254780524

254780524

flagellar hook-associated protein FlgK

GeneID in NCBI database:8209519Locus tag:CLIBASIA_02055
Protein GI in NCBI database:254780524Protein Accession:YP_003064937.1
Gene range:+(758295, 759737)Protein Length:480aa
Gene description:flagellar hook-associated protein FlgK
COG prediction:[N] Flagellar hook-associated protein
KEGG prediction:flgK; flagellar hook-associated protein FlgK; K02396 flagellar hook-associated protein 1 FlgK
SEED prediction:Flagellar hook-associated protein FlgK
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480
MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccEEEEEccccEEEEEEcccEEEEcccccEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEccccccccHHHHccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEcccccEEEEEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccEEEEEcccEEEEcccccEEEEcccccccccccccEEEEccEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEcHHccccHHHcccccccccccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MSLLAVFNKAQNICNNASQQFASIVRNIEnadnknyvrrdtmttispenVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSaddhynnspthYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIkfktaskhdahdfLDQRDVLLQKISEIIGISTivrnnndmvvytsdgttlfetvprdinfekmnsytvtsesnpifIDGVVVssnqgsavpkgKIKALLQIRDSVVPIFQNQLDEMARVLIGsfsekdpiagnsenvpglfiadGIKDLDNKLCQGiseticvnpqyrsnpsflrdggsvsKKFLWNVknlagypdliNHYCdsfnknfifdpvagintNVTLLEYARNSIGWleknrsdshdlhmkSQVVFNHISesysntvgvNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
MSLLAVFNKAQNICNNASQQFASIVRNIenadnknyvrrdtmttispenvtvVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNfntsarevQKIRADADKEIELEISNLRRFLSELTVVNDAIKFktaskhdahdflDQRDVLLQKISEIIGistivrnnndmVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISeticvnpqyrsNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMT****ENV*VVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKE***********PTHYISKLRDSLESYSKN*S**IL*KTVIDNAEEVVQNFNTSAREVQKI*A*ADKEIELEISNLRRFLSELTVVND**************FLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINF***********SNPIFIDGVVV**********GKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKN******************************QEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
*SLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK
MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGVK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target480 flagellar hook-associated protein FlgK [Candidatus Libe
315122285481 flagellar hook-associated protein FlgK [Candidatus Libe 1 0.0
222147590484 flagellar hook-associated protein FlgK [Agrobacterium v 1 2e-94
222084886491 flagellar hook-associated protein [Agrobacterium radiob 1 4e-87
163758033487 hypothetical protein HPDFL43_00370 [Hoeflea phototrophi 1 6e-86
86356331495 flagellar hook-associated protein FlgK [Rhizobium etli 1 1e-85
241203125495 flagellar hook-associated protein FlgK [Rhizobium legum 1 4e-85
325291963492 flagellar hook-associated protein FlgK [Agrobacterium s 1 4e-85
209547947495 flagellar hook-associated protein FlgK [Rhizobium legum 1 5e-85
241113583486 flagellar hook-associated protein FlgK [Rhizobium legum 1 6e-85
116250501495 flagellar hook-associated protein FlgK [Rhizobium legum 1 8e-85
>gi|315122285|ref|YP_004062774.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 481 Back     alignment and organism information
 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/481 (69%), Positives = 397/481 (82%), Gaps = 1/481 (0%)

Query: 1   MSLLAVFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENK 60
           MSL AVFNKAQNI +NAS+QF +IV+NIEN+ NKNYVR+D +T  + +    V QRSEN+
Sbjct: 1   MSLSAVFNKAQNIFSNASEQFFTIVKNIENSGNKNYVRQDIITVNTGDMTVAVKQRSENQ 60

Query: 61  NMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSE 120
           NMF+K+L A SSAIGQQRLL+SFE+LK++M A++ YNNSP+HY++KLRDSL  YS N S 
Sbjct: 61  NMFEKLLDAKSSAIGQQRLLESFESLKDIMGAENKYNNSPSHYMAKLRDSLSVYSNNPST 120

Query: 121 DILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFK 180
           DI GK +I +A  +V N NTS++E+QKIRA ADKEI++E+S LR FLSELTVVND IKFK
Sbjct: 121 DIFGKQIISDANALVYNLNTSSKEIQKIRAGADKEIDIEVSKLRGFLSELTVVNDQIKFK 180

Query: 181 TASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKM 240
           T +KHD H+ LD+RD LLQ ISE IGISTI+RNNND+++YTSDGTTLFETVPR+INFEKM
Sbjct: 181 TVAKHDTHELLDKRDALLQNISEEIGISTIIRNNNDIIIYTSDGTTLFETVPRNINFEKM 240

Query: 241 NSYTVTSESNPIFIDGVVVS-SNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
           + Y+ TSES  + IDGV VS  +Q    PKG+IKALL IRD+V+P+FQNQLDE++R LI 
Sbjct: 241 DLYSATSESKSVVIDGVKVSIPDQTHTAPKGRIKALLHIRDNVIPMFQNQLDEISRSLIS 300

Query: 300 SFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSK 359
            FSEKDP+AG S++V GLFIADG+KD  NKL +G+SE I VNPQY+SNP FLRDGGSVSK
Sbjct: 301 GFSEKDPVAGRSQDVLGLFIADGLKDPGNKLYKGMSEIIRVNPQYQSNPFFLRDGGSVSK 360

Query: 360 KFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSH 419
             LWNVK  A Y  LINHYCDSFN  F FD   GI TNV+LLEYA+NSIGWLEKNRS SH
Sbjct: 361 NHLWNVKGFAEYSGLINHYCDSFNAMFSFDSATGIGTNVSLLEYAKNSIGWLEKNRSTSH 420

Query: 420 DLHMKSQVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEGV 479
           D  MK+QVVFNHISESYSNT GVNLQ+ELSFLIKVEQSYNISNKL+M  ++ML TLLEG+
Sbjct: 421 DSRMKNQVVFNHISESYSNTTGVNLQDELSFLIKVEQSYNISNKLMMSINRMLNTLLEGI 480

Query: 480 K 480
           K
Sbjct: 481 K 481


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147590|ref|YP_002548547.1| flagellar hook-associated protein FlgK [Agrobacterium vitis S4] Length = 484 Back     alignment and organism information
>gi|222084886|ref|YP_002543415.1| flagellar hook-associated protein [Agrobacterium radiobacter K84] Length = 491 Back     alignment and organism information
>gi|163758033|ref|ZP_02165121.1| hypothetical protein HPDFL43_00370 [Hoeflea phototrophica DFL-43] Length = 487 Back     alignment and organism information
>gi|86356331|ref|YP_468223.1| flagellar hook-associated protein FlgK [Rhizobium etli CFN 42] Length = 495 Back     alignment and organism information
>gi|241203125|ref|YP_002974221.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 495 Back     alignment and organism information
>gi|325291963|ref|YP_004277827.1| flagellar hook-associated protein FlgK [Agrobacterium sp. H13-3] Length = 492 Back     alignment and organism information
>gi|209547947|ref|YP_002279864.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 495 Back     alignment and organism information
>gi|241113583|ref|YP_002973418.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 486 Back     alignment and organism information
>gi|116250501|ref|YP_766339.1| flagellar hook-associated protein FlgK [Rhizobium leguminosarum bv. viciae 3841] Length = 495 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target480 flagellar hook-associated protein FlgK [Candidatus Libe
PRK07521483 PRK07521, flgK, flagellar hook-associated protein FlgK; 1e-109
COG1256552 COG1256, FlgK, Flagellar hook-associated protein [Cell 7e-43
TIGR02492322 TIGR02492, flgK_ends, flagellar hook-associated protein 2e-33
PRK06665 627 PRK06665, flgK, flagellar hook-associated protein FlgK; 2e-10
PRK06945 651 PRK06945, flgK, flagellar hook-associated protein FlgK; 6e-08
PRK08147547 PRK08147, flgK, flagellar hook-associated protein FlgK; 1e-06
PRK05683 676 PRK05683, flgK, flagellar hook-associated protein FlgK; 2e-04
PRK08871 626 PRK08871, flgK, flagellar hook-associated protein FlgK; 4e-04
PRK07739507 PRK07739, flgK, flagellar hook-associated protein FlgK; 4e-17
PRK08471613 PRK08471, flgK, flagellar hook-associated protein FlgK; 1e-04
PRK12714 624 PRK12714, flgK, flagellar hook-associated protein FlgK; 3e-04
>gnl|CDD|181014 PRK07521, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|31448 COG1256, FlgK, Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|162886 TIGR02492, flgK_ends, flagellar hook-associated protein FlgK Back     alignment and domain information
>gnl|CDD|180650 PRK06665, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|180769 PRK06945, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|181252 PRK08147, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|168176 PRK05683, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|181572 PRK08871, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|181099 PRK07739, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|181438 PRK08471, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|183697 PRK12714, flgK, flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 480 flagellar hook-associated protein FlgK [Candidatus Libe
PRK07521482 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK07739500 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK08147547 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK07191456 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK06665628 flgK flagellar hook-associated protein FlgK; Validated 100.0
COG1256552 FlgK Flagellar hook-associated protein [Cell motility a 100.0
PRK08471612 flgK flagellar hook-associated protein FlgK; Validated 100.0
TIGR02492495 flgK_ends flagellar hook-associated protein FlgK; Inter 100.0
PRK12714624 flgK flagellar hook-associated protein FlgK; Provisiona 100.0
PRK12715649 flgK flagellar hook-associated protein FlgK; Provisiona 100.0
PRK06945649 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK08871626 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK05683676 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK06799431 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK06803398 flgE flagellar hook protein FlgE; Validated 100.0
COG1749423 FlgE Flagellar hook protein FlgE [Cell motility and sec 100.0
PRK12637473 flgE flagellar hook protein FlgE; Provisional 100.0
PRK05682414 flgE flagellar hook protein FlgE; Validated 100.0
TIGR02488263 flgG_G_neg flagellar basal-body rod protein FlgG; Inter 100.0
PRK08425716 flgE flagellar hook protein FlgE; Validated 100.0
PRK05841605 flgE flagellar hook protein FlgE; Validated 100.0
TIGR02489877 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR 100.0
PRK12636263 flgG flagellar basal body rod protein FlgG; Provisional 100.0
COG4786265 FlgG Flagellar basal body rod protein [Cell motility an 100.0
PRK12691262 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12693261 flgG flagellar basal body rod protein FlgG; Provisional 100.0
PRK12816264 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12694260 flgG flagellar basal body rod protein FlgG; Reviewed 99.98
PRK12692262 flgG flagellar basal body rod protein FlgG; Reviewed 99.97
PRK12817261 flgG flagellar basal body rod protein FlgG; Reviewed 99.96
PRK12640246 flgF flagellar basal body rod protein FlgF; Reviewed 99.96
PRK12689253 flgF flagellar basal body rod protein FlgF; Reviewed 99.95
PRK12642241 flgF flagellar basal body rod protein FlgF; Reviewed 99.95
PRK12641252 flgF flagellar basal body rod protein FlgF; Reviewed 99.94
PRK12819257 flgG flagellar basal body rod protein FlgG; Reviewed 99.94
PRK12690237 flgF flagellar basal body rod protein FlgF; Reviewed 99.94
TIGR02490254 flgF flagellar basal-body rod protein FlgF; InterPro: I 99.57
PRK05681139 flgC flagellar basal body rod protein FlgC; Reviewed 99.22
PRK12632130 flgC flagellar basal body rod protein FlgC; Provisional 99.09
TIGR01395147 FlgC flagellar basal-body rod protein FlgC; InterPro: I 99.0
PRK12782138 flgC flagellar basal body rod protein FlgC; Reviewed 98.99
PRK12631138 flgC flagellar basal body rod protein FlgC; Provisional 98.96
PRK12628140 flgC flagellar basal body rod protein FlgC; Provisional 98.95
COG1558137 FlgC Flagellar basal body rod protein [Cell motility an 98.92
PRK12630143 flgC flagellar basal body rod protein FlgC; Provisional 98.92
PRK12629135 flgC flagellar basal body rod protein FlgC; Provisional 98.89
PRK06802141 flgC flagellar basal body rod protein FlgC; Reviewed 98.88
COG4787251 FlgF Flagellar basal body rod protein [Cell motility an 97.99
COG1344360 FlgL Flagellin and related hook-associated proteins [Ce 96.37
PRK12804307 flagellin; Provisional 96.12
PRK12802282 flagellin; Provisional 95.32
PRK12807287 flagellin; Provisional 95.14
COG1815133 FlgB Flagellar basal body protein [Cell motility and se 94.99
PRK08869377 flagellin; Reviewed 93.44
PRK08412777 flgL flagellar hook-associated protein FlgL; Validated 93.44
PRK06819371 flagellin; Validated 92.6
PRK08870403 flgL flagellar hook-associated protein FlgL; Reviewed 91.48
PRK07701301 flgL flagellar hook-associated protein FlgL; Validated 90.56
PRK12818255 flgG flagellar basal body rod protein FlgG; Reviewed 99.95
TIGR03506231 FlgEFG_subfam fagellar hook-basal body proteins. This m 99.92
PRK12643209 flgF flagellar basal body rod protein FlgF; Reviewed 99.4
COG4787251 FlgF Flagellar basal body rod protein [Cell motility an 97.56
pfam0642939 DUF1078 Domain of unknown function (DUF1078). This fami 99.19
PRK12627128 flgB flagellar basal body rod protein FlgB; Provisional 96.14
PRK06003126 flgB flagellar basal body rod protein FlgB; Reviewed 95.95
PRK06004126 flgB flagellar basal body rod protein FlgB; Reviewed 95.63
PRK05680137 flgB flagellar basal body rod protein FlgB; Reviewed 95.38
PRK12623131 flgB flagellar basal body rod protein FlgB; Provisional 94.78
PRK12622135 flgB flagellar basal body rod protein FlgB; Provisional 94.52
PRK12624143 flgB flagellar basal body rod protein FlgB; Provisional 94.2
PRK05681139 flgC flagellar basal body rod protein FlgC; Reviewed 99.17
PRK12632130 flgC flagellar basal body rod protein FlgC; Provisional 99.02
PRK12631138 flgC flagellar basal body rod protein FlgC; Provisional 98.89
PRK06802141 flgC flagellar basal body rod protein FlgC; Reviewed 98.84
PRK12782138 flgC flagellar basal body rod protein FlgC; Reviewed 98.84
PRK12629135 flgC flagellar basal body rod protein FlgC; Provisional 98.83
PRK12630143 flgC flagellar basal body rod protein FlgC; Provisional 98.8
PRK12628140 flgC flagellar basal body rod protein FlgC; Provisional 98.75
pfam0046031 Flg_bb_rod Flagella basal body rod protein. 98.71
COG1558137 FlgC Flagellar basal body rod protein [Cell motility an 98.69
PRK12622135 flgB flagellar basal body rod protein FlgB; Provisional 98.55
PRK12621136 flgB flagellar basal body rod protein FlgB; Provisional 98.48
PRK12619130 flgB flagellar basal body rod protein FlgB; Provisional 98.45
TIGR01395147 FlgC flagellar basal-body rod protein FlgC; InterPro: I 98.44
PRK12625132 flgB flagellar basal body rod protein FlgB; Provisional 98.39
PRK12624143 flgB flagellar basal body rod protein FlgB; Provisional 98.39
PRK05680137 flgB flagellar basal body rod protein FlgB; Reviewed 98.35
PRK12623131 flgB flagellar basal body rod protein FlgB; Provisional 98.35
COG1815133 FlgB Flagellar basal body protein [Cell motility and se 98.33
PRK12620132 flgB flagellar basal body rod protein FlgB; Provisional 98.32
PRK12685116 flgB flagellar basal body rod protein FlgB; Reviewed 98.22
PRK12626162 flgB flagellar basal body rod protein FlgB; Provisional 98.16
PRK06003126 flgB flagellar basal body rod protein FlgB; Reviewed 98.13
PRK06797135 flgB flagellar basal body rod protein FlgB; Reviewed 98.02
PRK07182148 flgB flagellar basal body rod protein FlgB; Reviewed 98.01
PRK06004126 flgB flagellar basal body rod protein FlgB; Reviewed 97.95
PRK12627128 flgB flagellar basal body rod protein FlgB; Provisional 97.68
TIGR01396134 FlgB flagellar basal-body rod protein FlgB; InterPro: I 94.39
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06803 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>COG1749 FlgE Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>PRK12637 flgE flagellar hook protein FlgE; Provisional Back     alignment and domain information
>PRK05682 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>TIGR02488 flgG_G_neg flagellar basal-body rod protein FlgG; InterPro: IPR012834 This family consists of the FlgG protein of the flagellar apparatus in the proteobacteria and spirochetes Back     alignment and domain information
>PRK08425 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK05841 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) Back     alignment and domain information
>PRK12636 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>COG4786 FlgG Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK12691 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12693 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>PRK12816 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12694 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12692 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12817 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12640 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12642 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12641 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12819 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12690 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>TIGR02490 flgF flagellar basal-body rod protein FlgF; InterPro: IPR012836 Members of this protein are FlgF, one of several homologous flagellar basal-body rod proteins in bacteria Back     alignment and domain information
>PRK05681 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>TIGR01395 FlgC flagellar basal-body rod protein FlgC; InterPro: IPR006299 These sequences represent FlgC, one of several components of bacterial flagella Back     alignment and domain information
>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12631 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12628 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK12630 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12629 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>COG4787 FlgF Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>COG1344 FlgL Flagellin and related hook-associated proteins [Cell motility and secretion] Back     alignment and domain information
>PRK12804 flagellin; Provisional Back     alignment and domain information
>PRK12802 flagellin; Provisional Back     alignment and domain information
>PRK12807 flagellin; Provisional Back     alignment and domain information
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>PRK08869 flagellin; Reviewed Back     alignment and domain information
>PRK08412 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>PRK06819 flagellin; Validated Back     alignment and domain information
>PRK08870 flgL flagellar hook-associated protein FlgL; Reviewed Back     alignment and domain information
>PRK07701 flgL flagellar hook-associated protein FlgL; Validated Back     alignment and domain information
>PRK12818 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>TIGR03506 FlgEFG_subfam fagellar hook-basal body proteins Back     alignment and domain information
>PRK12643 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>COG4787 FlgF Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>pfam06429 DUF1078 Domain of unknown function (DUF1078) Back     alignment and domain information
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12623 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12622 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12624 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK05681 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12631 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12629 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12630 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12628 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>pfam00460 Flg_bb_rod Flagella basal body rod protein Back     alignment and domain information
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK12622 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12621 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12619 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>TIGR01395 FlgC flagellar basal-body rod protein FlgC; InterPro: IPR006299 These sequences represent FlgC, one of several components of bacterial flagella Back     alignment and domain information
>PRK12625 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12624 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12623 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12626 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK06797 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK07182 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>TIGR01396 FlgB flagellar basal-body rod protein FlgB; InterPro: IPR006300 Many bacterial species swim actively by means of flagella Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target480 flagellar hook-associated protein FlgK [Candidatus Libe
3a69_A402 Atomic Model Of The Bacterial Flagellar Hook Based 3e-21
2d4y_A463 Crystal Structure Of A 49k Fragment Of Hap1 (Flgk) 7e-20
2d4y_A463 Crystal Structure Of A 49k Fragment Of Hap1 (Flgk) 1e-05
>gi|281306984|pdb|3A69|A Chain A, Atomic Model Of The Bacterial Flagellar Hook Based On Docking An X-Ray Derived Structure And Terminal Two Alpha- Helices Into An 7.1 Angstrom Resolution Cryoem Map Length = 402 Back     alignment and structure
 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/473 (9%), Positives = 109/473 (23%), Gaps = 72/473 (15%)

Query: 6   VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTISPENVTVVTQRSENKNMFDK 65
            F++A +  N A+     I  NI N+    +               V             
Sbjct: 1   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVG------------ 48

Query: 66  VLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGK 125
                        L      + +  +     N      ++  ++       +       +
Sbjct: 49  -------------LGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSR 95

Query: 126 TVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTASKH 185
                 +E     N    ++    A        +              N A      +  
Sbjct: 96  NGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQ------------GANPAPITIPNTLM 143

Query: 186 DAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEKMNSYTV 245
            A         +    ++ +   T    ++          T++++     +       T 
Sbjct: 144 AAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTK 203

Query: 246 TSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIGSFSEKD 305
            +E      D    ++   +                        L      ++ S    +
Sbjct: 204 DNEWAVYTHDSSDPAATAPTTAS-------------------TTLKFNENGILESGGTVN 244

Query: 306 PIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNV 365
              G                            +    Q     + +    +  K      
Sbjct: 245 ITTGTING--------------ATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVS 290

Query: 366 KNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKS 425
             +     ++ +Y +   +      +A    N  L     N   W     S    L    
Sbjct: 291 YQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNV--WAATQASGVALLGTAG 348

Query: 426 QVVFNHISESYSNTVGVNLQEELSFLIKVEQSYNISNKLIMFTDKMLQTLLEG 478
              F  ++        V+L +EL  +I  +++Y  + + I   D++L TL+  
Sbjct: 349 SGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNL 401


>gi|119389100|pdb|2D4Y|A Chain A, Crystal Structure Of A 49k Fragment Of Hap1 (Flgk) Length = 463 Back     alignment and structure
>gi|119389100|pdb|2D4Y|A Chain A, Crystal Structure Of A 49k Fragment Of Hap1 (Flgk) Length = 463 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target480 flagellar hook-associated protein FlgK [Candidatus Libe
2d4y_A463 HAP1, flagellar HOOK-associated protein 1; multi-domain 4e-19
2pff_A1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 1e-04
>2d4y_A HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium} Length = 463 Back     alignment and structure
 Score = 91.5 bits (226), Expect = 4e-19
 Identities = 40/257 (15%), Positives = 102/257 (39%), Gaps = 5/257 (1%)

Query: 62  MFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSED 121
           + +++  A + + G     +    +  +++      +S +  +     SL++   N  + 
Sbjct: 7   ITNQLRGAQNQSSGLTTRYEQMSKIDNLLADKS---SSLSGSLQSFFTSLQTLVSNAEDP 63

Query: 122 ILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK--F 179
              + +I  AE +V  F T+ + ++      +  I   ++ +  +  ++  +ND I    
Sbjct: 64  AARQALIGKAEGLVNQFKTTDQYLRDQDKQVNIAIGSSVAQINNYAKQIANLNDQISRMT 123

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
              +    +D LDQRD L+ ++++I+G+   V++     +  ++G TL +          
Sbjct: 124 GVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMANGYTLVQGSTARQLAAV 183

Query: 240 MNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLIG 299
            +S   T  +     +           +  G +  LL  R   +   +N L ++A     
Sbjct: 184 PSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLLTFRSQDLDQTRNTLGQLALAFAD 243

Query: 300 SFSEKDPIAGNSENVPG 316
           +F+ +     +++   G
Sbjct: 244 AFNAQHTKGYDADGNKG 260


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target480 flagellar hook-associated protein FlgK [Candidatus Libe
3a69_A402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 100.0
2d4y_A463 HAP1, flagellar HOOK-associated protein 1; multi-domain 100.0
1wlg_A299 Flagellar HOOK protein FLGE; EAR-& motif, structural pr 98.89
1ucu_A494 Phase 1 flagellin; flagellar filament, cryo-electron mi 95.69
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure
Probab=100.00  E-value=0  Score=321.85  Aligned_cols=115  Identities=14%  Similarity=0.036  Sum_probs=88.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEEC------CCCEEEEEEEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999999867874420257899812679998604------660699899872068878887754445567887
Q gi|254780524|r    6 VFNKAQNICNNASQQFASIVRNIENADNKNYVRRDTMTTIS------PENVTVVTQRSENKNMFDKVLHAHSSAIGQQRL   79 (480)
Q Consensus         6 sl~~~~SGL~a~q~~ldvisnNIANvnT~Gyk~~~~~f~~~------~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (480)
                      |||+|+|||+|||++|+||||||||+||+||||+|++|+++      +.||.+..++|+   +.++.+..+...++.++.
T Consensus         1 s~~~a~sGl~A~q~al~vts~NIANaNT~GYsRq~v~f~~~~~~~~~G~GV~v~~v~r~---~~qg~~~~t~~~~d~ai~   77 (402)
T 3a69_A            1 SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQD---FTDGTTTNTGRGLDVAIS   77 (402)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHC-------------------------------------------------CEECCCS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHHCCCCCCCCEEEEEEEEE---CCCCCEEECCCCCHHEEC
T ss_conf             97899999999997357888889877764206570207776466877674477678984---145645764760030142


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHH
Q ss_conf             87899888651267777764011366777668764138675300112210
Q gi|254780524|r   80 LQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVID  129 (480)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  129 (480)
                      +.+||...      ......+++|.+.|..+..+.+.++.+..+.++...
T Consensus        78 ~~g~f~~~------~~~g~~~~tr~g~~~~~~~g~lvn~~g~~l~g~~~~  121 (402)
T 3a69_A           78 QNGFFRLV------DSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPAT  121 (402)
T ss_dssp             SSCEEEEE------CTTCCEEEESCCEEEECTTSCEECTTCCEEEEEECB
T ss_pred             CCCEEEEE------CCCCCEEEEECCCCCCCCCCCEECCCCCEEECCCCC
T ss_conf             78617886------279864364156534278887863789644123145



>2d4y_A HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium} Back     alignment and structure
>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} SCOP: b.152.1.1 PDB: 2bgy_A 2bgz_A Back     alignment and structure
>1ucu_A Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} SCOP: e.32.1.1 PDB: 3a5x_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target480 flagellar hook-associated protein FlgK [Candidatus Libe
d1wlga_293 Flagellar hook protein flgE {Salmonella typhimurium [Ta 97.86
>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: All beta proteins
fold: Flagellar hook protein flgE
superfamily: Flagellar hook protein flgE
family: Flagellar hook protein flgE
domain: Flagellar hook protein flgE
species: Salmonella typhimurium [TaxId: 90371]
Probab=97.86  E-value=3.8e-10  Score=76.67  Aligned_cols=83  Identities=12%  Similarity=0.055  Sum_probs=65.1

Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             66665555666544310245676642011112333345677652899998777887664211123223456799999998
Q gi|254780524|r  356 SVSKKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISES  435 (480)
Q Consensus       356 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~t~~sg~~~~~~~~~~~~g~i~~~  435 (480)
                      ............+..++.....+.++........+++.+.+...|.....+.  |.++..||.+.+++|+++++|+|.++
T Consensus       211 dG~~~G~l~~~~i~~dG~i~~~ysNG~~~~lgqiala~F~Np~gL~~~g~n~--f~~t~~SG~~~~g~~g~~g~G~i~~g  288 (293)
T d1wlga_         211 NGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNV--WAATQASGVALLGTAGSGNFGKLTNG  288 (293)
T ss_dssp             CCBCCBCEEEEEECTTCEEEEEETTSCEEEEEEECEEECSCGGGSEECSTTC--EECCTTTCCCEEECTTBTTBCCCSSC
T ss_pred             CCCCCEEEEEEEECCCEEEEEEECCCCEEEEEEEEEEEECCHHHHHHCCCCE--EECCCCCCCCEECCCCCCCCEEEECC
T ss_conf             8843112321066587589999769967898899999735968732125970--87600168855568998882238426


Q ss_pred             HHHHH
Q ss_conf             87662
Q gi|254780524|r  436 YSNTV  440 (480)
Q Consensus       436 ~lE~S  440 (480)
                      +||+|
T Consensus       289 ~LE~S  293 (293)
T d1wlga_         289 ALEAS  293 (293)
T ss_dssp             EEEEC
T ss_pred             CEECC
T ss_conf             13169



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 480 flagellar hook-associated protein FlgK [Candidatus
2d4y_A_1-268_356-463376 (A:1-268,A:356-463) HAP1, flagellar HOOK-associate 2e-32
>2d4y_A (A:1-268,A:356-463) HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium}Length = 376 Back     alignment and structure
 Score =  134 bits (339), Expect = 2e-32
 Identities = 56/395 (14%), Positives = 134/395 (33%), Gaps = 28/395 (7%)

Query: 62  MFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSED 121
           + +++  A + + G     +    +  +++      +S +  +     SL++   N  + 
Sbjct: 7   ITNQLRGAQNQSSGLTTRYEQMSKIDNLLADKS---SSLSGSLQSFFTSLQTLVSNAEDP 63

Query: 122 ILGKTVIDNAEEVVQNFNTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIK--F 179
              + +I  AE +V  F T+ + ++      +  I   ++ +  +  ++  +ND I    
Sbjct: 64  AARQALIGKAEGLVNQFKTTDQYLRDQDKQVNIAIGSSVAQINNYAKQIANLNDQISRMT 123

Query: 180 KTASKHDAHDFLDQRDVLLQKISEIIGISTIVRNNNDMVVYTSDGTTLFETVPRDINFEK 239
              +    +D LDQRD L+ ++++I+G+   V++     +  ++G TL +          
Sbjct: 124 GVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMANGYTLVQG-STARQLAA 182

Query: 240 MNSYTVTSESNPIFIDGV-VVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMARVLI 298
           + S    + +   ++D            +  G +  LL  R   +   +N L ++A    
Sbjct: 183 VPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLLTFRSQDLDQTRNTLGQLALAFA 242

Query: 299 GSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVS 358
            +F+ +     +++   G         + +     +  T        S      D  +  
Sbjct: 243 DAFNAQHTKGYDADGNKGKDFFSIGSAIVDM---NVKVTNEAEIAMASESKLDPDVDTGD 299

Query: 359 KKFLWNVKNLAGYPDLINHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDS 418
                N + L    +                    +  N T  +     +  +    S  
Sbjct: 300 SDNR-NGQALLDLQN-----------------SNVVGGNKTFNDAYATLVSDVGNKTSTL 341

Query: 419 HDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIK 453
                    V   + +   +  GVNL EE   L +
Sbjct: 342 KTSSTTQANVVKQLYKQQQSVSGVNLDEEYGNLQR 376


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target480 flagellar hook-associated protein FlgK [Candidatus Libe
2d4y_A_1-268_356-463376 HAP1, flagellar HOOK-associated protein 1; multi-d 100.0
>2d4y_A (A:1-268,A:356-463) HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium} Back     alignment and structure
Probab=100.00  E-value=3e-33  Score=221.62  Aligned_cols=371  Identities=15%  Similarity=0.162  Sum_probs=290.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCCC
Q ss_conf             06887888775444556788787899888651267777764011366777668764138675300112210122222210
Q gi|254780524|r   59 NKNMFDKVLHAHSSAIGQQRLLQSFEALKEMMSADDHYNNSPTHYISKLRDSLESYSKNLSEDILGKTVIDNAEEVVQNF  138 (480)
Q Consensus        59 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  138 (480)
                      .|.|+..+++...+..++...........+.+|..+  ..++...+..|+..|..+..+|.+...+..++..+..++..+
T Consensus         3 ~D~fl~~q~r~~~s~~~~~~~~~~~l~~le~~~~e~--~~gl~~~l~~ff~a~~~ls~~P~~~~~R~~vl~~a~~L~~~~   80 (376)
T 2d4y_A            3 YDAFITNQLRGAQNQSSGLTTRYEQMSKIDNLLADK--SSSLSGSLQSFFTSLQTLVSNAEDPAARQALIGKAEGLVNQF   80 (376)
T ss_dssp             -CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCT--TTCHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             579999999999877778999999999999985899--877899999999999999868798899999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC--CCCCCCCHHHHHHHHHHHHCCEEEEEEEECCCCE
Q ss_conf             00224565665432000111278788754343210112223456--6765210012100001010020124787337711
Q gi|254780524|r  139 NTSAREVQKIRADADKEIELEISNLRRFLSELTVVNDAIKFKTA--SKHDAHDFLDQRDVLLQKISEIIGISTIVRNNND  216 (480)
Q Consensus       139 ~~~~~~~~~~~~~~~~~~~~~v~~~n~~~~~~~~~n~~~~~~~~--~~~~~~~~~d~~~~~~~~~s~~~~~~~~~~~~~~  216 (480)
                      +..+..+..++......+...|.++|.++.+++.+|..|.....  .+..+++++|+||.+++++++++++.+....++.
T Consensus        81 n~~~~~L~~l~~~~~~~i~~~V~~iN~l~~~Ia~LN~~I~~~~~~~~g~~~ndLlDqRD~ll~eLS~~i~i~v~~~~~G~  160 (376)
T 2d4y_A           81 KTTDQYLRDQDKQVNIAIGSSVAQINNYAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGT  160 (376)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--------CHHHHHHHHHHHHHHHHSCEEEEEETTTE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             99999999999999999999999999999999999999999861468999067789999999998766070478627885


Q ss_pred             EEEECCCCEEEECCCCCE-EEEEECCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHH
Q ss_conf             478706970610344412-5763045666766432167336556656776667653111011102331367787887655
Q gi|254780524|r  217 MVVYTSDGTTLFETVPRD-INFEKMNSYTVTSESNPIFIDGVVVSSNQGSAVPKGKIKALLQIRDSVVPIFQNQLDEMAR  295 (480)
Q Consensus       217 ~~v~~~~g~~l~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  295 (480)
                      +.|+..+|.+|++..... +..... ...........................+|+++|+..+|+..++.++..++.++.
T Consensus       161 v~V~~~~G~~LV~g~~~~~l~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~gG~l~gll~~rd~~l~~~~~~Ld~lA~  239 (376)
T 2d4y_A          161 YNLTMANGYTLVQGSTARQLAAVPS-SADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLLTFRSQDLDQTRNTLGQLAL  239 (376)
T ss_dssp             EEEEETTCCEEEETTEECCEEEEEC-SSCTTCEEEEEEETTTEEEECCGGGGCSHHHHHHHHHHHHTHHHHHHHHHHHHH
T ss_pred             EEEEECCCEEECCCCCCCEEEEECC-CCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             1267279715035775320465204-677775226773267775445534467521002678864202456778999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             43100123455777777654321122345666654332222223333346662100024566665555666544310245
Q gi|254780524|r  296 VLIGSFSEKDPIAGNSENVPGLFIADGIKDLDNKLCQGISETICVNPQYRSNPSFLRDGGSVSKKFLWNVKNLAGYPDLI  375 (480)
Q Consensus       296 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  375 (480)
                      .+++.++..|..|.+..+..+..++..........         ....+..++....     ......+.....++....
T Consensus       240 ~la~~~N~~~~~G~~~~g~~g~~~f~~~~~~~~~~---------~~~~~~~~~~~~~-----~~~~~~~~~~~~gDn~na  305 (376)
T 2d4y_A          240 AFADAFNAQHTKGYDADGNKGKDFFSIGSAIVDMN---------VKVTNEAEIAMAS-----ESKLDPDVDTGDSDNRNG  305 (376)
T ss_dssp             HHHHHHHHHHTTSBCTTSCBCCCCEECCCTTTTCE---------ECCCCGGGCCCBS-----SCCC--------CCCHHH
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHH---------HHCCCHHHHHHCC-----CCCCCCCCCCCCCCHHHH
T ss_conf             99998887540256777877865312355565303---------4227878764305-----565578766788867999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             676642011112333345677652899998777887664211123223456799999998876628888999999999
Q gi|254780524|r  376 NHYCDSFNKNFIFDPVAGINTNVTLLEYARNSIGWLEKNRSDSHDLHMKSQVVFNHISESYSNTVGVNLQEELSFLIK  453 (480)
Q Consensus       376 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~t~~sg~~~~~~~~~~~~g~i~~~~lE~SNVDL~eE~tnLI~  453 (480)
                      .....      .. ......++.+|.++|..+++.+++.++.+....+..+..+.++...+.+.|+|+|+||++|||+
T Consensus       306 ~~l~~------lq-~~~~~~g~~T~~~~y~~~v~~vG~~~~~a~~~~~~~~~~~~~~~~~r~svSGVnlDEE~anlik  376 (376)
T 2d4y_A          306 QALLD------LQ-NSNVVGGNKTFNDAYATLVSDVGNKTSTLKTSSTTQANVVKQLYKQQQSVSGVNLDEEYGNLQR  376 (376)
T ss_dssp             HHHHG------GG-GSCCBTTTBCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---------------
T ss_pred             HHHHH------CH-HCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCC
T ss_conf             99984------31-2357689863999999999999999999999999999999999999984206179999998549