254780527

254780527

hypothetical protein CLIBASIA_02070

GeneID in NCBI database:8209522Locus tag:CLIBASIA_02070
Protein GI in NCBI database:254780527Protein Accession:YP_003064940.1
Gene range:+(754108, 755301)Protein Length:397aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MKEVNNISYKGLLEANQYSLGHNDDRLNSIQEEKRNNSTKTINKNPNKQDFDVQNKSLFEIFLTTIPDADNHIHEDEERLIDNDLIYNSYKGAMYPSASQYFTVRDLSASEKDFPSIESFASKSPQDIEDISGFLSPDFSILLKNKTDRDYSDGLCTITDVFSQLKSDSGSFSNYLRHRKEMFSEDVPLNPVDFLLEKQLDTASLGEEICNLKGFSVPSRYQSSDSLDALMSTESVLNQKSFMRVTMIPESVHYTDTGSIKALTIQMKPNSPDNIVATLCLSGEKLSVKLRVESDFLYKKIQSGRQNILDALNFSGYTMDRFDVEFVRKDSLDLLKDSMNYCAQQQGFTHSNEFEKKKLYFPERERTEKKFFWGEKRSGLIYNKGEIIGIYSNYIYV
ccccccccEEEEEEcccccccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEEHHHcccccccccHHHHHHHccccEEEccccccccccccEEEEEEccccccccccHHHHHccccccHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccEEEEEEccccEEEcccccEEEEEEEEcccccccEEEEEEEcccEEEEEEEEcHHHHHHHHHHHHHHHHHHccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccHHHHHHHHcccccccccEEccccEEEEEcccEEc
cccEccccHccHHHHHHcccccccccHHHHHHHHccccccEEcccccccccccccccHHHHHHcccccccccccccHHHHHcccHEEEccccccccccccEEEEEcccccccccccHHHccccccccHHHHcccccccHHHEEcccccccccccccEHHHHHHHHccccccHHHHHHHHHHHccccccccHHHHHHHHHHcHcccHHHHHccccccccccccccccHHHHHccHHHHccccHHEEEEccccEEEcccccEEEEEEEEcccccccEEEEEEEcccccEEEEEEEcHHHHHHHHccccHHHHHHHcccccEccEEEEEEEHcHHHHHHHHHHHHHHHcccccccHHHccEccccccccccHHHccccccccEEEcccEEEEEEEcEEEc
mkevnnisYKGLLEAnqyslghnddrlNSIQeekrnnstktinknpnkqdfdvqNKSLFEIFLTtipdadnhihedeerlidndliynsykgamypsasqyftvrdlsasekdfpsiesfaskspqdiedisgflspdfsillknktdrdysdglctITDVFSQLKSDSGSFSNYLRHRKemfsedvplnpvdfLLEKQLDTASLGEEIcnlkgfsvpsryqssdsldALMSTESVLNQKSFMRvtmipesvhytdtgsIKALTIqmkpnspdnIVATLCLSGEKLSVKLRVESDFLYKKIQSGRQNILDALNfsgytmdrfdvEFVRKDSLDLLKDSMNYCaqqqgfthsnefekkklyfperertekkffwgekrsgliynkgEIIGIYSNYIYV
MKEVNNISYKGLLEANQYSLGHNDDRLNSIQeekrnnstktinknpnkqdfdVQNKSLFEIFLTTIPDADNHIHEDEERLIDNDLIYNSYKGAMYPSASQYFTVRDLSASEKDFPSIESFASKSPQDIEDISGFLSPDFSILLKNKTDRDYSDGLCTITDVFSQLKSDSGSFSNYLRHRKEMFSEDVPLNPVDFLLEKQLDTASLGEEICNLKGFSVPSRYQSSDSLDALMSTESVLNQKSFMRVTMIPESVHYTDTGSIKALTIQMKPNSPDNIVATLCLSGEKLSVKLRVESDFLYKKIQSGRQNILDALNFSGYTMDRFDVEFVRKDSLDLLKDSMNYCAQqqgfthsnefekkklyfperertekkffwgekrsgliynkgeiigiysnyiyv
MKEVNNISYKGLLEANQYSLGHNDDRLNSIQEEKRNNSTKTINKNPNKQDFDVQNKSLFEIFLTTIPDADNHIHEDEERLIDNDLIYNSYKGAMYPSASQYFTVRDLSASEKDFPSIESFASKSPQDIEDISGFLSPDFSILLKNKTDRDYSDGLCTITDVFSQLKSDSGSFSNYLRHRKEMFSEDVPLNPVDFLLEKQLDTASLGEEICNLKGFSVPSRYQSSDSLDALMSTESVLNQKSFMRVTMIPESVHYTDTGSIKALTIQMKPNSPDNIVATLCLSGEKLSVKLRVESDFLYKKIQSGRQNILDALNFSGYTMDRFDVEFVRKDSLDLLKDSMNYCAQQQGFTHSNEFEKKKLYFPERERTEKKFFWGEKRSGLIYNKGEIIGIYSNYIYV
*****NISYKGLLEANQY**********************************VQNKSLFEIFLTTIPDADNHIHEDEERLIDNDLIYNSYKGAMYPSASQYFTVRDLSASEKDFPSIESFASKSPQDIEDISGFLSPDFSILLKNKTDRDYSDGLCTITDVFSQLK************************PVDFLLEKQLDTASLGEEICNLKGFSV*****SSDSLDALMSTESVLNQKSFMR************TGSIKALTIQMKPNSPDNIVATLCLSGEKLSVKLRVESDF************LDALNFSGYTMDRFDVEF************************************************EKRSGLIYNKGEIIGIYSNYIYV
MKEVNNISYKGLLEANQYSLGHNDDRLNSIQEEKRNNSTKTINKNPNKQDFDVQNKSLFEIFLTTIPDADNHIHEDEERLIDNDLIYNSYKGAMYPSASQYFTVRDLSASEKDFPSIESFASKSPQDIEDISGFLSPDFSILLKNKTDRDYSDGLCTITDVFSQLKSDSGSFSNYLRHRKEMFSEDVPLNPVDFLLEKQLDTASLGEEICNLKGFSVPSRYQSSDSLDALMSTESVLNQKSFMRVTMIPESVHYTDTGSIKALTIQMKPNSPDNIVATLCLSGEKLSVKLRVESDFLYKKIQSGRQNILDALNFSGYTMDRFDVEFVRKDSLDLLKDSMNYCAQQQGFTHSNEFEKKKLYFPERERTEKKFFWGEKRSGLIYNKGEIIGIYSNYIYV
**EVNNISYKGLLEANQYSLGHNDDRLNSIQEEKRNNSTKTINKNPNKQDFDVQNKSLFEIFLTTIPDADNHIHEDEERLIDNDLIYNSYKGAMYPSASQYFTVRDLSAS*K*****ESFASKSPQDIEDISGFLSPDFSILLKNKTDRDYSDGLCTITDVFSQLKSDSGSFSNYLRHRKEMFSEDVPLNPVDFLLEKQLDTASLGEEICNLKGFSVP*****SDSLDALMSTESVLNQKSFMRVTMIPESVHYTDTGSIKALTIQMKPNSPDNIVATLCLSGEKLSVKLRVESDFLYKKIQSGRQNILDALNFSGYTMDRFDVEFVRKDSLDLLKDSMNYCAQQQGFTHSNEFEKKKLYFPERERTEKKFFWGEKRSGLIYNKGEIIGIYSNYIYV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEVNNISYKGLLEANQYSLGHNDDRLNSIQEEKRNNSTKTINKNPNKQDFDVQNKSLFEIFLTTIPDADNHIHEDEERLIDNDLIYNSYKGAMYPSASQYFTVRDLSASEKDFPSIESFASKSPQDIEDISGFLSPDFSILLKNKTDRDYSDGLCTITDVFSQLKSDSGSFSNYLRHRKEMFSEDVPLNPVDFLLEKQLDTASLGEEICNLKGFSVPSRYQSSDSLDALMSTESVLNQKSFMRVTMIPESVHYTDTGSIKALTIQMKPNSPDNIVATLCLSGEKLSVKLRVESDFLYKKIQSGRQNILDALNFSGYTMDRFDVEFVRKDSLDLLKDSMNYCAQQQGFTHSNEFEKKKLYFPERERTEKKFFWGEKRSGLIYNKGEIIGIYSNYIYV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target397 hypothetical protein CLIBASIA_02070 [Candidatus Liberib
315122282409 hypothetical protein CKC_02670 [Candidatus Liberibacter 1 3e-92
222084882535 chemotaxis motility protein [Agrobacterium radiobacter 1 2e-05
218506269216 chemotaxis motility protein [Rhizobium etli Brasil 5] L 1 2e-04
218516975169 chemotaxis motility protein [Rhizobium etli 8C-3] Lengt 1 2e-04
190890379474 chemotaxis motility protein [Rhizobium etli CIAT 652] L 1 4e-04
209547943475 chemotaxis motility protein [Rhizobium leguminosarum bv 1 5e-04
86356327475 chemotaxis motility protein [Rhizobium etli CFN 42] Len 1 0.001
218460648434 chemotaxis motility protein [Rhizobium etli Kim 5] Leng 1 0.001
241203121477 chemotaxis motility protein [Rhizobium leguminosarum bv 1 0.003
116250497477 chemotaxis MotD protein (motility protein D) [Rhizobium 2 2e-32
>gi|315122282|ref|YP_004062771.1| hypothetical protein CKC_02670 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 409 Back     alignment and organism information
 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 199/412 (48%), Positives = 272/412 (66%), Gaps = 19/412 (4%)

Query: 1   MKEVNNISYKGLLEANQYSLGHNDDRLNSIQEEKRNNSTKTINKNPNKQDFDVQNKSLFE 60
           MKEV+ I+ +   +    SL + D++L+++QE+K+NN+ K + K  +++D   Q KSLFE
Sbjct: 2   MKEVS-IACQDHFDIKSSSLDNRDNKLDAVQEKKKNNTAKILKKILDQKDISSQKKSLFE 60

Query: 61  IFLTTIPDADNHIHEDEERLIDNDLIYNSYKGAMYPSASQYFTVRDLSASEKDFPSIE-- 118
             L T+P+AD++I  +EE    N +  N     +  +      +RD++++E++   I+  
Sbjct: 61  KILLTVPNADSNICTNEEISFKNAVENNPCTENVCHNPLDELIMRDITSNEENDCLIKDS 120

Query: 119 -SFASKSPQDIEDISGFLSPDFSILLKNKTDRDYSDGLCTITDVFSQLKS---------- 167
               S+  +DI + S     DF I+  +K D D+SD L   T    QLKS          
Sbjct: 121 SEVCSRIAKDIYNSSTIALRDFLII--DKIDGDHSDFLLKSTVALLQLKSSPDSIELLPL 178

Query: 168 --DSGSFSNYLRHRKEMFSEDVPLNPVDFLLEKQLDTASLGEEICNLKGFSVPSRYQSSD 225
             +S S S+ LR  KE FS+D P   V FL+E++L T S  +EI NL+ FS+ SR   +D
Sbjct: 179 GLESDSTSSDLRQGKENFSKDKPCKAVGFLIEEKLTTVSEDKEIRNLESFSI-SRRLYND 237

Query: 226 SLDALMSTESVLNQKSFMRVTMIPESVHYTDTGSIKALTIQMKPNSPDNIVATLCLSGEK 285
            + +  STE+ LNQK  MR TMIPE  HY D GSIK L IQMKPNSPDN+VATL LSG+K
Sbjct: 238 GIGSFPSTENALNQKFAMRFTMIPEHFHYIDRGSIKTLKIQMKPNSPDNVVATLSLSGDK 297

Query: 286 LSVKLRVESDFLYKKIQSGRQNILDALNFSGYTMDRFDVEFVRKDSLDLLKDSMNYCAQQ 345
           LS+KL+VESD+LYKKIQ+ RQ ILDALNFSGYTMD FDV+F  KD+++L +DS+NY +QQ
Sbjct: 298 LSIKLQVESDYLYKKIQNERQGILDALNFSGYTMDHFDVDFRSKDTVNLYQDSINYFSQQ 357

Query: 346 QGFTHSNEFEKKKLYFPERERTEKKFFWGEKRSGLIYNKGEIIGIYSNYIYV 397
           QGF  S+ FE+KK++FPE+ R EKK FWGEKR+G+IYN GE IG+YS YIYV
Sbjct: 358 QGFKQSDGFERKKVHFPEKGRVEKKVFWGEKRTGIIYNNGEYIGMYSEYIYV 409


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084882|ref|YP_002543411.1| chemotaxis motility protein [Agrobacterium radiobacter K84] Length = 535 Back     alignment and organism information
>gi|218506269|ref|ZP_03504147.1| chemotaxis motility protein [Rhizobium etli Brasil 5] Length = 216 Back     alignment and organism information
>gi|218516975|ref|ZP_03513815.1| chemotaxis motility protein [Rhizobium etli 8C-3] Length = 169 Back     alignment and organism information
>gi|190890379|ref|YP_001976921.1| chemotaxis motility protein [Rhizobium etli CIAT 652] Length = 474 Back     alignment and organism information
>gi|209547943|ref|YP_002279860.1| chemotaxis motility protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 475 Back     alignment and organism information
>gi|86356327|ref|YP_468219.1| chemotaxis motility protein [Rhizobium etli CFN 42] Length = 475 Back     alignment and organism information
>gi|218460648|ref|ZP_03500739.1| chemotaxis motility protein [Rhizobium etli Kim 5] Length = 434 Back     alignment and organism information
>gi|241203121|ref|YP_002974217.1| chemotaxis motility protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 477 Back     alignment and organism information
>gi|116250497|ref|YP_766335.1| chemotaxis MotD protein (motility protein D) [Rhizobium leguminosarum bv. viciae 3841] Length = 477 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 397 hypothetical protein CLIBASIA_02070 [Candidatus Liberib
pfam0212085 Flg_hook Flagellar hook-length control protein FliK. Th 90.28
>pfam02120 Flg_hook Flagellar hook-length control protein FliK Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00