254780528

254780528

chemotaxis protein

GeneID in NCBI database:8209523Locus tag:CLIBASIA_02075
Protein GI in NCBI database:254780528Protein Accession:YP_003064941.1
Gene range:+(752914, 754104)Protein Length:396aa
Gene description:chemotaxis protein
COG prediction:none
KEGG prediction:chemotaxis protein; K10564 chemotaxis protein MotC
SEED prediction:chemotaxis motility protein
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHcccccccEEEEEHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHEEHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHccHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
ccHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHccccccccEEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHcccccHcccccccEEEEEHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHcc
MNQKYLICTMMVAMDVFfsfatdqdlvrtiVPYQCVRSLQRALDEAMRgdislqkkipdIVKETGVQLRATHMDVfvdnrnidAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSkikdkdntrgivpyLHLLIGrammpfssqqavhffdyvrltspgtfLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLhgqlklpdedivfTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDrldykdlaTIQLYENIlnipfvdimslqrstcnipyyslmEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDllldkkeprhtnvsMGIESFIKKNRSQIESIDVLLAEAR
MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRgdislqkkipdiVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKElskikdkdntrgIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIaqnsvisgkrkIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLlldkkeprhtnVSMGIesfikknrsqiesIDVLLAEAR
MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR
****YLICTMMVAMDV****************YQCVRSLQRALDEAMR******KKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLA***************LATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMS****************************************NRSQIESIDVLLA***
MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSG***********IKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR
*NQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEA*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR
MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR
MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target396 chemotaxis protein [Candidatus Liberibacter asiaticus s
315122281397 chemotaxis protein [Candidatus Liberibacter solanacearu 1 1e-130
116250496431 chemotaxis protein [Rhizobium leguminosarum bv. viciae 1 2e-33
218461677442 chemotaxis protein [Rhizobium etli Kim 5] Length = 442 1 3e-33
222084881433 chemotaxis motility protein [Agrobacterium radiobacter 1 4e-33
241203120431 chemotaxis protein [Rhizobium leguminosarum bv. trifoli 1 6e-33
218680024357 chemotaxis protein [Rhizobium etli CIAT 894] Length = 3 1 7e-33
327193054431 chemotaxis motility protein [Rhizobium etli CNPAF512] L 1 1e-31
190890378431 chemotaxis motility protein [Rhizobium etli CIAT 652] L 1 6e-31
307318925434 chemotaxis protein [Sinorhizobium meliloti AK83] Length 1 1e-30
307311570434 chemotaxis protein [Sinorhizobium meliloti BL225C] Leng 1 1e-30
>gi|315122281|ref|YP_004062770.1| chemotaxis protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 397 Back     alignment and organism information
 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 313/399 (78%), Gaps = 5/399 (1%)

Query: 1   MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI 60
           MNQK LI  M++ M+VF SFA +QDL  +  PY  +R LQR LD +++     +KKI DI
Sbjct: 1   MNQKCLIMIMIMVMEVFPSFAMNQDLENSNAPYARIRFLQRVLDSSLQEGGYSKKKILDI 60

Query: 61  VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK 120
           V+E G+QLR T+M  F D+RN+DAV+IYTIIS+++S+++ LIA D KGYFD++IV+AL+K
Sbjct: 61  VEEVGLQLRTTNMSFFADHRNVDAVFIYTIISENISILNYLIANDKKGYFDLSIVHALRK 120

Query: 121 YFSGQLEESSKELSKIKDKDNT--RGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPG 178
           YF+G+ EES K L+ IKD D+   +GI PY +LL+GRAMM  +S++A+ FFD VRLTS G
Sbjct: 121 YFAGEFEESIKALNTIKDNDHIHIKGIEPYFYLLMGRAMMKLNSKEAIQFFDRVRLTSSG 180

Query: 179 TFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLP 237
           T LEE++LRNLLEIT N+ + E  FGYIR Y+ QF+HSIYKD+FI++LLRFFLH ++KL 
Sbjct: 181 TALEEMSLRNLLEITLNQGIEEHVFGYIRDYIRQFYHSIYKDNFINLLLRFFLHSKIKLQ 240

Query: 238 DEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQL 297
           D+DIVF +SF  ++EQRAIY KIAQ++VI GKRKIG LAI+QLK ++ +LD++DLATI L
Sbjct: 241 DKDIVFVMSFLEVDEQRAIYFKIAQHAVIFGKRKIGLLAIQQLKEMVYKLDHRDLATIWL 300

Query: 298 YENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKD 357
           Y +++NIPFVD + LQRS CNIP YSLME+DR LKK+SE+I+SE+ KS I+IDF+HI K 
Sbjct: 301 YNDLMNIPFVDTVLLQRSLCNIPEYSLMEKDRNLKKSSEVILSEMRKSSINIDFDHIDKY 360

Query: 358 LLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396
           L+LD K+  HT+    +ESFIKKNR +IE IDV L   R
Sbjct: 361 LVLDTKQHEHTH--WNLESFIKKNRQKIEVIDVYLEGTR 397


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116250496|ref|YP_766334.1| chemotaxis protein [Rhizobium leguminosarum bv. viciae 3841] Length = 431 Back     alignment and organism information
>gi|218461677|ref|ZP_03501768.1| chemotaxis protein [Rhizobium etli Kim 5] Length = 442 Back     alignment and organism information
>gi|222084881|ref|YP_002543410.1| chemotaxis motility protein [Agrobacterium radiobacter K84] Length = 433 Back     alignment and organism information
>gi|241203120|ref|YP_002974216.1| chemotaxis protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 431 Back     alignment and organism information
>gi|218680024|ref|ZP_03527921.1| chemotaxis protein [Rhizobium etli CIAT 894] Length = 357 Back     alignment and organism information
>gi|327193054|gb|EGE59966.1| chemotaxis motility protein [Rhizobium etli CNPAF512] Length = 431 Back     alignment and organism information
>gi|190890378|ref|YP_001976920.1| chemotaxis motility protein [Rhizobium etli CIAT 652] Length = 431 Back     alignment and organism information
>gi|307318925|ref|ZP_07598356.1| chemotaxis protein [Sinorhizobium meliloti AK83] Length = 434 Back     alignment and organism information
>gi|307311570|ref|ZP_07591211.1| chemotaxis protein [Sinorhizobium meliloti BL225C] Length = 434 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target396 chemotaxis protein [Candidatus Liberibacter asiaticus s
PRK12798421 PRK12798, PRK12798, chemotaxis protein; Reviewed 7e-41
>gnl|CDD|183755 PRK12798, PRK12798, chemotaxis protein; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 396 chemotaxis protein [Candidatus Liberibacter asiaticus s
PRK12798416 chemotaxis protein; Reviewed 100.0
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00