellar hook-associated protein FlgL; Provisional Back     alignment and domain information
>PRK06663 flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>PRK07192 flgL flagellar hook-associated protein FlgL; Reviewed Back     alignment and domain information
>PRK12718 flgL flagellar hook-associated protein FlgL; Provisional Back     alignment and domain information
>PRK07701 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>PRK08073 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>PRK08027 flgL flagellar hook-associated protein FlgL; Reviewed Back     alignment and domain information
>PRK08913 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>PRK06008 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>pfam07164 consensus Back     alignment and domain information
>COG1344 FlgL Flagellin and related hook-associated proteins [Cell motility and secretion] Back     alignment and domain information
>PRK06819 flagellin; Validated Back     alignment and domain information
>PRK08869 flagellin; Reviewed Back     alignment and domain information
>PRK12804 flagellin; Provisional Back     alignment and domain information
>PRK12803 flagellin; Provisional Back     alignment and domain information
>PRK12807 flagellin; Provisional Back     alignment and domain information
>PRK12802 flagellin; Provisional Back     alignment and domain information
>PRK12805 flagellin; Provisional Back     alignment and domain information
>PRK12808 flagellin; Provisional Back     alignment and domain information
>PRK13588 flagellin B; Provisional Back     alignment and domain information
>PRK12806 flagellin; Provisional Back     alignment and domain information
>PRK12584 flagellin A; Reviewed Back     alignment and domain information
>TIGR02550 flagell_flgL flagellar hook-associated protein 3; InterPro: IPR013384 FlgL (or HAP3) proteins are flagellar hook-associated proteins encoded in bacterial flagellar operons Back     alignment and domain information
>PRK12687 flagellin; Reviewed Back     alignment and domain information
>PRK08412 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>PRK08026 flagellin; Validated Back     alignment and domain information
>PRK08411 flagellin; Reviewed Back     alignment and domain information
>PRK13589 flagellin; Provisional Back     alignment and domain information
>pfam00669 Flagellin_N Bacterial flagellin N-terminal helical region Back     alignment and domain information
>pfam00700 Flagellin_C Bacterial flagellin C-terminal helical region Back     alignment and domain information
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>PRK12688 flagellin; Reviewed Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12688 flagellin; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target357 flagellar hook-associated protein FlgL [Candidatus Libe
3k8v_A351 Crysatl Structure Of A Bacterial Cell-Surface Flage 8e-21
3k8w_A326 Crysatl Structure Of A Bacterial Cell-Surface Flage 2e-15
2d4x_A248 Crystal Structure Of A 26k Fragment Of Hap3 (Flgl) 5e-09
1ucu_A 494 R-Type Straight Flagellar Filament Made Of Full-Len 2e-18
3a5x_A 494 L-Type Straight Flagellar Filament Made Of Full-Len 4e-18
1ucu_A494 R-Type Straight Flagellar Filament Made Of Full-Len 1e-11
3a5x_A494 L-Type Straight Flagellar Filament Made Of Full-Len 4e-11
2zbi_A292 Crysatl Structure Of A Bacterial Cell-Surface Flage 4e-08
1io1_A398 Crystal Structure Of F41 Fragment Of Flagellin Leng 1e-07
3pwx_A239 Structure Of Putative Flagellar Hook-Associated Pro 2e-07
>gi|308198489|pdb|3K8V|A Chain A, Crysatl Structure Of A Bacterial Cell-Surface Flagellin N20c20 Length = 351 Back     alignment and structure
 Score =  105 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 27/343 (7%), Positives = 67/343 (19%), Gaps = 24/343 (6%)

Query: 22  LNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQA 81
                    + + +G   +      A +        +   + +   + +       T++ 
Sbjct: 1   TQNSLSTSLQRLSSGLRINSAKDDAAGLAISDRMTAQIKGLTQAQRNANDGISLAQTAEG 60

Query: 82  HLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGI 141
            L  +   +Q +    V    G             +          A  T          
Sbjct: 61  ALGEISNNLQRIRELAVQASNGTNTQTDRDALQAEVTQLQSEIQRVAEQTSFNGQKLLDG 120

Query: 142 NSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLE 201
           + +                S     Q      S +                         
Sbjct: 121 SFNGVQFQIGANAGETIGVSKIMNAQTASLGGSLTRTTSTIDATDLTKYDTAMAAGDLTI 180

Query: 202 DKFSDD------------------------EYWANNWSNASDHNIKYRIKDTEGIDVSAN 237
           +                             +       + +   +         +  +AN
Sbjct: 181 NGVDVGKIDAASTAQERAAQLTEAINRVSSQTNVGASYDKTTGQVTLTSNAAIAVAGAAN 240

Query: 238 VNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKN 297
                           T     N    +     ++ ++ +   L  I   RA LG  +  
Sbjct: 241 DATVAGWANNATTGTATTTTGINSLTVSSFTNAQQTITQIDNALKDINTARADLGAVQNR 300

Query: 298 INEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEM 340
                  LQ+    + +   +    +  +  A LS      + 
Sbjct: 301 FTSTVANLQSMTENLSSARGRVTDADFASETANLSRAQILQQA 343


>gi|308198491|pdb|3K8W|A Chain A, Crysatl Structure Of A Bacterial Cell-Surface Flagellin N20c45 Length = 326 Back     alignment and structure
>gi|119389099|pdb|2D4X|A Chain A, Crystal Structure Of A 26k Fragment Of Hap3 (Flgl) Length = 248 Back     alignment and structure
>gi|34810684|pdb|1UCU|A Chain A, R-Type Straight Flagellar Filament Made Of Full-Length Flagellin Length = 494 Back     alignment and structure
>gi|291191082|pdb|3A5X|A Chain A, L-Type Straight Flagellar Filament Made Of Full-Length Flagellin Length = 494 Back     alignment and structure
>gi|34810684|pdb|1UCU|A Chain A, R-Type Straight Flagellar Filament Made Of Full-Length Flagellin Length = 494 Back     alignment and structure
>gi|291191082|pdb|3A5X|A Chain A, L-Type Straight Flagellar Filament Made Of Full-Length Flagellin Length = 494 Back     alignment and structure
>gi|167013356|pdb|2ZBI|A Chain A, Crysatl Structure Of A Bacterial Cell-Surface Flagellin Length = 292 Back     alignment and structure
>gi|13786773|pdb|1IO1|A Chain A, Crystal Structure Of F41 Fragment Of Flagellin Length = 398 Back     alignment and structure
>gi|319443813|pdb|3PWX|A Chain A, Structure Of Putative Flagellar Hook-Associated Protein From Vibrio Parahaemolyticus Length = 239 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target357 flagellar hook-associated protein FlgL [Candidatus Libe
1ucu_A494 Phase 1 flagellin; flagellar filament, cryo-electron mi 100.0
3k8w_A326 Flagellin homolog; flagellum, structural protein, bacte 100.0
2d4x_A248 Flagellar HOOK-associated protein 3; multi-domain prote 100.0
1io1_A398 Phase 1 flagellin; beta-folium, structural protein; 2.0 99.96
3k1h_A158 HP1076, putative uncharacterized protein; FLIS interact 98.01
1ory_B55 Flagellin; flagellar chaperone, cytosolic export chaper 97.3
>1ucu_A Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} SCOP: e.32.1.1 PDB: 3a5x_A Back     alignment and structure
Probab=100.00  E-value=0  Score=322.59  Aligned_cols=347  Identities=11%  Similarity=0.006  Sum_probs=224.5

Q ss_pred             CEECHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             13218999999999999999999999999720220464212899999999999999999999999999999999999988
Q gi|254780523|r    4 TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHL   83 (357)
Q Consensus         4 ~~Ist~~~~~~~~~~l~~~~~~l~~~~~qlsTGk~i~~~sddp~~~~~~~~l~~~~~~l~~~~~n~~~a~~~l~~~e~~L   83 (357)
                      +||+|++++...+++|++.+.+|.+.|+||||||||++|+|||+++.++++|+.++..+++|.+|+..+.+||+++|++|
T Consensus         2 ~~i~tn~~~~~~~~~l~~~~~~l~~~~~~lssG~ri~~~sDdp~~~~~~~~l~~~~~~~~q~~~n~~~a~s~l~~ae~~L   81 (494)
T 1ucu_A            2 QVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANIKGLTQASRNANDGISIAQTTEGAL   81 (494)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCTTTSCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             09975199999999999999999999998601586588320589999999999999999999998999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH-HCCCCEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             88999999999999851378889889999999998656777777652-00243041056654432122333332222222
Q gi|254780523|r   84 SSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANM-TDEGQYLFSGINSSEKPLNGYFTKDSLAKKSF  162 (357)
Q Consensus        84 ~~i~~~l~~~~~~~v~a~n~t~~~~d~~~~a~e~~~~~~~l~~~aN~-~~~g~~~f~G~~~~~~p~~~~~~~~~~~~~~~  162 (357)
                      .++.++|+|+||++++++|++++++||++++.|+.+++++|.+++|. +++|.|+|+|......|+..............
T Consensus        82 ~~v~~~L~r~relavqaan~~~s~~dr~ai~~ei~~l~~~i~~ia~~t~fnG~~Lf~G~~~~~~~~g~~~~~~~~~~~~~  161 (494)
T 1ucu_A           82 NEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVSGQTQFNGVKVLAQDNTLTIQVGANDGETIDIDLKQ  161 (494)
T ss_dssp             HHHHHHHHHHHHHHHHHTCTTCCHHHHHHHHHHHHHHHHHHHHHHHHCCBTTBCTTTSCEEEEEECSSSTTCEEEEEECC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHCCCCCCEEEEEECCCCEEEEECCC
T ss_conf             99999999999999976168876455777788999988777776545421413320114542278752157225640233


Q ss_pred             CCHHHCC-------------------C-------CCCCCCC------CCCCCCCC-----C--------------CCCCC
Q ss_conf             1000101-------------------3-------4543222------45665321-----1--------------23332
Q gi|254780523|r  163 DQMLQGF-------------------L-------EENSKSL------LAGQHLEV-----S--------------SMNAQ  191 (357)
Q Consensus       163 ~~~~~~~-------------------~-------~~~~~~~------~~~~~~~~-----~--------------~~~~~  191 (357)
                      .......                   .       .......      ........     .              .....
T Consensus       162 ~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  241 (494)
T 1ucu_A          162 INSQTLGLDTLNVQQKYKVSDTAATVTGYADTTIALDNSTFKASATGLGGTDQKIDGDLKFDDTTGKYYAKVTVTGGTGK  241 (494)
T ss_dssp             CSTTTTTCTTCCCCCCCEEEEEECCCCSEEEEEEECBCTTSTTTCGGGCSSEEEECSSEEEETTTTEEEEEEEEETCSSC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCEEEECCCCC
T ss_conf             33222465310134444555420010023310233024421111234323221013320222011100000122013243


Q ss_pred             C-C------------CCCCCCCCCCCCC-CCCC-----CCEEECCC------------------CCCCEEECCCCCCEEE
Q ss_conf             2-1------------0012334444456-6543-----20011156------------------6520000025641022
Q gi|254780523|r  192 Q-M------------TDFIKQLEDKFSD-DEYW-----ANNWSNAS------------------DHNIKYRIKDTEGIDV  234 (357)
Q Consensus       192 ~-~------------~~~~~~~~~~~~~-~~~~-----~~~~~~~~------------------~~~~~~~~~~~~~~~~  234 (357)
                      . .            ............. ....     ........                  ..........+.....
T Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~  321 (494)
T 1ucu_A          242 DGYYEVSVDKTNGEVTLAGGATSPLTGGLPATATEDVKNVQVANADLTEAKAALTAAGVTGTASVVKMSYTDNNGKTIDG  321 (494)
T ss_dssp             CEEEEEEECTTTCBEEESTTCSSCCTTSSCTTCCEEESEEEEEGGGTHHHHHHHHHTTCCSCEEEEEEEEECTTSCEEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCEEEEEECCCCCEEECC
T ss_conf             32212222445553000234433333443220223334310023332223321000243332210001320332101014


Q ss_pred             EE------------ECCCC-----------------------------------HHHHHHHHHHHHCCCCCCCCCCHHHH
Q ss_conf             32------------03531-----------------------------------01123333321002334455511356
Q gi|254780523|r  235 SA------------NVNMR-----------------------------------GIRDIMFVAVIGTEFLSKNLTDGARN  267 (357)
Q Consensus       235 ~~------------~~~~~-----------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~  267 (357)
                      ..            .....                                   ..........................
T Consensus       322 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~  401 (494)
T 1ucu_A          322 GLAVKVGDDYYSATQNKDGSISINTTKYTADDGTSKTALNKLGGADGKTEVVSIGGKTYAASKAEGHNFKAQPDLAEAAA  401 (494)
T ss_dssp             EEEEEETTEEEEEEECTTSCEEECBCCEECSSSSEECCBCEEESTTSCEEEEEETTEEEEHHHHTTCBTTTSCCCCCCCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCHHCCCCCHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             43223342100012344543123442000222034432100112234320000343111123332011221001213437


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             67777789999999999999998668999999999989999999998643332788899999999999999999999999
Q gi|254780523|r  268 VLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTK  347 (357)
Q Consensus       268 ~~~~~~~~~l~~a~~~i~~~~a~lGa~~~~l~~~~~~l~~~~~~l~~~~s~l~daD~ae~~t~l~~~q~~~qas~~~~a~  347 (357)
                      .....++..||.++++|...|+++|++++|||...+++.+..++++..+|+|+|+||+|++++|+++|+.+||+.+|+++
T Consensus       402 ~~a~~al~~ID~Ai~~V~~~ra~lGA~~nrle~~~~nl~~~~~n~~~~~s~i~DaD~a~e~~~l~~~qi~~Qaa~~~laq  481 (494)
T 1ucu_A          402 TTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLTSVRSRIEDSDYATEVSNMSRAQILQQAGTSVLAQ  481 (494)
T ss_dssp             SCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             88999999999999999999999879999999999999999999999854577140999999999999999999999999


Q ss_pred             HHC
Q ss_conf             736
Q gi|254780523|r  348 LQK  350 (357)
Q Consensus       348 i~~  350 (357)
                      ..+
T Consensus       482 An~  484 (494)
T 1ucu_A          482 ANQ  484 (494)
T ss_dssp             HHH
T ss_pred             HCC
T ss_conf             752



>3k8w_A Flagellin homolog; flagellum, structural protein, bacterial flagellu; 1.70A {Sphingomonas SP} PDB: 2zbi_A 3k8v_A Back     alignment and structure
>2d4x_A Flagellar HOOK-associated protein 3; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1io1_A Phase 1 flagellin; beta-folium, structural protein; 2.00A {Salmonella typhimurium} SCOP: e.32.1.1 Back     alignment and structure
>3k1h_A HP1076, putative uncharacterized protein; FLIS interacting protein, hypothetical protein, chaperone; 1.74A {Helicobacter pylori} Back     alignment and structure
>1ory_B Flagellin; flagellar chaperone, cytosolic export chaperone, FLIS, FLIC; 2.45A {Aquifex aeolicus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target357 flagellar hook-associated protein FlgL [Candidatus Libe
d1io1a_395 Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371 99.95
>d1io1a_ e.32.1.1 (A:) Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Phase 1 flagellin
superfamily: Phase 1 flagellin
family: Phase 1 flagellin
domain: Phase 1 flagellin
species: Salmonella typhimurium [TaxId: 90371]
Probab=99.95  E-value=2.6e-27  Score=166.72  Aligned_cols=90  Identities=7%  Similarity=0.019  Sum_probs=82.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH-HCCCCEE
Q ss_conf             999999999999999999999998888999999999999851378889889999999998656777777652-0024304
Q gi|254780523|r   59 KNHIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANM-TDEGQYL  137 (357)
Q Consensus        59 ~~~l~~~~~n~~~a~~~l~~~e~~L~~i~~~l~~~~~~~v~a~n~t~~~~d~~~~a~e~~~~~~~l~~~aN~-~~~g~~~  137 (357)
                      |..|+|+.+|...+.+||+++|++|+++.++|+|||||+||++|+++++.||+++..|+.+|+++|.+++|. +|+|.+|
T Consensus         2 i~gl~qa~~N~~d~~s~lqtae~al~~~~~iL~r~reLavqaan~t~~~~dr~ai~~E~~~l~~ei~~ia~~T~fng~~L   81 (395)
T d1io1a_           2 IKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVSGQTQFNGVKV   81 (395)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCTTCCHHHHHHHHHHHHHHHHHHHHHHHHCCBTTBCT
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCEECCCCC
T ss_conf             71388999989999999999999999999999999999998505789999999999999999999999997370288022


Q ss_pred             ECCCCCCCCCC
Q ss_conf             10566544321
Q gi|254780523|r  138 FSGINSSEKPL  148 (357)
Q Consensus       138 f~G~~~~~~p~  148 (357)
                      |.|......++
T Consensus        82 l~Gs~~~~~~~   92 (395)
T d1io1a_          82 LAQDNTLTIQV   92 (395)
T ss_dssp             TTSCEEEEEEC
T ss_pred             CCCCCCEEEEE
T ss_conf             35567258972



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target357 flagellar hook-associated protein FlgL [Candidatus Libe
2d4x_A_248 Flagellar HOOK-associated protein 3; multi-domain 100.0
1ucu_A_41-169_400-454184 Phase 1 flagellin; flagellar filament, cryo-electr 100.0
1io1_A_1-117_348-398168 Phase 1 flagellin; beta-folium, structural protein 99.96
2zbi_A_1-113_232-292174 Flagellin homolog; flagellum, structural protein; 99.96
1ory_B_55 Flagellin; flagellar chaperone, cytosolic export c 97.31
1ucu_A_1-40_455-49480 Phase 1 flagellin; flagellar filament, cryo-electr 96.1
1ucu_A_1-40_455-49480 Phase 1 flagellin; flagellar filament, cryo-electr 96.83
2d4y_A_1-268_356-463376 HAP1, flagellar HOOK-associated protein 1; multi-d 91.99
>2d4x_A (A:) Flagellar HOOK-associated protein 3; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 1.90A {Salmonella typhimurium} Back     alignment and structure
Probab=100.00  E-value=7.7e-34  Score=205.20  Aligned_cols=247  Identities=14%  Similarity=0.105  Sum_probs=174.5

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             21289999999999999999999999999999999999998888999999999999851378889889999999998656
Q gi|254780523|r   42 GLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY  121 (357)
Q Consensus        42 ~sddp~~~~~~~~l~~~~~~l~~~~~n~~~a~~~l~~~e~~L~~i~~~l~~~~~~~v~a~n~t~~~~d~~~~a~e~~~~~  121 (357)
                      -||||+++.++++|+.+++++++|.+|+..+.+||+++|++|.++.++|+|+|+++++++||++++++|.+++.|+.+++
T Consensus         1 ~SDDp~~~~~a~~l~~~~~~~~q~~~Ni~~a~~~l~~ae~aL~~i~~~l~~~k~l~vqa~ngt~s~~dr~~i~~ei~~l~   80 (248)
T 2d4x_A            1 MSDDPIAASQAVVLSQAQAQNSQYALARTFATQKVSLEESVLSQVTTAIQTAQEKIVYAGNGTLSDDDRASLATDLQGIR   80 (248)
T ss_dssp             -----------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCTTCCHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             99688999999999999999999999999999999999999999999999999999975147765222899988999988


Q ss_pred             HHHHHHHHH-HCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             777777652-0024304105665443212233333222222210001013454322245665321123332210012334
Q gi|254780523|r  122 ESFVTFANM-TDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQL  200 (357)
Q Consensus       122 ~~l~~~aN~-~~~g~~~f~G~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  200 (357)
                      +++.+++|+ +++|.|+|+|.....+||.................................            .......
T Consensus        81 ~~i~~~an~t~~~g~~lf~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~~~~~  148 (248)
T 2d4x_A           81 DQLMNLANSTDGNGRYIFAGYKTEAAPFDQATGGYHGGEKSVTQQVDSARTMVIGHTGAQI------------FNSITSN  148 (248)
T ss_dssp             HHHHHHHTCBCTTSCBTTSTTCTTSCSBCTTTCCBCSCSSCEEEECSSSCEEEESCCHHHH------------HSCCCTT
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH------------HCCCCCC
T ss_conf             9999998621024531125755466530046754435332111123544322224332011------------0133312


Q ss_pred             CCCCCCCCCCCCEEECCCCCCCEEECCCCCCEEEEEECCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             44445665432001115665200000256410223203531011233333210023344555113566777778999999
Q gi|254780523|r  201 EDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQG  280 (357)
Q Consensus       201 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a  280 (357)
                                                 ..............................................+..++.+
T Consensus       149 ---------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a  201 (248)
T 2d4x_A          149 ---------------------------AVPEPDGSDSEKNLFVMLDTAIAALKTPVEGNNVEKEKAAAAIDKTNRGLKNS  201 (248)
T ss_dssp             ---------------------------CCCCTTSCCCCCCHHHHHHHHHHHHTSCCTTCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ---------------------------CCCCCCCCCCCHHHHHHHHCCCCCHHCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             ---------------------------22222322100023444200000100000000001110001112234678999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             99999999986689999999999899999999986433327888999
Q gi|254780523|r  281 LSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTA  327 (357)
Q Consensus       281 ~~~i~~~~a~lGa~~~~l~~~~~~l~~~~~~l~~~~s~l~daD~ae~  327 (357)
                      ++.+...++.+|++++|++...+.+.....++++.+++++|+|++++
T Consensus       202 ~~~~~~~~~~~g~~~~~l~~~~~~~~~~~~~~~~~~s~i~d~D~a~v  248 (248)
T 2d4x_A          202 LNNVLTVRAELGTQLSELSTLDSLGSDRALGQKLQMSNLVDVDWNSV  248 (248)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHCC-----------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99999999998299999999999899999999999888763283259



>1ucu_A (A:41-169,A:400-454) Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} Back     alignment and structure
>1io1_A (A:1-117,A:348-398) Phase 1 flagellin; beta-folium, structural protein; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2zbi_A (A:1-113,A:232-292) Flagellin homolog; flagellum, structural protein; 2.00A {Sphingomonas SP} Back     alignment and structure
>1ory_B (B:) Flagellin; flagellar chaperone, cytosolic export chaperone, FLIS, FLIC; 2.45A {Aquifex aeolicus} Back     alignment and structure
>1ucu_A (A:1-40,A:455-494) Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} Back     alignment and structure
>1ucu_A (A:1-40,A:455-494) Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} Back     alignment and structure
>2d4y_A (A:1-268,A:356-463) HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium} Back     alignment and structure