254780525

254780525

flagellar hook protein FlgE

GeneID in NCBI database:8209520Locus tag:CLIBASIA_02060
Protein GI in NCBI database:254780525Protein Accession:YP_003064938.1
Gene range:+(757006, 758271)Protein Length:421aa
Gene description:flagellar hook protein FlgE
COG prediction:none
KEGG prediction:flgE; flagellar hook protein FlgE; K02390 flagellar hook protein FlgE
SEED prediction:Flagellar hook protein FlgE
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-
MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccccccccccEEEEEEEEEccccccEEEcccccEEEEcccEEEEEEcccccEEEEEcccccccccccEEcccccEEEEEEcccccccEEEccccccEEEEcccccccccccccccEEEEEccccccccccccccccccccccccccccEEEccccccEEEEEEEEEcccccEEEEEEcccccccccccccccccccEEEEEccccccccccccEEEEEcccccccccEEEEEEcccEEEccccccccccccccccccccEEEEccccEEEEEEccccEEEEEEEEEEEcccHHHHHHccccEEEEcccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHcccccccHHcccccccccccHHHHHHHHcccccccccccEEEEEEEEEcccccEEccccccEEEEEcccEEEEEcccccEEEEEcccEEEcccccEEcccccEEEEEEccccccccEEEccccccccEccccccccccccEEEEEEEccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEEEcccccEEEEEEEccccccccccccccccccEEEEEccccccccccccEEEEccccccccccEEEEEcccccEcccccccEEEccccccccEEEEEEEccccEEEEEEEcccEEEEEEEEEEEcccccccccccccEEEEcccccccEEcccccccccEEccccHHHccccHHHHHHHHHHHHHHHHHHcHEEEccHHHHHHHHHHcc
MGILGSMKTAMsgmdaqsnrvsavsdnianvdtvgykrTAIAFSslvfpstsnsyvsgglEISTKDMISeqgslmhtasntdlaiqgkgffivkgrdnvncltragdfhinnegflenvaGGVLlgyplknasaplivnsFQGLERINVkhaelsamptttgfisnnldknatiitpdktpkhngrdaeythkssfaaydTLGSSVVYDVYytktgdkkwevsifrqdqstnnsfpynvaplntvevsfdpvtgylansshkaisfndntsgidqqiTIDIskttqlaggfipqkseinghapgkpkdfsvskdgyvdiiyddgtrvpIYRLAIatvpsednlklfdgntylptrdsgdisigfpghnqhgeifsGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR
MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSslvfpstsnsYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMptttgfisnnldkNATIItpdktpkhngrdaeythkssfaaydtlgSSVVYDVYYTKTGDKKWEVSIFrqdqstnnsFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPqkseinghapgkpkdfsvskDGYVDIIYDDGTRVPIYRLAIatvpsednlkLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAvnskvfqtgsdFMDILISLKR
MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR
*GILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF**************STKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAEL*****TTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR
MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR
*GILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR
MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR
MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target421 flagellar hook protein FlgE [Candidatus Liberibacter as
254780378262 flagellar basal body rod protein FlgG [Candidatus 3e-11
254780378262 flagellar basal body rod protein FlgG [Candidatus 2e-09
254780685243 flagellar basal body rod protein FlgF [Candidatus 1e-10
254780380134 flagellar basal body rod protein FlgC [Candidatus 0.001
>gi|254780378|ref|YP_003064791.1| flagellar basal body rod protein FlgG [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 61.2 bits (147), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 71/132 (53%), Gaps = 16/132 (12%)

Query: 10  AMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVF--------PSTSNSY------ 55
           A +GM AQ   +  +++NIAN++T GYKR    F+  ++        PS S         
Sbjct: 7   AAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEG 66

Query: 56  --VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNE 113
             +  G++IS+   +  QG ++HT +N DLA+ G+G+F V+  D     TRAG F+I+++
Sbjct: 67  ISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSK 126

Query: 114 GFLENVAGGVLL 125
           G L    G  L+
Sbjct: 127 GQLVTADGNTLV 138

>gi|254780378|ref|YP_003064791.1| flagellar basal body rod protein FlgG [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 77/161 (47%), Gaps = 16/161 (9%)

Query: 262 KAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIY 321
           +A SFN ++ G  Q +T D    T + G  IP+++          ++  VS+ G +  + 
Sbjct: 117 RAGSFNIDSKG--QLVTAD--GNTLVPGIVIPEET----------REIKVSRSGQILAVT 162

Query: 322 DDGTRV-PIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALET 380
              +   P+ +L IA   +E  L+    N    T  SGD  I  P       +  G LE 
Sbjct: 163 GKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEA 222

Query: 381 ANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLKR 421
           +NVD   E++E+I AQR Y +NSKV +  +D M  LI+  R
Sbjct: 223 SNVDAVKEISEMISAQRAYEMNSKVIE-AADEMSSLITKMR 262

>gi|254780685|ref|YP_003065098.1| flagellar basal body rod protein FlgF [Candidatus Liberibacter asiaticus str. psy62] Length = 243 Back     alignment
 Score = 59.3 bits (142), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 71/137 (51%), Gaps = 15/137 (10%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN-----SYVSGGL 60
           S    ++   A   R+S V+DN++N DTVG++   + FS +V    ++     S+V+ G 
Sbjct: 4   SFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGK 63

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
           E  +K    E GS + T +  D A++G  +F ++    +  LTR G F + ++G L + +
Sbjct: 64  EYLSK----EVGSFISTGTELDFALEGDAWFALESPRGI-ILTRDGRFKVTDDGSLVSAS 118

Query: 121 GGVLLGYP-LKNASAPL 136
           G     YP L  AS P+
Sbjct: 119 G----KYPVLDMASVPI 131

>gi|254780380|ref|YP_003064793.1| flagellar basal body rod protein FlgC [Candidatus Liberibacter asiaticus str. psy62] Length = 134 Back     alignment
 Score = 35.8 bits (81), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 19/124 (15%)

Query: 3   ILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVG-------YKRTAIAFSSLVFPSTSNSY 55
           ++ S   A SG+  QS R+  +S+NIAN  T G       Y+R  I+F  ++       +
Sbjct: 4   LIASAHIANSGLAVQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVM-------H 56

Query: 56  VSGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGF 115
            SGG+ +  K +  +Q + +             G  IVK   NVN L    D    N  +
Sbjct: 57  GSGGVRV--KKIGVDQSTFVEEFDPGHPVANASG--IVK-YPNVNVLVETADMRETNRLY 111

Query: 116 LENV 119
           + N+
Sbjct: 112 MANL 115

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target421 flagellar hook protein FlgE [Candidatus Liberibacter as
315122284422 flagellar hook protein FlgE [Candidatus Liberibacter so 1 0.0
15887919425 flagellar hook protein FlgE [Agrobacterium tumefaciens 1 1e-111
325291962426 Flagellar hook protein FlgE [Agrobacterium sp. H13-3] L 1 1e-110
163758031419 flagellar hook protein E [Hoeflea phototrophica DFL-43] 1 1e-98
116250500433 flagellar hook protein FlgE [Rhizobium leguminosarum bv 1 2e-94
260466603418 flagellar basal body FlaE domain protein [Mesorhizobium 1 2e-94
13472592418 flagellar hook protein FlgE [Mesorhizobium loti MAFF303 1 5e-94
110632640422 flagellar hook protein FlgE [Mesorhizobium sp. BNC1] Le 1 4e-93
86360902430 flagellar hook protein FlgE [Rhizobium etli CFN 42] Len 1 9e-93
241203124432 flagellar hook protein FlgE [Rhizobium leguminosarum bv 1 1e-92
>gi|315122284|ref|YP_004062773.1| flagellar hook protein FlgE [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 422 Back     alignment and organism information
 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/422 (74%), Positives = 364/422 (86%), Gaps = 1/422 (0%)

Query: 1   MGILGSMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGL 60
           MGILG+MKTAMSGMDAQSNRVSAVSDNIANV+T+GYKRTA++FSSLVFP  +  + SGG+
Sbjct: 1   MGILGTMKTAMSGMDAQSNRVSAVSDNIANVNTIGYKRTAVSFSSLVFPPAAGCHTSGGV 60

Query: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120
            +S KDMIS QGSL+HTASNTDLAIQG+GFF+VK +   + LTR+G+F INNEGFL+N A
Sbjct: 61  AVSEKDMISSQGSLIHTASNTDLAIQGEGFFVVKDKTGTHYLTRSGNFQINNEGFLQNTA 120

Query: 121 GGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKT 180
           G VL GYP++NA +PL++NSFQGLE INV++ E  A+PTT G I  NLDK+A ++   KT
Sbjct: 121 GYVLQGYPMRNAFSPLVLNSFQGLETINVRNFEPRAVPTTLGSIPANLDKDAKVVVRSKT 180

Query: 181 PKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA 240
           PK NG DAEYTHKSSF+AYDTLGS V+YD+YYTK  DKKWEVSIFRQDQS+   FPYNV 
Sbjct: 181 PKSNGGDAEYTHKSSFSAYDTLGSRVIYDLYYTKVEDKKWEVSIFRQDQSSKTIFPYNVT 240

Query: 241 -PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEIN 299
            PL  ++VSFDPVTG+LA SS K ISF+DNTSGI   I IDISKTTQL GGFIPQ + IN
Sbjct: 241 NPLAVIDVSFDPVTGHLAESSPKEISFDDNTSGISHPIKIDISKTTQLVGGFIPQNAVIN 300

Query: 300 GHAPGKPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGD 359
           G APGKP+DFSVSKDG +D+IYDDGTRVP+YRLAIATVPSE++LK+ DGNTYLPTRDSGD
Sbjct: 301 GQAPGKPRDFSVSKDGNIDVIYDDGTRVPVYRLAIATVPSENSLKICDGNTYLPTRDSGD 360

Query: 360 ISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISL 419
           ISIG+PG++Q G++ SGALETANVDIA+ELTELIEAQRNYA NSKVFQTGSDFMDILISL
Sbjct: 361 ISIGYPGNDQRGDVLSGALETANVDIANELTELIEAQRNYAANSKVFQTGSDFMDILISL 420

Query: 420 KR 421
           KR
Sbjct: 421 KR 422


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15887919|ref|NP_353600.1| flagellar hook protein FlgE [Agrobacterium tumefaciens str. C58] Length = 425 Back     alignment and organism information
>gi|325291962|ref|YP_004277826.1| Flagellar hook protein FlgE [Agrobacterium sp. H13-3] Length = 426 Back     alignment and organism information
>gi|163758031|ref|ZP_02165119.1| flagellar hook protein E [Hoeflea phototrophica DFL-43] Length = 419 Back     alignment and organism information
>gi|116250500|ref|YP_766338.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. viciae 3841] Length = 433 Back     alignment and organism information
>gi|260466603|ref|ZP_05812791.1| flagellar basal body FlaE domain protein [Mesorhizobium opportunistum WSM2075] Length = 418 Back     alignment and organism information
>gi|13472592|ref|NP_104159.1| flagellar hook protein FlgE [Mesorhizobium loti MAFF303099] Length = 418 Back     alignment and organism information
>gi|110632640|ref|YP_672848.1| flagellar hook protein FlgE [Mesorhizobium sp. BNC1] Length = 422 Back     alignment and organism information
>gi|86360902|ref|YP_472789.1| flagellar hook protein FlgE [Rhizobium etli CFN 42] Length = 430 Back     alignment and organism information
>gi|241203124|ref|YP_002974220.1| flagellar hook protein FlgE [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 432 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target421 flagellar hook protein FlgE [Candidatus Liberibacter as
PRK05682407 PRK05682, flgE, flagellar hook protein FlgE; Validated 1e-110
PRK06803402 PRK06803, flgE, flagellar hook protein FlgE; Validated 9e-47
COG1749423 COG1749, FlgE, Flagellar hook protein FlgE [Cell motili 9e-79
TIGR03506231 TIGR03506, FlgEFG_subfam, fagellar hook-basal body prot 4e-30
COG4786265 COG4786, FlgG, Flagellar basal body rod protein [Cell m 2e-21
PRK12818256 PRK12818, flgG, flagellar basal body rod protein FlgG; 3e-18
TIGR02488259 TIGR02488, flgG_G_neg, flagellar basal-body rod protein 6e-18
PRK12817260 PRK12817, flgG, flagellar basal body rod protein FlgG; 2e-17
PRK12691262 PRK12691, flgG, flagellar basal body rod protein FlgG; 2e-17
PRK12693261 PRK12693, flgG, flagellar basal body rod protein FlgG; 1e-16
PRK12694260 PRK12694, flgG, flagellar basal body rod protein FlgG; 6e-16
PRK12816264 PRK12816, flgG, flagellar basal body rod protein FlgG; 6e-16
PRK12636263 PRK12636, flgG, flagellar basal body rod protein FlgG; 5e-15
PRK08425 731 PRK08425, flgE, flagellar hook protein FlgE; Validated 2e-12
PRK12690238 PRK12690, flgF, flagellar basal body rod protein FlgF; 2e-12
PRK12642241 PRK12642, flgF, flagellar basal body rod protein FlgF; 3e-12
TIGR02489 719 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, e 2e-11
PRK12692262 PRK12692, flgG, flagellar basal body rod protein FlgG; 4e-11
PRK12640246 PRK12640, flgF, flagellar basal body rod protein FlgF; 4e-11
COG4787251 COG4787, FlgF, Flagellar basal body rod protein [Cell m 4e-09
PRK05841 603 PRK05841, flgE, flagellar hook protein FlgE; Validated 9e-08
PRK12689253 PRK12689, flgF, flagellar basal body rod protein FlgF; 3e-05
PRK12819257 PRK12819, flgG, flagellar basal body rod protein FlgG; 2e-04
PRK12641252 PRK12641, flgF, flagellar basal body rod protein FlgF; 4e-04
TIGR03506231 TIGR03506, FlgEFG_subfam, fagellar hook-basal body prot 1e-21
PRK12636263 PRK12636, flgG, flagellar basal body rod protein FlgG; 3e-17
COG4786265 COG4786, FlgG, Flagellar basal body rod protein [Cell m 5e-17
PRK12691262 PRK12691, flgG, flagellar basal body rod protein FlgG; 6e-14
TIGR02488259 TIGR02488, flgG_G_neg, flagellar basal-body rod protein 8e-14
PRK12693261 PRK12693, flgG, flagellar basal body rod protein FlgG; 1e-12
PRK12816264 PRK12816, flgG, flagellar basal body rod protein FlgG; 6e-11
PRK12692262 PRK12692, flgG, flagellar basal body rod protein FlgG; 1e-10
PRK12817260 PRK12817, flgG, flagellar basal body rod protein FlgG; 4e-08
TIGR0249089 TIGR02490, flgF, flagellar basal-body rod protein FlgF 2e-06
PRK12637473 PRK12637, flgE, flagellar hook protein FlgE; Provisiona 1e-15
TIGR02489719 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, e 2e-15
PRK08425731 PRK08425, flgE, flagellar hook protein FlgE; Validated 5e-15
PRK05841603 PRK05841, flgE, flagellar hook protein FlgE; Validated 3e-12
PRK12694260 PRK12694, flgG, flagellar basal body rod protein FlgG; 6e-13
PRK12637473 PRK12637, flgE, flagellar hook protein FlgE; Provisiona 8e-13
pfam07559117 pfam07559, FlaE, Flagellar basal body protein FlaE 7e-12
PRK12632130 PRK12632, flgC, flagellar basal body rod protein FlgC; 4e-07
COG1558137 COG1558, FlgC, Flagellar basal body rod protein [Cell m 3e-05
TIGR01396131 TIGR01396, FlgB, flagellar basal-body rod protein FlgB 7e-05
PRK07191456 PRK07191, flgK, flagellar hook-associated protein FlgK; 0.001
TIGR01395135 TIGR01395, FlgC, flagellar basal-body rod protein FlgC 0.002
pfam0642939 pfam06429, DUF1078, Domain of unknown function (DUF1078 1e-06
PRK12632130 PRK12632, flgC, flagellar basal body rod protein FlgC; 0.003
PRK05681135 PRK05681, flgC, flagellar basal body rod protein FlgC; 6e-06
pfam0046031 pfam00460, Flg_bb_rod, Flagella basal body rod protein 4e-05
PRK12782138 PRK12782, flgC, flagellar basal body rod protein FlgC; 9e-04
PRK07521483 PRK07521, flgK, flagellar hook-associated protein FlgK; 0.001
COG1256 552 COG1256, FlgK, Flagellar hook-associated protein [Cell 0.002
PRK12623131 PRK12623, flgB, flagellar basal body rod protein FlgB; 0.004
>gnl|CDD|180198 PRK05682, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|180703 PRK06803, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|31935 COG1749, FlgE, Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|163298 TIGR03506, FlgEFG_subfam, fagellar hook-basal body proteins Back     alignment and domain information
>gnl|CDD|34397 COG4786, FlgG, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183768 PRK12818, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|131541 TIGR02488, flgG_G_neg, flagellar basal-body rod protein FlgG, Gram-negative bacteria Back     alignment and domain information
>gnl|CDD|183767 PRK12817, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183686 PRK12691, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183687 PRK12693, flgG, flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>gnl|CDD|183688 PRK12694, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183766 PRK12816, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183640 PRK12636, flgG, flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>gnl|CDD|181421 PRK08425, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|183685 PRK12690, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|183643 PRK12642, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|131542 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, epsilon proteobacterial Back     alignment and domain information
>gnl|CDD|139158 PRK12692, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183642 PRK12640, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|34398 COG4787, FlgF, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|180282 PRK05841, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|183684 PRK12689, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|183769 PRK12819, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|105809 PRK12641, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|163298 TIGR03506, FlgEFG_subfam, fagellar hook-basal body proteins Back     alignment and domain information
>gnl|CDD|183640 PRK12636, flgG, flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>gnl|CDD|34397 COG4786, FlgG, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183686 PRK12691, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|131541 TIGR02488, flgG_G_neg, flagellar basal-body rod protein FlgG, Gram-negative bacteria Back     alignment and domain information
>gnl|CDD|183687 PRK12693, flgG, flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>gnl|CDD|183766 PRK12816, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|139158 PRK12692, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183767 PRK12817, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|162884 TIGR02490, flgF, flagellar basal-body rod protein FlgF Back     alignment and domain information
>gnl|CDD|183641 PRK12637, flgE, flagellar hook protein FlgE; Provisional Back     alignment and domain information
>gnl|CDD|131542 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, epsilon proteobacterial Back     alignment and domain information
>gnl|CDD|181421 PRK08425, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|180282 PRK05841, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|183688 PRK12694, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183641 PRK12637, flgE, flagellar hook protein FlgE; Provisional Back     alignment and domain information
>gnl|CDD|148912 pfam07559, FlaE, Flagellar basal body protein FlaE Back     alignment and domain information
>gnl|CDD|183637 PRK12632, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>gnl|CDD|31746 COG1558, FlgC, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|162337 TIGR01396, FlgB, flagellar basal-body rod protein FlgB Back     alignment and domain information
>gnl|CDD|180871 PRK07191, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|130462 TIGR01395, FlgC, flagellar basal-body rod protein FlgC Back     alignment and domain information
>gnl|CDD|148188 pfam06429, DUF1078, Domain of unknown function (DUF1078) Back     alignment and domain information
>gnl|CDD|183637 PRK12632, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>gnl|CDD|180197 PRK05681, flgC, flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>gnl|CDD|109515 pfam00460, Flg_bb_rod, Flagella basal body rod protein Back     alignment and domain information
>gnl|CDD|139220 PRK12782, flgC, flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>gnl|CDD|181014 PRK07521, flgK, flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>gnl|CDD|31448 COG1256, FlgK, Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183630 PRK12623, flgB, flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 421 flagellar hook protein FlgE [Candidatus Liberibacter as
PRK05682414 flgE flagellar hook protein FlgE; Validated 100.0
PRK06803398 flgE flagellar hook protein FlgE; Validated 100.0
COG1749423 FlgE Flagellar hook protein FlgE [Cell motility and sec 100.0
PRK05841605 flgE flagellar hook protein FlgE; Validated 100.0
PRK12637473 flgE flagellar hook protein FlgE; Provisional 100.0
TIGR02488263 flgG_G_neg flagellar basal-body rod protein FlgG; Inter 100.0
PRK12636263 flgG flagellar basal body rod protein FlgG; Provisional 100.0
PRK12691262 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12816264 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12693261 flgG flagellar basal body rod protein FlgG; Provisional 100.0
PRK12694260 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12692262 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
COG4786265 FlgG Flagellar basal body rod protein [Cell motility an 100.0
PRK12817261 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12689253 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
TIGR03506231 FlgEFG_subfam fagellar hook-basal body proteins. This m 100.0
PRK12818255 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12690237 flgF flagellar basal body rod protein FlgF; Reviewed 99.97
PRK12642241 flgF flagellar basal body rod protein FlgF; Reviewed 99.97
TIGR02490254 flgF flagellar basal-body rod protein FlgF; InterPro: I 99.78
PRK08425716 flgE flagellar hook protein FlgE; Validated 100.0
PRK08471 612 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK07739500 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK06665 628 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK12715 649 flgK flagellar hook-associated protein FlgK; Provisiona 100.0
PRK12714 624 flgK flagellar hook-associated protein FlgK; Provisiona 100.0
PRK08871 626 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK06945 649 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK05683 676 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK05681139 flgC flagellar basal body rod protein FlgC; Reviewed 99.67
COG1558137 FlgC Flagellar basal body rod protein [Cell motility an 98.91
TIGR01395147 FlgC flagellar basal-body rod protein FlgC; InterPro: I 98.53
PRK12621136 flgB flagellar basal body rod protein FlgB; Provisional 98.45
PRK12632130 flgC flagellar basal body rod protein FlgC; Provisional 98.43
PRK12782138 flgC flagellar basal body rod protein FlgC; Reviewed 98.4
PRK05680137 flgB flagellar basal body rod protein FlgB; Reviewed 98.4
PRK12619130 flgB flagellar basal body rod protein FlgB; Provisional 98.4
COG1815133 FlgB Flagellar basal body protein [Cell motility and se 98.33
PRK06802141 flgC flagellar basal body rod protein FlgC; Reviewed 98.28
PRK12629135 flgC flagellar basal body rod protein FlgC; Provisional 98.25
PRK07521482 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK07191456 flgK flagellar hook-associated protein FlgK; Validated 100.0
TIGR02492495 flgK_ends flagellar hook-associated protein FlgK; Inter 100.0
COG1256 552 FlgK Flagellar hook-associated protein [Cell motility a 100.0
PRK08147 547 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK06799431 flgK flagellar hook-associated protein FlgK; Validated 100.0
PRK12640246 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
PRK12819257 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12641252 flgF flagellar basal body rod protein FlgF; Reviewed 99.96
PRK12643209 flgF flagellar basal body rod protein FlgF; Reviewed 99.64
COG4787251 FlgF Flagellar basal body rod protein [Cell motility an 99.35
TIGR02489877 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR 100.0
PRK12631138 flgC flagellar basal body rod protein FlgC; Provisional 99.53
PRK12628140 flgC flagellar basal body rod protein FlgC; Provisional 99.06
PRK12630143 flgC flagellar basal body rod protein FlgC; Provisional 99.02
PRK12622135 flgB flagellar basal body rod protein FlgB; Provisional 98.51
PRK12625132 flgB flagellar basal body rod protein FlgB; Provisional 98.4
PRK12624143 flgB flagellar basal body rod protein FlgB; Provisional 98.33
PRK12685116 flgB flagellar basal body rod protein FlgB; Reviewed 98.33
PRK12623131 flgB flagellar basal body rod protein FlgB; Provisional 98.33
PRK12620132 flgB flagellar basal body rod protein FlgB; Provisional 98.3
pfam0046031 Flg_bb_rod Flagella basal body rod protein. 98.29
PRK06003126 flgB flagellar basal body rod protein FlgB; Reviewed 98.17
PRK12626162 flgB flagellar basal body rod protein FlgB; Provisional 98.1
PRK07182148 flgB flagellar basal body rod protein FlgB; Reviewed 97.96
PRK06797135 flgB flagellar basal body rod protein FlgB; Reviewed 97.94
PRK06004126 flgB flagellar basal body rod protein FlgB; Reviewed 97.91
PRK12627128 flgB flagellar basal body rod protein FlgB; Provisional 97.76
TIGR01396134 FlgB flagellar basal-body rod protein FlgB; InterPro: I 94.0
PRK12632130 flgC flagellar basal body rod protein FlgC; Provisional 99.12
pfam0642939 DUF1078 Domain of unknown function (DUF1078). This fami 99.06
PRK06802141 flgC flagellar basal body rod protein FlgC; Reviewed 98.98
PRK12629135 flgC flagellar basal body rod protein FlgC; Provisional 98.91
PRK12782138 flgC flagellar basal body rod protein FlgC; Reviewed 98.89
TIGR01395147 FlgC flagellar basal-body rod protein FlgC; InterPro: I 98.31
PRK12630143 flgC flagellar basal body rod protein FlgC; Provisional 98.16
PRK12628140 flgC flagellar basal body rod protein FlgC; Provisional 98.06
COG1558137 FlgC Flagellar basal body rod protein [Cell motility an 97.89
PRK12627128 flgB flagellar basal body rod protein FlgB; Provisional 95.98
PRK06003126 flgB flagellar basal body rod protein FlgB; Reviewed 95.76
PRK06004126 flgB flagellar basal body rod protein FlgB; Reviewed 95.73
PRK12622135 flgB flagellar basal body rod protein FlgB; Provisional 95.44
PRK12623131 flgB flagellar basal body rod protein FlgB; Provisional 95.25
PRK05680137 flgB flagellar basal body rod protein FlgB; Reviewed 95.24
COG1815133 FlgB Flagellar basal body protein [Cell motility and se 95.21
PRK12624143 flgB flagellar basal body rod protein FlgB; Provisional 94.88
PRK12685116 flgB flagellar basal body rod protein FlgB; Reviewed 94.0
PRK12625132 flgB flagellar basal body rod protein FlgB; Provisional 93.95
PRK12621136 flgB flagellar basal body rod protein FlgB; Provisional 93.95
PRK12619130 flgB flagellar basal body rod protein FlgB; Provisional 93.33
PRK12620132 flgB flagellar basal body rod protein FlgB; Provisional 93.32
PRK06797135 flgB flagellar basal body rod protein FlgB; Reviewed 92.52
PRK12804307 flagellin; Provisional 91.98
COG1344360 FlgL Flagellin and related hook-associated proteins [Ce 91.43
>PRK05682 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK06803 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>COG1749 FlgE Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>PRK05841 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK12637 flgE flagellar hook protein FlgE; Provisional Back     alignment and domain information
>TIGR02488 flgG_G_neg flagellar basal-body rod protein FlgG; InterPro: IPR012834 This family consists of the FlgG protein of the flagellar apparatus in the proteobacteria and spirochetes Back     alignment and domain information
>PRK12636 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>PRK12691 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12816 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12693 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>PRK12694 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12692 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>COG4786 FlgG Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK12817 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>TIGR03506 FlgEFG_subfam fagellar hook-basal body proteins Back     alignment and domain information
>PRK12818 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12690 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12642 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>TIGR02490 flgF flagellar basal-body rod protein FlgF; InterPro: IPR012836 Members of this protein are FlgF, one of several homologous flagellar basal-body rod proteins in bacteria Back     alignment and domain information
>PRK08425 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK05681 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>TIGR01395 FlgC flagellar basal-body rod protein FlgC; InterPro: IPR006299 These sequences represent FlgC, one of several components of bacterial flagella Back     alignment and domain information
>PRK12621 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12619 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12629 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12640 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12819 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12641 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12643 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>COG4787 FlgF Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) Back     alignment and domain information
>PRK12631 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12628 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12630 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12622 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12625 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12624 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12623 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>pfam00460 Flg_bb_rod Flagella basal body rod protein Back     alignment and domain information
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12626 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK07182 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK06797 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>TIGR01396 FlgB flagellar basal-body rod protein FlgB; InterPro: IPR006300 Many bacterial species swim actively by means of flagella Back     alignment and domain information
>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>pfam06429 DUF1078 Domain of unknown function (DUF1078) Back     alignment and domain information
>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12629 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>TIGR01395 FlgC flagellar basal-body rod protein FlgC; InterPro: IPR006299 These sequences represent FlgC, one of several components of bacterial flagella Back     alignment and domain information
>PRK12630 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12628 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12622 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12623 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>PRK12624 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12625 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12621 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12619 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06797 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12804 flagellin; Provisional Back     alignment and domain information
>COG1344 FlgL Flagellin and related hook-associated proteins [Cell motility and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target421 flagellar hook protein FlgE [Candidatus Liberibacter as
3a69_A402 Atomic Model Of The Bacterial Flagellar Hook Based 8e-65
1wlg_A299 Crystal Structure Of Flge31, A Major Fragment Of Th 1e-29
>gi|281306984|pdb|3A69|A Chain A, Atomic Model Of The Bacterial Flagellar Hook Based On Docking An X-Ray Derived Structure And Terminal Two Alpha- Helices Into An 7.1 Angstrom Resolution Cryoem Map Length = 402 Back     alignment and structure
 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 98/415 (23%), Positives = 176/415 (42%), Gaps = 13/415 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NIAN  T G+K    +F+ +       S V  G++++  
Sbjct: 1   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGI 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 57  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+    +  P KTP    
Sbjct: 117 GYPA--TGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPV--PSKTPFSVS 172

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   YD+ G++   +VY+ KT D +W V                     + 
Sbjct: 173 DADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDP-----AATAPTTAST 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTTQLAGGFIPQKSEINGHAPGK 305
            + F+      +  +    +   N +         ++   Q  G      +  NG+ PG 
Sbjct: 228 TLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGD 287

Query: 306 PKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFP 365
              + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G  
Sbjct: 288 LVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTA 347

Query: 366 GHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
           G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 348 GSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>gi|56554379|pdb|1WLG|A Chain A, Crystal Structure Of Flge31, A Major Fragment Of The Hook Protein Length = 299 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target421 flagellar hook protein FlgE [Candidatus Liberibacter as
3a69_A402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 9e-59
1wlg_A299 Flagellar HOOK protein FLGE; EAR-& motif, structural pr 2e-39
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Length = 402 Back     alignment and structure
 Score =  222 bits (567), Expect = 9e-59
 Identities = 100/416 (24%), Positives = 180/416 (43%), Gaps = 15/416 (3%)

Query: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTK 65
           S   A+SG++A +  +  + +NIAN  T G+K    +F+ +     + S V  G++++  
Sbjct: 1   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMF----AGSKVGLGVKVAGI 56

Query: 66  DMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLL 125
                 G+  +T    D+AI   GFF +   +     +R G F ++    L N+ G  L 
Sbjct: 57  TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLT 116

Query: 126 GYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNG 185
           GYP      P  +        I + +  ++A  TTT  +  NL+    +  P KTP    
Sbjct: 117 GYPATGT--PPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPV--PSKTPFSVS 172

Query: 186 RDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV 245
               Y  K +   YD+ G++   +VY+ KT D +W V         ++          + 
Sbjct: 173 DADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTH-----DSSDPAATAPTTAST 227

Query: 246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQITIDISKTT-QLAGGFIPQKSEINGHAPG 304
            + F+   G L +     I+            ++    +  Q  G      +  NG+ PG
Sbjct: 228 TLKFNE-NGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPG 286

Query: 305 KPKDFSVSKDGYVDIIYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGF 364
               + ++ DG V   Y +     + ++ +A   + + L     N +  T+ SG   +G 
Sbjct: 287 DLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGT 346

Query: 365 PGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSKVFQTGSDFMDILISLK 420
            G    G++ +GALE +NVD++ EL  +I AQRNY  N++  +T    ++ L++L+
Sbjct: 347 AGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} SCOP: b.152.1.1 PDB: 2bgy_A 2bgz_A Length = 299 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target421 flagellar hook protein FlgE [Candidatus Liberibacter as
3a69_A402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 100.0
1wlg_A299 Flagellar HOOK protein FLGE; EAR-& motif, structural pr 99.85
2d4y_A463 HAP1, flagellar HOOK-associated protein 1; multi-domain 96.62
1ucu_A494 Phase 1 flagellin; flagellar filament, cryo-electron mi 91.83
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure
Probab=100.00  E-value=0  Score=415.15  Aligned_cols=401  Identities=25%  Similarity=0.408  Sum_probs=281.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCEEECCCHHHHHH
Q ss_conf             89999999999998637887753027786714220024654304777763122058857886303411121483022110
Q gi|254780525|r    6 SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSNSYVSGGLEISTKDMISEQGSLMHTASNTDLAI   85 (421)
Q Consensus         6 ~l~~a~SGL~A~q~al~vts~NIANanT~GYsRq~~~~~~~~~~~~~~~~~G~GV~v~~i~r~~~~~~~~~t~~~~d~a~   85 (421)
                      +|+||+|||.|+|++|+||||||||||||||||||++|++.++    ++++|.||++.+|+|+++|+.++.+.+.+|+++
T Consensus         1 s~~~a~sGl~A~q~al~vts~NIANaNT~GYsRq~v~f~~~~~----~~~~G~GV~v~~v~r~~~qg~~~~t~~~~d~ai   76 (402)
T 3a69_A            1 SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA----GSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAI   76 (402)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHC--------------------------------------------------CEECCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHHC----CCCCCCCEEEEEEEEECCCCCEEECCCCCHHEE
T ss_conf             9789999999999735788888987776420657020777646----687767447767898414564576476003014


Q ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             36662010179882564201122212367201455620111110134555432344544444444455454333211233
Q gi|254780525|r   86 QGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTTTGFIS  165 (421)
Q Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (421)
                      .++++|......+...++++..|..+.++.+.+..+...+.+................  ....................
T Consensus        77 ~~~g~f~~~~~~g~~~~tr~g~~~~~~~g~lvn~~g~~l~g~~~~~~~~~~~~~~~~~--~~~i~~~~~~~~~t~~~~~~  154 (402)
T 3a69_A           77 SQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPA--PITIPNTLMAAKSTTTASMQ  154 (402)
T ss_dssp             SSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCCEEEEEECBTTTTBCCTTCCCE--ECCCCCCCCCCBCCCEEEEE
T ss_pred             CCCCEEEEECCCCCEEEEECCCCCCCCCCCEECCCCCEEECCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCEEEEEE
T ss_conf             2786178862798643641565342788878637896441231457775222567655--52144445676553036763


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCE
Q ss_conf             10245544444444445677654322210367540688736778762135555420477630444446566664432100
Q gi|254780525|r  166 NNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTV  245 (421)
Q Consensus       166 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (421)
                      .......  ...............+.......+++..|..+.+...+.+.....+.................     ...
T Consensus       155 ~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~v~d~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~  227 (402)
T 3a69_A          155 INLNSTD--PVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTT-----AST  227 (402)
T ss_dssp             EEEETTC--CCCSSCSCCTTCTTSCSEEEEEEEECTTCCEEEEEEEEEEEETTEEEEEEEETTCTTCCCCCS-----CSE
T ss_pred             CCCCCCC--CCCCCCCCCCCCCCCCCCCCCEEEECCCCCEEEEEEEEEECCCCCCEEEEECCCCCCCCCCCC-----CCE
T ss_conf             0246555--566534445577655133333799858997266667877637885237970366655546655-----522


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCC
Q ss_conf             122024456445776533212467766554332-3333310023333432334443323443445547763389984143
Q gi|254780525|r  246 EVSFDPVTGYLANSSHKAISFNDNTSGIDQQIT-IDISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDIIYDDG  324 (421)
Q Consensus       246 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  324 (421)
                      ...+... +................+....... .....................+...+......++..|.+.+....+
T Consensus       228 ~~~~~~~-G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~dG~~~~~~~~~~i~~dG~v~~~~~~~  306 (402)
T 3a69_A          228 TLKFNEN-GILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNE  306 (402)
T ss_dssp             EEEECTT-SBEEECCEEEEECCCBTTBCCCEEEEECTTCEEESSCCCEEEEEEESCBCCCCEEEEEECTTCEEEEEETTS
T ss_pred             EEEECCC-CCCCCCCCEECCCCCCCCCCCCCCCEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCC
T ss_conf             6874146-521457720002345456555431000011200135653112102466555421234217895599973565


Q ss_pred             CCCCCCCCEECCCCCHHHHHHCCCCEEEECCCCCCEEECCCCCCCCEEEEECCEECCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             21101222001217867877416952663233587021378887611465231000477899999999999999999999
Q gi|254780525|r  325 TRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETANVDIASELTELIEAQRNYAVNSK  404 (421)
Q Consensus       325 ~~~~~~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~i~~~~le~SgVnlDEEm~nLi~~Q~aYqAsAr  404 (421)
                      .........+.+|.|+.+|.+.|++.|.++..+|.+.++.+.....+.+.+++||.|||||||||+|||+|||+||||||
T Consensus       307 ~~~~~~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~~~~~~lE~S~V~ldeEmtnli~~Q~aY~A~ak  386 (402)
T 3a69_A          307 QEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQ  386 (402)
T ss_dssp             CEEEEEEECEEECSCGGGSEECSTTCEECCTTTCCCEEECTTBTTBCCCCC---------CHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCEEEEECCEECCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             42100112345667857733047960643556777300678878731481075451147999999999999999999752


Q ss_pred             HHHHHHHHHHHHHHHC
Q ss_conf             9999999999997512
Q gi|254780525|r  405 VFQTGSDFMDILISLK  420 (421)
Q Consensus       405 vItt~demldtLlnl~  420 (421)
                      ||+|+|||||+|||||
T Consensus       387 vitt~demld~linlk  402 (402)
T 3a69_A          387 TIKTQDQILNTLVNLR  402 (402)
T ss_dssp             HHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             6649999999997059



>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} SCOP: b.152.1.1 PDB: 2bgy_A 2bgz_A Back     alignment and structure
>2d4y_A HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium} Back     alignment and structure
>1ucu_A Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} SCOP: e.32.1.1 PDB: 3a5x_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 421 flagellar hook protein FlgE [Candidatus Liberibacter as
d1wlga_293 b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella 5e-37
>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella typhimurium [TaxId: 90371]} Length = 293 Back     information, alignment and structure

class: All beta proteins
fold: Flagellar hook protein flgE
superfamily: Flagellar hook protein flgE
family: Flagellar hook protein flgE
domain: Flagellar hook protein flgE
species: Salmonella typhimurium [TaxId: 90371]
 Score =  149 bits (376), Expect = 5e-37
 Identities = 71/299 (23%), Positives = 116/299 (38%), Gaps = 11/299 (3%)

Query: 82  DLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSF 141
           D+AI   GFF +   +     +R G F ++    L N+ G  L GYP      P  +   
Sbjct: 3   DVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPAT--GTPPTIQQG 60

Query: 142 QGLERINVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDT 201
                I + +  ++A  TTT  +  N   N+T   P KTP        Y  K +   YD+
Sbjct: 61  ANPAPITIPNTLMAAKSTTTASMQIN--LNSTDPVPSKTPFSVSDADSYNKKGTVTVYDS 118

Query: 202 LGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSH 261
            G++   +VY+ KT D +W V         ++S P   AP            G L +   
Sbjct: 119 QGNAHDMNVYFVKTKDNEWAVYTH------DSSDPAATAPTTASTTLKFNENGILESGGT 172

Query: 262 KAISFNDNTSGIDQQITIDIS-KTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDII 320
             I+            ++       Q  G      +  NG+ PG    + ++ DG V   
Sbjct: 173 VNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGN 232

Query: 321 YDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALE 379
           Y +     + ++ +A   + + L     N +  T+ SG   +G  G    G++ +GALE
Sbjct: 233 YSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALE 291


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target421 flagellar hook protein FlgE [Candidatus Liberibacter as
d1wlga_293 Flagellar hook protein flgE {Salmonella typhimurium [Ta 99.78
>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: All beta proteins
fold: Flagellar hook protein flgE
superfamily: Flagellar hook protein flgE
family: Flagellar hook protein flgE
domain: Flagellar hook protein flgE
species: Salmonella typhimurium [TaxId: 90371]
Probab=99.78  E-value=1.2e-17  Score=127.13  Aligned_cols=291  Identities=22%  Similarity=0.373  Sum_probs=202.1

Q ss_pred             HHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22110366620101798825642011222123672014556201111101345554323445444444444554543332
Q gi|254780525|r   81 TDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNASAPLIVNSFQGLERINVKHAELSAMPTT  160 (421)
Q Consensus        81 ~d~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (421)
                      ||+|+.++++|......+...++|...|..+.+++|.+..+...+++..+..........  ..................
T Consensus         2 LDlAI~G~GFFvV~~~~g~~~YTRaG~F~~D~~G~Lvn~~G~~l~G~~~d~~~~~~~~~~--~~~~i~i~~~~~~~~aTt   79 (293)
T d1wlga_           2 LDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGA--NPAPITIPNTLMAAKSTT   79 (293)
T ss_dssp             EECCCSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCCEEEEEECBTTTTBCCTTC--CCEECCCCCCCBCCBCCC
T ss_pred             CCEEECCCEEEEEECCCCCEEEECCCCEEECCCCCEECCCCCEEEEEECCCCCCCCCCCC--CCCCCCCCCCCCCCCCCC
T ss_conf             647874870799876999887844887329899998839999898576368886312577--655443444345776551


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCCCCCCEEEEEECCCCCCCCCCCCCC
Q ss_conf             11233102455444444444456776543222103675406887367787621355554204776304444465666644
Q gi|254780525|r  161 TGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSVVYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVA  240 (421)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (421)
                      .......+......  .............+.......++|.+|..|.+.+++.+.....|..............     .
T Consensus        80 ~~~~~~NL~~~~~~--~~~~~~~~~~~~t~~~~~s~~vyDs~G~~~~v~~~f~k~~~~~w~~~~~~~~~~~~~~-----~  152 (293)
T d1wlga_          80 TASMQINLNSTDPV--PSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATA-----P  152 (293)
T ss_dssp             EEEEEEEEETTCCC--CSSCSCCTTCTTSCSEEEEEEEECTTCCEEEEEEEEEEEETTEEEEEEEETTCTTCCC-----C
T ss_pred             EEEEECCCCCCCCC--CCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCEEEEEECCCCCCEEEEECCCCCCCCC-----C
T ss_conf             46774166421235--5322223478776330113676422586422205666204654137871256644546-----6


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             3210012202445644577653321246776655433233-333100233334323344433234434455477633899
Q gi|254780525|r  241 PLNTVEVSFDPVTGYLANSSHKAISFNDNTSGIDQQITID-ISKTTQLAGGFIPQKSEINGHAPGKPKDFSVSKDGYVDI  319 (421)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  319 (421)
                      ......+.|+....... ...................... .....++............+...|.+....|+..|.+.+
T Consensus       153 ~~~~~~l~F~~~G~l~~-~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~qdG~~~G~l~~~~i~~dG~i~~  231 (293)
T d1wlga_         153 TTASTTLKFNENGILES-GGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVG  231 (293)
T ss_dssp             CSCSEEEEECTTSBEEE-CCEEEEECCCBTTBCCCEEEEECTTCEEESSCCCEEEEEEECCBCCBCEEEEEECTTCEEEE
T ss_pred             CCCEEEEECCCCCCCCC-CCCEEECCCCCCCCCCCEECCCCCCCCCCCCCCCEEEEECCCCCCCEEEEEEEECCCEEEEE
T ss_conf             43135653278632223-33100023441124321000252210001257400244326884311232106658758999


Q ss_pred             EECCCCCCCCCCCEECCCCCHHHHHHCCCCEEEECCCCCCEEECCCCCCCCEEEEECCEECC
Q ss_conf             84143211012220012178678774169526632335870213788876114652310004
Q gi|254780525|r  320 IYDDGTRVPIYRLAIATVPSEDNLKLFDGNTYLPTRDSGDISIGFPGHNQHGEIFSGALETA  381 (421)
Q Consensus       320 ~~~~~~~~~~~~~~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~i~~~~le~S  381 (421)
                      .+.++.......+.+++|.||.+|.+.|++.|.++..||.+.++.++...+|+|.+++||+|
T Consensus       232 ~ysNG~~~~lgqiala~F~Np~gL~~~g~n~f~~t~~SG~~~~g~~g~~g~G~i~~g~LE~S  293 (293)
T d1wlga_         232 NYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEAS  293 (293)
T ss_dssp             EETTSCEEEEEEECEEECSCGGGSEECSTTCEECCTTTCCCEEECTTBTTBCCCSSCEEEEC
T ss_pred             EECCCCEEEEEEEEEEEECCHHHHHHCCCCEEECCCCCCCCEECCCCCCCCEEEECCCEECC
T ss_conf             97699678988999997359687321259708760016885556899888223842613169



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 421 flagellar hook protein FlgE [Candidatus Liberibact
3a69_A_133-285153 (A:133-285) Flagellar HOOK protein FLGE; the bacte 4e-19
1wlg_A_62-218157 (A:62-218) Flagellar HOOK protein FLGE; EAR-& moti 9e-19
3a69_A_48-116_315-358113 (A:48-116,A:315-358) Flagellar HOOK protein FLGE; 1e-11
1wlg_A_1-46_245-28183 (A:1-46,A:245-281) Flagellar HOOK protein FLGE; EA 4e-09
3a69_A_48-116_315-358113 (A:48-116,A:315-358) Flagellar HOOK protein FLGE; 1e-06
>3a69_A (A:133-285) Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp}Length = 153 Back     alignment and structure
 Score = 90.3 bits (224), Expect = 4e-19
 Identities = 30/158 (18%), Positives = 55/158 (34%), Gaps = 9/158 (5%)

Query: 147 INVKHAELSAMPTTTGFISNNLDKNATIITPDKTPKHNGRDAEYTHKSSFAAYDTLGSSV 206
           I + +  ++A  TTT  +  NL+    + +   TP        Y  K +   YD+ G++ 
Sbjct: 4   ITIPNTLMAAKSTTTASMQINLNSTDPVPSK--TPFSVSDADSYNKKGTVTVYDSQGNAH 61

Query: 207 VYDVYYTKTGDKKWEVSIFRQDQSTNNSFPYNVAPLNTVEVSFDPVTGYLANSSHKAISF 266
             +VY+ KT D +W V           +         +  + F+   G L +     I+ 
Sbjct: 62  DMNVYFVKTKDNEWAVYTHDSSDPAATA-----PTTASTTLKFNE-NGILESGGTVNITT 115

Query: 267 NDNTSGIDQQITIDISK-TTQLAGGFIPQKSEINGHAP 303
                      ++       Q  G      +  NG+ P
Sbjct: 116 GTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKP 153


>1wlg_A (A:62-218) Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium}Length = 157 Back     alignment and structure
>3a69_A (A:48-116,A:315-358) Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp}Length = 113 Back     alignment and structure
>1wlg_A (A:1-46,A:245-281) Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium}Length = 83 Back     alignment and structure
>3a69_A (A:48-116,A:315-358) Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp}Length = 113 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target421 flagellar hook protein FlgE [Candidatus Liberibacter as
3a69_A_48-116_315-358113 Flagellar HOOK protein FLGE; the bacterial flagell 97.49
2d4y_A_1-268_356-463376 HAP1, flagellar HOOK-associated protein 1; multi-d 96.49
3a69_A_48-116_315-358113 Flagellar HOOK protein FLGE; the bacterial flagell 94.92
1wlg_A_1-46_245-28183 Flagellar HOOK protein FLGE; EAR-& motif, structur 94.21
1wlg_A_62-218157 Flagellar HOOK protein FLGE; EAR-& motif, structur 93.11
>3a69_A (A:48-116,A:315-358) Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure
Probab=97.49  E-value=3.7e-05  Score=50.09  Aligned_cols=77  Identities=21%  Similarity=0.283  Sum_probs=69.2

Q ss_pred             CCCEEEEEEEEEECCCCEEECCCHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCC
Q ss_conf             22058857886303411121483022110366620101798825642011222123672014556201111101345
Q gi|254780525|r   57 SGGLEISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVAGGVLLGYPLKNAS  133 (421)
Q Consensus        57 G~GV~v~~i~r~~~~~~~~~t~~~~d~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~  133 (421)
                      |.||++..+.+.+.|+.++.|++.+|+|+.++++|......+...+++...|..+.++.|.+..+...+....-...
T Consensus         1 G~Gv~~~~~~~~~~qG~l~~T~~~lDlAI~G~GfF~V~~~~G~~~yTR~G~F~ld~~G~Lvt~~G~~vlal~~f~n~   77 (113)
T 3a69_A            1 GLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTVLANFANN   77 (113)
T ss_dssp             -----------------------CEECCCSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCCEEECEEECSCG
T ss_pred             CCCEEEEEEEEEECCCCEEECCCHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             67647767999604554576264556662278603675157860001345422047887123567400234566786



>2d4y_A (A:1-268,A:356-463) HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium} Back     alignment and structure
>3a69_A (A:48-116,A:315-358) Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure
>1wlg_A (A:1-46,A:245-281) Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1wlg_A (A:62-218) Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} Back     alignment and structure