254780529

254780529

flagellar motor protein MotB

GeneID in NCBI database:8209524Locus tag:CLIBASIA_02080
Protein GI in NCBI database:254780529Protein Accession:YP_003064942.1
Gene range:+(751874, 752905)Protein Length:343aa
Gene description:flagellar motor protein MotB
COG prediction:[N] Flagellar motor protein
KEGG prediction:flagellar motor protein MotB; K02557 chemotaxis protein MotB
SEED prediction:Flagellar motor rotation protein MotB
Pathway involved in KEGG:Bacterial chemotaxis [PATH:las02030]
Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
MNSHGDKNQENDQFIIIKKKVAIDDTPNNLGSWKIVYADFMTVLMAFFLVMWIINATDDDTKKAIEQYFNPFGKNLMTASKGIFDEQNPPERSSQNKIDLSIDEHITKNSVDLKIGSTNQKKQYQRLENNIFYLSNSQQSEHCKNSLTRDSEKGKDLCKSTDLEKSINKEENYFLPPLSKEKILAMKRKKRLQDLAKKISSTLSGLVADNIVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDRQG
ccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEcccccccccccHHHHcccEEEEEEEcccc
cccccHHHHccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHccccccccccccccccccccccccccccccccccccccccccccHHcccHHHccccHHcccHHHcccccccHccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcEEEEEccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccHHHHHHHHHHHHHccccHHHEEEEEEccccccccccccccccccEEEEEEEcccc
mnshgdknqendQFIIIKKkvaiddtpnnlgsWKIVYADFMTVLMAFFLVMWIINATDDDTKKAIEQYFNPFGKNLMTAskgifdeqnpperssqnkidlsidehitknsvdlkigstnqkKQYQRLENNIFylsnsqqsehcknsltrdsekgkdlckstdleksinkeenyflpplskEKILAMKRKKRLQDLAKKISSTLSGLVADNIVKGVLFETTRTGILISIidqrntpmfdksssiplpeTIVVLQKIGEVLAHSTEVisirghtdaspfrniardNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLkiasdpmnsanrrIDILVEDRQG
mnshgdknqenDQFIIIKkkvaiddtpnnlGSWKIVYADFMTVLMAFFLVMWIINATDDDTKKAIEQYFNPFGKNLMTASKGIFDEQNPPERSSQNKIDLSIDEHItknsvdlkigstnqKKQYQRLENNIFYlsnsqqsehcknsltrdsekgkdlckstdleksinkeenyflpplskeKILAMKRKKRLQDLAKKisstlsglvadniVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVIsirghtdaspfrniARDNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHrlkiasdpmnsanrridilvedrqg
MNSHGDKNQENDQFIIIKKKVAIDDTPNNLGSWKIVYADFMTVLMAFFLVMWIINATDDDTKKAIEQYFNPFGKNLMTASKGIFDEQNPPERSSQNKIDLSIDEHITKNSVDLKIGSTNQKKQYQRLENNIFYLSNSQQSEHCKNSLTRDSEKGKDLCKSTDLEKSINKEENYFLPPLSKEKILAMKRKKRLQDLAKKISSTLSGLVADNIVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDRQG
*********************************KIVYADFMTVLMAFFLVMWIINATDDD**********************************************************************************************************************************************************VLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDR**
*********ENDQFIIIKKKVAIDDTPNNLGSWKIVYADFMTVLMAFFLVMWIINATDDDTKKAIEQYFNPFGKNLMTASKGIFD**********NKIDLSIDEHITKNSVDLKIGSTNQKKQYQRLENNIFYLSNS********************CKSTDLEKSINKEENYFLPPLSKEKILAMKRKKRLQDLAKKISSTLSGLVADNIVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDRQG
**SHGDKNQENDQFIIIKKKVAIDDTPNNLGSWKIVYADFMTVLMAFFLVMWIINATDDDTKKAIEQYFNPFGKNL********************************************************YL***********************************EENYFLPPLSKEKILAMKRKKRLQDLAKKISSTLSGLVADNIVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDR**
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSHGDKNQENDQFIIIKKKVAIDDTPNNLGSWKIVYADFMTVLMAFFLVMWIINATDDDTKKAIEQYFNPFGKNLMTASKGIFDEQNPPERSSQNKIDLSIDEHITKNSVDLKIGSTNQKKQYQRLENNIFYLSNSQQSEHCKNSLTRDSEKGKDLCKSTDLEKSINKEENYFLPPLSKEKILAMKRKKRLQDLAKKISSTLSGLVADNIVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDRQG
MNSHGDKNQENDQFIIIKKKVAIDDTPNNLGSWKIVYADFMTVLMAFFLVMWIINATDDDTKKAIEQYFNPFGKNLMTASKGIFDEQNPPERSSQNKIDLSIDEHITKNSVDLKIGSTNQKKQYQRLENNIFYLSNSQQSEHCKNSLTRDSEKGKDLCKSTDLEKSINKEENYFLPPLSKEKILAMKRKKRLQDLAKKISSTLSGLVADNIVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDRQG
MNSHGDKNQENDQFIIIKKKVAIDDTPNNLGSWKIVYADFMTVLMAFFLVMWIINATDDDTKKAIEQYFNPFGKNLMTASKGIFDEQNPPERSSQNKIDLSIDEHITKNSVDLKIGSTNQKKQYQRLENNIFYLSNSQQSEHCKNSLTRDSEKGKDLCKSTDLEKSINKEENYFLPPLSKEKILAMKRKKRLQDLAKKISSTLSGLVADNIVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDRQG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target343 flagellar motor protein MotB [Candidatus Liberibacter a
254780953190 OmpA/MotB [Candidatus Liberibacter asiaticus str. 0.003
254780547160 OmpA/MotB [Candidatus Liberibacter asiaticus str. 0.003
>gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 190 Back     alignment
 Score = 34.7 bits (78), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 251 VLQKIGEVL-AHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRI 309
           +LQ I  +L    + VI+I+ HTD+       ++N  +S +RA      L++ GVS +R 
Sbjct: 95  MLQLIATILNKFPSTVIAIQSHTDSI---GTLKNNLLISQERADVIKSYLIQRGVSSNRF 151

Query: 310 SKISGFAH 317
             + GFA+
Sbjct: 152 ISVRGFAY 159

>gi|254780547|ref|YP_003064960.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Back     alignment
 Score = 34.3 bits (77), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 233 NTPMFDKSSSIPLPETIVVLQKIGEVLA-HSTEVISIRGHTDASPFRNIARDNWRLSLDR 291
           ++  FD SS    P  I VL  +G  L  H  + + I GH D    RN    +  L L R
Sbjct: 50  DSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFL-IEGHADELGSRN---SSIALGLRR 105

Query: 292 AYSAYQVLMKSGVSEDRI 309
           AY+ +   +  G+S  R+
Sbjct: 106 AYAVFNYFVARGISASRM 123

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target343 flagellar motor protein MotB [Candidatus Liberibacter a
315122280158 flagellar motor protein MotB [Candidatus Liberibacter s 1 8e-63
150395498397 flagellar motor protein MotB [Sinorhizobium medicae WSM 1 4e-46
163758026411 flagellar motor protein [Hoeflea phototrophica DFL-43] 1 6e-46
304392497364 chemotaxis protein MotB [Ahrensia sp. R2A130] Length = 1 1e-38
121602153357 putative flagellar motor protein MotB [Bartonella bacil 1 2e-35
306841271366 flagellar motor protein MotB [Brucella sp. BO2] Length 1 7e-35
319898651384 flagellar motor protein MotB [Bartonella clarridgeiae 7 1 8e-35
306840141366 flagellar motor protein MotB [Brucella sp. NF 2653] Len 1 1e-34
254720768366 flagellar motor protein MotB [Brucella sp. 83/13] Lengt 1 2e-34
294852974366 chemotaxis protein MotB [Brucella sp. NVSL 07-0026] Len 1 2e-34
>gi|315122280|ref|YP_004062769.1| flagellar motor protein MotB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 158 Back     alignment and organism information
 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 137/158 (86%)

Query: 186 MKRKKRLQDLAKKISSTLSGLVADNIVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPL 245
           MKRKKR+QDL +KIS+TLSGLVA++IVKG+LF+TT  G+LISIID  NTPMFDKSSSIPL
Sbjct: 1   MKRKKRMQDLEQKISTTLSGLVANHIVKGILFKTTPNGMLISIIDHNNTPMFDKSSSIPL 60

Query: 246 PETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVS 305
           PE I++LQKIGE L+ S E ISI GHTDASPFR+   DNW+LSLDRAYS YQ+LMKSG+S
Sbjct: 61  PEMILILQKIGEALSQSNENISIEGHTDASPFRHSTGDNWKLSLDRAYSTYQILMKSGIS 120

Query: 306 EDRISKISGFAHHRLKIASDPMNSANRRIDILVEDRQG 343
           E RISKISG A H  KI+SDPMN+ANRRI+ILV+D +G
Sbjct: 121 EKRISKISGLAQHNPKISSDPMNAANRRIEILVQDGEG 158


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150395498|ref|YP_001325965.1| flagellar motor protein MotB [Sinorhizobium medicae WSM419] Length = 397 Back     alignment and organism information
>gi|163758026|ref|ZP_02165114.1| flagellar motor protein [Hoeflea phototrophica DFL-43] Length = 411 Back     alignment and organism information
>gi|304392497|ref|ZP_07374437.1| chemotaxis protein MotB [Ahrensia sp. R2A130] Length = 364 Back     alignment and organism information
>gi|121602153|ref|YP_989388.1| putative flagellar motor protein MotB [Bartonella bacilliformis KC583] Length = 357 Back     alignment and organism information
>gi|306841271|ref|ZP_07473982.1| flagellar motor protein MotB [Brucella sp. BO2] Length = 366 Back     alignment and organism information
>gi|319898651|ref|YP_004158744.1| flagellar motor protein MotB [Bartonella clarridgeiae 73] Length = 384 Back     alignment and organism information
>gi|306840141|ref|ZP_07472926.1| flagellar motor protein MotB [Brucella sp. NF 2653] Length = 366 Back     alignment and organism information
>gi|254720768|ref|ZP_05182579.1| flagellar motor protein MotB [Brucella sp. 83/13] Length = 366 Back     alignment and organism information
>gi|294852974|ref|ZP_06793646.1| chemotaxis protein MotB [Brucella sp. NVSL 07-0026] Length = 366 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target343 flagellar motor protein MotB [Candidatus Liberibacter a
PRK05996423 PRK05996, motB, flagellar motor protein MotB; Validated 7e-41
PRK06742225 PRK06742, PRK06742, flagellar motor protein MotS; Revie 3e-07
PRK06667252 PRK06667, motB, flagellar motor protein MotB; Validated 7e-07
COG1360244 COG1360, MotB, Flagellar motor protein [Cell motility a 1e-20
PRK09041317 PRK09041, motB, flagellar motor protein MotB; Validated 3e-36
PRK06778289 PRK06778, PRK06778, hypothetical protein; Validated 1e-22
PRK05996423 PRK05996, motB, flagellar motor protein MotB; Validated 9e-20
PRK12799421 PRK12799, motB, flagellar motor protein MotB; Reviewed 1e-10
COG1360244 COG1360, MotB, Flagellar motor protein [Cell motility a 3e-10
cd07185106 cd07185, OmpA_C-like, Peptidoglycan binding domains sim 1e-13
PRK12799 421 PRK12799, motB, flagellar motor protein MotB; Reviewed 9e-13
pfam0069197 pfam00691, OmpA, OmpA family 6e-09
COG2885190 COG2885, OmpA, Outer membrane protein and related pepti 2e-07
PRK07033427 PRK07033, PRK07033, hypothetical protein; Provisional 7e-07
PRK09039343 PRK09039, PRK09039, hypothetical protein; Validated 7e-07
PRK08457257 PRK08457, motB, flagellar motor protein MotB; Reviewed 9e-05
TIGR02802104 TIGR02802, Pal_lipo, peptidoglycan-associated lipoprote 9e-04
PRK10510219 PRK10510, PRK10510, putative outer membrane lipoprotein 0.002
PRK08944302 PRK08944, motB, flagellar motor protein MotB; Reviewed 8e-12
PRK09038281 PRK09038, PRK09038, flagellar motor protein MotD; Revie 9e-11
TIGR03350137 TIGR03350, type_VI_ompA, type VI secretion system OmpA/ 8e-10
PRK07734259 PRK07734, motB, flagellar motor protein MotB; Reviewed 1e-05
PRK08126432 PRK08126, PRK08126, hypothetical protein; Provisional 2e-05
PRK09038281 PRK09038, PRK09038, flagellar motor protein MotD; Revie 3e-04
>gnl|CDD|168338 PRK05996, motB, flagellar motor protein MotB; Validated Back     alignment and domain information
>gnl|CDD|102525 PRK06742, PRK06742, flagellar motor protein MotS; Reviewed Back     alignment and domain information
>gnl|CDD|180652 PRK06667, motB, flagellar motor protein MotB; Validated Back     alignment and domain information
>gnl|CDD|31551 COG1360, MotB, Flagellar motor protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|181621 PRK09041, motB, flagellar motor protein MotB; Validated Back     alignment and domain information
>gnl|CDD|180691 PRK06778, PRK06778, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|168338 PRK05996, motB, flagellar motor protein MotB; Validated Back     alignment and domain information
>gnl|CDD|183756 PRK12799, motB, flagellar motor protein MotB; Reviewed Back     alignment and domain information
>gnl|CDD|31551 COG1360, MotB, Flagellar motor protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|143586 cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA Back     alignment and domain information
>gnl|CDD|183756 PRK12799, motB, flagellar motor protein MotB; Reviewed Back     alignment and domain information
>gnl|CDD|144333 pfam00691, OmpA, OmpA family Back     alignment and domain information
>gnl|CDD|32711 COG2885, OmpA, Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|180801 PRK07033, PRK07033, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181619 PRK09039, PRK09039, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|181435 PRK08457, motB, flagellar motor protein MotB; Reviewed Back     alignment and domain information
>gnl|CDD|131849 TIGR02802, Pal_lipo, peptidoglycan-associated lipoprotein Back     alignment and domain information
>gnl|CDD|182507 PRK10510, PRK10510, putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>gnl|CDD|181590 PRK08944, motB, flagellar motor protein MotB; Reviewed Back     alignment and domain information
>gnl|CDD|181618 PRK09038, PRK09038, flagellar motor protein MotD; Reviewed Back     alignment and domain information
>gnl|CDD|132393 TIGR03350, type_VI_ompA, type VI secretion system OmpA/MotB family protein Back     alignment and domain information
>gnl|CDD|181095 PRK07734, motB, flagellar motor protein MotB; Reviewed Back     alignment and domain information
>gnl|CDD|181240 PRK08126, PRK08126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181618 PRK09038, PRK09038, flagellar motor protein MotD; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 343 flagellar motor protein MotB [Candidatus Liberibacter a
PRK05996431 motB flagellar motor protein MotB; Validated 100.0
PRK09041317 motB flagellar motor protein MotB; Validated 100.0
PRK06778289 hypothetical protein; Validated 100.0
PRK12799 424 motB flagellar motor protein MotB; Reviewed 100.0
PRK08944305 motB flagellar motor protein MotB; Reviewed 100.0
PRK09038285 flagellar motor protein MotD; Reviewed 100.0
PRK07734259 motB flagellar motor protein MotB; Reviewed 100.0
PRK06925230 flagellar motor protein MotS; Reviewed 100.0
PRK08457251 motB flagellar motor protein MotB; Reviewed 100.0
PRK06667254 motB flagellar motor protein MotB; Validated 100.0
PRK06742225 flagellar motor protein MotS; Reviewed 100.0
COG1360244 MotB Flagellar motor protein [Cell motility and secreti 100.0
PRK09040215 hypothetical protein; Provisional 100.0
PRK07033429 hypothetical protein; Provisional 100.0
PRK09039343 hypothetical protein; Validated 100.0
PRK08126428 hypothetical protein; Provisional 100.0
TIGR03350137 type_VI_ompA type VI secretion system OmpA/MotB family 99.97
PRK10510219 putative outer membrane lipoprotein; Provisional 99.96
PRK09967160 putative outer membrane lipoprotein; Provisional 99.94
COG2885190 OmpA Outer membrane protein and related peptidoglycan-a 99.93
PRK10802173 peptidoglycan-associated outer membrane lipoprotein; Pr 99.92
TIGR02802104 Pal_lipo peptidoglycan-associated lipoprotein; InterPro 99.91
PRK10808347 outer membrane protein A; Reviewed 99.91
cd07185106 OmpA_C-like Peptidoglycan binding domains similar to th 99.9
PRK07034565 hypothetical protein; Provisional 99.85
pfam0069197 OmpA OmpA family. The Pfam entry also includes MotB and 99.82
>PRK05996 motB flagellar motor protein MotB; Validated Back     alignment and domain information
>PRK09041 motB flagellar motor protein MotB; Validated Back     alignment and domain information
>PRK06778 hypothetical protein; Validated Back     alignment and domain information
>PRK12799 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK08944 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK09038 flagellar motor protein MotD; Reviewed Back     alignment and domain information
>PRK07734 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK06925 flagellar motor protein MotS; Reviewed Back     alignment and domain information
>PRK08457 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK06667 motB flagellar motor protein MotB; Validated Back     alignment and domain information
>PRK06742 flagellar motor protein MotS; Reviewed Back     alignment and domain information
>COG1360 MotB Flagellar motor protein [Cell motility and secretion] Back     alignment and domain information
>PRK09040 hypothetical protein; Provisional Back     alignment and domain information
>PRK07033 hypothetical protein; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK08126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03350 type_VI_ompA type VI secretion system OmpA/MotB family protein Back     alignment and domain information
>PRK10510 putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>PRK09967 putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>COG2885 OmpA Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10802 peptidoglycan-associated outer membrane lipoprotein; Provisional Back     alignment and domain information
>TIGR02802 Pal_lipo peptidoglycan-associated lipoprotein; InterPro: IPR014169 Members in this entry represent the peptidoglycan-associated lipoprotein (Pal or OprL) protein of the Tol-Pal system Back     alignment and domain information
>PRK10808 outer membrane protein A; Reviewed Back     alignment and domain information
>cd07185 OmpA_C-like Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA Back     alignment and domain information
>PRK07034 hypothetical protein; Provisional Back     alignment and domain information
>pfam00691 OmpA OmpA family Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target343 flagellar motor protein MotB [Candidatus Liberibacter a
2zvy_A183 Structure Of The Periplasmic Domain Of Motb From Sa 2e-23
2zov_A210 Structure Of The Periplasmic Domain Of Motb From Sa 4e-22
2k1s_A149 Solution Nmr Structure Of The Folded C-Terminal Fra 4e-18
3khn_A174 Crystal Structure Of Putative Motb Like Protein Dvu 9e-17
2zf8_A278 Crystal Structure Of Moty Length = 278 4e-12
2kgw_A129 Solution Structure Of The Carboxy-Terminal Domain O 1e-15
3nb3_A346 The Host Outer Membrane Proteins Ompa And Ompc Are 3e-15
2hqs_H118 Crystal Structure Of TolbPAL COMPLEX Length = 118 7e-12
1oap_A109 Mad Structure Of The Periplasmique Domain Of The Es 7e-12
2aiz_P134 Solution Structure Of Peptidoglycan Associated Lipo 1e-11
3cyp_B138 The Crystal Structure Of The C-Terminal Domain Of H 9e-11
3ldt_A169 Crystal Structure Of An Outer Membrane Protein(Ompa 2e-09
1r1m_A164 Structure Of The Ompa-Like Domain Of Rmpm From Neis 7e-09
3oon_A123 The Structure Of An Outer Membrance Protein From Bo 2e-06
>gi|257097127|pdb|2ZVY|A Chain A, Structure Of The Periplasmic Domain Of Motb From Salmonella (Crystal Form Ii) Length = 183 Back     alignment and structure
 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/169 (26%), Positives = 77/169 (45%), Gaps = 3/169 (1%)

Query: 177 PLSKEKILAMKRKKRLQDLAKKISSTLS-GLVADNIVKGVLFETTRTGILISIIDQRNTP 235
             + +++     + RL  L   +   +        +   +  +  + G+ I IID +N P
Sbjct: 3   QPNIDELKKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRP 62

Query: 236 MFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIA--RDNWRLSLDRAY 293
           MF   S+   P    +L+ I  VL      IS+ GHTD  P+ N      NW LS DRA 
Sbjct: 63  MFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELSADRAN 122

Query: 294 SAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDRQ 342
           ++ + L+  G+   ++ ++ G A         P ++ NRRI +LV ++Q
Sbjct: 123 ASRRELVAGGLDNGKVLRVVGMAATMRLSDRGPDDAINRRISLLVLNKQ 171


>gi|239781764|pdb|2ZOV|A Chain A, Structure Of The Periplasmic Domain Of Motb From Salmonella (Crystal Form I) Length = 210 Back     alignment and structure
>gi|188036026|pdb|2K1S|A Chain A, Solution Nmr Structure Of The Folded C-Terminal Fragment Of Yiad From Escherichia Coli. Northeast Structural Genomics Consortium Target Er553 Length = 149 Back     alignment and structure
>gi|270047795|pdb|3KHN|A Chain A, Crystal Structure Of Putative Motb Like Protein Dvu_2228 From Desulfovibrio Vulgaris. Length = 174 Back     alignment and structure
>gi|193885262|pdb|2ZF8|A Chain A, Crystal Structure Of Moty Length = 278 Back     alignment and structure
>gi|290559940|pdb|2KGW|A Chain A, Solution Structure Of The Carboxy-Terminal Domain Of Ompatb, A Pore Forming Protein From Mycobacterium Tuberculosis Length = 129 Back     alignment and structure
>gi|323462898|pdb|3NB3|A Chain A, The Host Outer Membrane Proteins Ompa And Ompc Are Packed At Specific Sites In The Shigella Phage Sf6 Virion As Structural Components Length = 346 Back     alignment and structure
>gi|145579534|pdb|2HQS|H Chain H, Crystal Structure Of TolbPAL COMPLEX Length = 118 Back     alignment and structure
>gi|46015011|pdb|1OAP|A Chain A, Mad Structure Of The Periplasmique Domain Of The Escherichia Coli Pal Protein Length = 109 Back     alignment and structure
>gi|159163741|pdb|2AIZ|P Chain P, Solution Structure Of Peptidoglycan Associated Lipoprotein From Haemophilus Influenza Bound To Udp-N-Acetylmuramoyl-L- Alanyl-D-Glutamyl-Meso-2,6-Diaminopimeloyl-D-Alanyl-D- Alanine Length = 134 Back     alignment and structure
>gi|193885364|pdb|3CYP|B Chain B, The Crystal Structure Of The C-Terminal Domain Of Helicobacter Pylori Motb (Residues 125-256). Length = 138 Back     alignment and structure
>gi|285803774|pdb|3LDT|A Chain A, Crystal Structure Of An Outer Membrane Protein(Ompa)from Legionella Pneumophila Length = 169 Back     alignment and structure
>gi|49258621|pdb|1R1M|A Chain A, Structure Of The Ompa-Like Domain Of Rmpm From Neisseria Meningitidis Length = 164 Back     alignment and structure
>gi|307568444|pdb|3OON|A Chain A, The Structure Of An Outer Membrance Protein From Borrelia Burgdorferi B31 Length = 123 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target343 flagellar motor protein MotB [Candidatus Liberibacter a
2zov_A210 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 1e-23
2zvy_A183 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 6e-18
3khn_A174 MOTB protein, putative; structural genomics, OMPA-like 5e-04
2zf8_A278 MOTY, component of sodium-driven polar flagellar motor; 4e-12
3cyp_B138 Chemotaxis protein MOTB; bacterial flagellar motor, pep 1e-11
3ldt_A169 Outer membrane protein, OMPA family protein; OMPA-like 2e-11
3oon_A123 Outer membrane protein (TPN50); protein structure initi 2e-11
2kgw_A129 Outer membrane protein A; OMPA- like, cell membrane, tr 4e-11
1r1m_A164 Outer membrane protein class 4; 1.90A {Neisseria mening 4e-08
>2zov_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium} Length = 210 Back     alignment and structure
 Score =  105 bits (263), Expect = 1e-23
 Identities = 45/181 (24%), Positives = 82/181 (45%), Gaps = 3/181 (1%)

Query: 165 KSINKEENYFLPPLSKEKILAMKRKKRLQDLAKKISSTLSGLVADNIVKG-VLFETTRTG 223
               +++       + +++     + RL  L   +   +        ++  +  +  + G
Sbjct: 2   DDYTQQQGEVEKQPNIDELKKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEG 61

Query: 224 ILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIAR- 282
           + I IID +N PMF   S+   P    +L+ I  VL      IS+ GHTD  P+ N  + 
Sbjct: 62  LRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKG 121

Query: 283 -DNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDR 341
             NW LS DRA ++ + L+  G+   ++ ++ G A         P ++ NRRI +LV ++
Sbjct: 122 YSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATMRLSDRGPDDAINRRISLLVLNK 181

Query: 342 Q 342
           Q
Sbjct: 182 Q 182


>2zvy_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A Length = 183 Back     alignment and structure
>3khn_A MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Length = 174 Back     alignment and structure
>2zf8_A MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus} Length = 278 Back     alignment and structure
>3cyp_B Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B* Length = 138 Back     alignment and structure
>3ldt_A Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} Length = 169 Back     alignment and structure
>3oon_A Outer membrane protein (TPN50); protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; 1.79A {Borrelia burgdorferi} Length = 123 Back     alignment and structure
>2kgw_A Outer membrane protein A; OMPA- like, cell membrane, transmembrane; NMR {Mycobacterium tuberculosis} Length = 129 Back     alignment and structure
>1r1m_A Outer membrane protein class 4; 1.90A {Neisseria meningitidis} SCOP: d.79.7.1 Length = 164 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 flagellar motor protein MotB [Candidatus Liberibacter a
2zov_A210 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 100.0
2zvy_A183 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 100.0
3khn_A174 MOTB protein, putative; structural genomics, OMPA-like 99.96
3ldt_A169 Outer membrane protein, OMPA family protein; OMPA-like 99.96
2k1s_A149 Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha 99.94
3oon_A123 Outer membrane protein (TPN50); protein structure initi 99.91
3cyp_B138 Chemotaxis protein MOTB; bacterial flagellar motor, pep 99.92
2kgw_A129 Outer membrane protein A; OMPA- like, cell membrane, tr 99.91
1r1m_A164 Outer membrane protein class 4; 1.90A {Neisseria mening 99.91
2zf8_A278 MOTY, component of sodium-driven polar flagellar motor; 99.9
2hqs_H118 Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, t 99.9
2aiz_P134 Outer membrane protein P6; alpha-beta sandwich; HET: UD 99.88
>2zov_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium} Back     alignment and structure
Probab=100.00  E-value=8e-33  Score=236.71  Aligned_cols=152  Identities=29%  Similarity=0.455  Sum_probs=127.9

Q ss_pred             HHHHHHHHHHHHHHHHHH-HHHHCCCEEEECCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             999999999999975553-3210131145114534999970345674555687546835656544367898612783389
Q gi|254780529|r  190 KRLQDLAKKISSTLSGLV-ADNIVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISI  268 (343)
Q Consensus       190 ~~~~~~~~~i~~~~~~~~-~~~~~~~~~v~~~~~~i~I~i~d~~~~~lF~~gsa~l~~~~~~~l~~ia~~l~~~~~~i~I  268 (343)
                      ..+..+...+...+.... .......+.++..+.++.|+|.+....+||.+||+.|++.++.+|.+||.+|+.+|+.|.|
T Consensus        27 ~~l~~l~~~l~~~~~~~~~~~~~~~~~~i~~~~~gl~i~i~d~~~~vlF~~gsa~l~~~~~~~L~~ia~~l~~~p~~i~I  106 (210)
T 2zov_A           27 SRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISL  106 (210)
T ss_dssp             HHHHHHHHHHHHHHHHCHHHHHHGGGEEEEEETTEEEEEEECCSSSCSBCTTSCCBCHHHHHHHHHHHHHHTTSCCCEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             99999999999999870988865237358981695189998489984768997435988999999999999735856999


Q ss_pred             EEEECCCCCCC--CCCCHHHHHHHHHHHHHHHHHHCCCCHHHEEEEEECCCCCCCCCCCCCCCCCCEEEEEEECC
Q ss_conf             87314676678--74106999999999999999986999657122563033488889885213375599999569
Q gi|254780529|r  269 RGHTDASPFRN--IARDNWRLSLDRAYSAYQVLMKSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDR  341 (343)
Q Consensus       269 eGHTD~~p~~g--~~~~Nw~LS~~RA~aV~~~L~~~Gv~~~ri~~v~G~g~~~P~~~n~t~~~~NRRVEi~i~~~  341 (343)
                      +||||++|+.+  .+++||+||++||.+|++||+..|+++.|+++|.|||+++|+++|++.+++||||||+|...
T Consensus       107 ~GHTD~~~~~~~~~~~sN~~LS~~RA~aV~~~L~~~g~~~~~~l~v~G~G~~~P~~~~~~~~a~NRRVEI~il~~  181 (210)
T 2zov_A          107 AGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATMRLSDRGPDDAINRRISLLVLNK  181 (210)
T ss_dssp             EEEEECSCCCSSCSSCCHHHHHHHHHHHHHHHHHHTTCCTTCEEEEEEECCC---------CCCEEEEEEEEECH
T ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCCCCHHHCCCEEEEEECC
T ss_conf             986488764457764306789999999999999985998045899998678878997996648729889999785



>2zvy_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A Back     alignment and structure
>3khn_A MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Back     alignment and structure
>3ldt_A Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} Back     alignment and structure
>2k1s_A Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12} Back     alignment and structure
>3oon_A Outer membrane protein (TPN50); protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; 1.79A {Borrelia burgdorferi} Back     alignment and structure
>3cyp_B Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B* 3imp_B Back     alignment and structure
>2kgw_A Outer membrane protein A; OMPA- like, cell membrane, transmembrane; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1r1m_A Outer membrane protein class 4; 1.90A {Neisseria meningitidis} SCOP: d.79.7.1 Back     alignment and structure
>2zf8_A MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus} Back     alignment and structure
>2hqs_H Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli} SCOP: d.79.7.1 PDB: 2w8b_C 1oap_A Back     alignment and structure
>2aiz_P Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} SCOP: d.79.7.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 343 flagellar motor protein MotB [Candidatus Liberibacter a
d1r1ma_140 d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-t 0.003
>d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Length = 140 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: OmpA-like
family: OmpA-like
domain: Outer membrane protein class 4, RmpM, C-terminal domain
species: Neisseria meningitidis [TaxId: 487]
 Score = 36.8 bits (84), Expect = 0.003
 Identities = 24/126 (19%), Positives = 43/126 (34%), Gaps = 25/126 (19%)

Query: 236 MFDKSSSIPLPETIVVLQKIGEVLA-HSTEVISIRGHTDASPFRNIARDNWRLSLDRAYS 294
           +F         E    L+ + + L+  + + + + GHTD          N  LS  RAY 
Sbjct: 15  LFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDK---YNQALSERRAYV 71

Query: 295 AYQVLMKSGVSEDRISKIS---------------------GFAHHRLKIASDPMNSANRR 333
               L+ +GV   RIS +                        +  + + A       +RR
Sbjct: 72  VANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRR 131

Query: 334 IDILVE 339
           +D+ + 
Sbjct: 132 VDVKIR 137


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 flagellar motor protein MotB [Candidatus Liberibacter a
d1r1ma_140 Outer membrane protein class 4, RmpM, C-terminal domain 99.89
d2hqsc1106 Peptidoglycan-associated lipoprotein, PAL, periplasmic 99.89
d2aizp1134 Peptidoglycan-associated lipoprotein, PAL, periplasmic 99.89
>d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: OmpA-like
family: OmpA-like
domain: Outer membrane protein class 4, RmpM, C-terminal domain
species: Neisseria meningitidis [TaxId: 487]
Probab=99.89  E-value=5e-24  Score=176.46  Aligned_cols=105  Identities=23%  Similarity=0.318  Sum_probs=94.7

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-CEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHEE
Q ss_conf             567455568754683565654436789861278-3389873146766787410699999999999999998699965712
Q gi|254780529|r  232 RNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTE-VISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRIS  310 (343)
Q Consensus       232 ~~~~lF~~gsa~l~~~~~~~l~~ia~~l~~~~~-~i~IeGHTD~~p~~g~~~~Nw~LS~~RA~aV~~~L~~~Gv~~~ri~  310 (343)
                      ...+||++||+.|+++++..|++++..|+.+|. .|.|+||||++   |+..+||+||.+||.+|+.||+..|++++||.
T Consensus        11 ~~~~~F~~~s~~l~~~~~~~L~~l~~~l~~~~~~~i~I~GhtD~~---G~~~~N~~LS~~RA~~V~~~L~~~Gi~~~ri~   87 (140)
T d1r1ma_          11 SAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFM---GSDKYNQALSERRAYVVANNLVSNGVPVSRIS   87 (140)
T ss_dssp             EHHHHHTTSSSCCCHHHHHHHHHHHHHHTTSCEEEEEEEEECCSS---SCHHHHHHHHHHHHHHHHHHHHHTTCCGGGEE
T ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCC---CCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             773066289742798999999999998721997089999860654---42121036788999999999997599937599


Q ss_pred             EEEECCCCCCCCCCCCCC----------------------CCCCEEEEEEEC
Q ss_conf             256303348888988521----------------------337559999956
Q gi|254780529|r  311 KISGFAHHRLKIASDPMN----------------------SANRRIDILVED  340 (343)
Q Consensus       311 ~v~G~g~~~P~~~n~t~~----------------------~~NRRVEi~i~~  340 (343)
                       +.|||+++|+++|.++.                      ..||||||.|..
T Consensus        88 -~~g~Ge~~P~~~n~~~~~~~~~~~~~~~~~nr~~~i~~~~~nRRVEi~v~~  138 (140)
T d1r1ma_          88 -AVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRS  138 (140)
T ss_dssp             -EEECTTTTCCCHHHHHHHHHTCCSSCCSSHHHHHHHHHTGGGSEEEEEEEE
T ss_pred             -EEEEECCCCCCCCCCHHHHHHCCCHHHHHHHHHHHHHCCCCCCCEEEEEEE
T ss_conf             -999725787788969889853022012332025555046899858999982



>d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 343 flagellar motor protein MotB [Candidatus Liberibac
2zov_A_210 (A:) Chemotaxis protein MOTB; 2-layer sandwich, ba 5e-17
2zvy_A_183 (A:) Chemotaxis protein MOTB; 2-layer sandwich, ba 1e-16
3khn_A_174 (A:) MOTB protein, putative; structural genomics, 1e-11
2k1s_A_149 (A:) Inner membrane lipoprotein YIAD; abbababab, O 2e-09
3ldt_A_169 (A:) Outer membrane protein, OMPA family protein; 4e-09
2hqs_H_118 (H:) Peptidoglycan-associated lipoprotein; TOLB, P 5e-10
3cyp_B_138 (B:) Chemotaxis protein MOTB; bacterial flagellar 9e-10
1r1m_A_164 (A:) Outer membrane protein class 4; 1.90A {Neisse 6e-09
2aiz_P_134 (P:) Outer membrane protein P6; alpha-beta sandwic 6e-09
2zf8_A_155-278124 (A:155-278) MOTY, component of sodium-driven polar 4e-08
>2zov_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium}Length = 210 Back     alignment and structure
 Score = 83.3 bits (205), Expect = 5e-17
 Identities = 43/182 (23%), Positives = 77/182 (42%), Gaps = 5/182 (2%)

Query: 165 KSINKEENYFLPPLSKEKILAMKRKKRLQDLAKKISSTLSGLVA-DNIVKGVLFETTRTG 223
               +++       + +++     + RL  L   +   +        +   +  +  + G
Sbjct: 2   DDYTQQQGEVEKQPNIDELKKRXEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEG 61

Query: 224 ILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFRNIARD 283
           + I IID +N P F   S+   P    +L+ I  VL      IS+ GHTD  P+ N  + 
Sbjct: 62  LRIQIIDSQNRPXFKTGSAEVEPYXRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKG 121

Query: 284 --NWRLSLDRAYSAYQVLM-KSGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVED 340
             NW LS DRA ++ + L+     +   +  + G A         P ++ NRRI +LV +
Sbjct: 122 YSNWELSADRANASRRELVAGGLDNGKVLR-VVGXAATXRLSDRGPDDAINRRISLLVLN 180

Query: 341 RQ 342
           +Q
Sbjct: 181 KQ 182


>2zvy_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_ALength = 183 Back     alignment and structure
>3khn_A (A:) MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str}Length = 174 Back     alignment and structure
>2k1s_A (A:) Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12}Length = 149 Back     alignment and structure
>3ldt_A (A:) Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila}Length = 169 Back     alignment and structure
>2hqs_H (H:) Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli}Length = 118 Back     alignment and structure
>3cyp_B (B:) Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B*Length = 138 Back     alignment and structure
>1r1m_A (A:) Outer membrane protein class 4; 1.90A {Neisseria meningitidis}Length = 164 Back     alignment and structure
>2aiz_P (P:) Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae}Length = 134 Back     alignment and structure
>2zf8_A (A:155-278) MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus}Length = 124 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target343 flagellar motor protein MotB [Candidatus Liberibacter a
2zov_A_210 Chemotaxis protein MOTB; 2-layer sandwich, bacteri 99.96
2zvy_A_183 Chemotaxis protein MOTB; 2-layer sandwich, bacteri 99.95
3khn_A_174 MOTB protein, putative; structural genomics, OMPA- 99.95
3ldt_A_169 Outer membrane protein, OMPA family protein; OMPA- 99.94
2k1s_A_149 Inner membrane lipoprotein YIAD; abbababab, OMPA, 99.94
3cyp_B_138 Chemotaxis protein MOTB; bacterial flagellar motor 99.91
2hqs_H_118 Peptidoglycan-associated lipoprotein; TOLB, PAL, T 99.91
2aiz_P_134 Outer membrane protein P6; alpha-beta sandwich; HE 99.9
1r1m_A_164 Outer membrane protein class 4; 1.90A {Neisseria m 99.9
2zf8_A_155-278124 MOTY, component of sodium-driven polar flagellar m 99.9
>2zov_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium} Back     alignment and structure
Probab=99.96  E-value=4.6e-28  Score=205.96  Aligned_cols=130  Identities=29%  Similarity=0.429  Sum_probs=116.6

Q ss_pred             HCCCEEEECCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC--CCCCCHHHHH
Q ss_conf             01311451145349999703456745556875468356565443678986127833898731467667--8741069999
Q gi|254780529|r  211 IVKGVLFETTRTGILISIIDQRNTPMFDKSSSIPLPETIVVLQKIGEVLAHSTEVISIRGHTDASPFR--NIARDNWRLS  288 (343)
Q Consensus       211 ~~~~~~v~~~~~~i~I~i~d~~~~~lF~~gsa~l~~~~~~~l~~ia~~l~~~~~~i~IeGHTD~~p~~--g~~~~Nw~LS  288 (343)
                      ......+.....+..+.+......++|++||+.|++.+...|+.++.+|+.++..|.|+||||++|+.  |.+.+||+||
T Consensus        49 ~~~~~~~~~~~~~~~~~~~~~~~~i~F~~~sa~l~~~~~~~l~~ia~~l~~~~~~i~I~GhtD~~~~~~~G~~~~N~~LS  128 (210)
T 2zov_A           49 LRPHLKIDLVQEGLRIQIIDSQNRPXFKTGSAEVEPYXRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELS  128 (210)
T ss_dssp             HGGGEEEEEETTEEEEEEECCSSSCSBCTTSCCBCHHHHHHHHHHHHHHTTSCCCEEEEEEEECSCCCSSCSSCCHHHHH
T ss_pred             HHCCCEEEECCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHH
T ss_conf             41371599817952999984899848699974469879999999999998338669999854877644577642057899


Q ss_pred             HHHHHHHHHHHHH-CCCCHHHEEEEEECCCCCCCCCCCCCCCCCCEEEEEEECC
Q ss_conf             9999999999998-6999657122563033488889885213375599999569
Q gi|254780529|r  289 LDRAYSAYQVLMK-SGVSEDRISKISGFAHHRLKIASDPMNSANRRIDILVEDR  341 (343)
Q Consensus       289 ~~RA~aV~~~L~~-~Gv~~~ri~~v~G~g~~~P~~~n~t~~~~NRRVEi~i~~~  341 (343)
                      .+||.+|+.||+. .|+++.||. +.|||+++|+++|++.+++||||||+|...
T Consensus       129 ~~RA~aV~~~L~~~~gi~~~ri~-~~g~G~~~p~~~n~~~~~~NRRVeI~i~~~  181 (210)
T 2zov_A          129 ADRANASRRELVAGGLDNGKVLR-VVGXAATXRLSDRGPDDAINRRISLLVLNK  181 (210)
T ss_dssp             HHHHHHHHHHHHHTTCCTTCEEE-EEEECCC---------CCCEEEEEEEEECH
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEE-EEEECCCCCCCCCCCCHHHCCCEEEEEECC
T ss_conf             99999999999985998035899-998688878998996458729889999784



>2zvy_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A Back     alignment and structure
>3khn_A (A:) MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Back     alignment and structure
>3ldt_A (A:) Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} Back     alignment and structure
>2k1s_A (A:) Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12} Back     alignment and structure
>3cyp_B (B:) Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B* Back     alignment and structure
>2hqs_H (H:) Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli} Back     alignment and structure
>2aiz_P (P:) Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} Back     alignment and structure
>1r1m_A (A:) Outer membrane protein class 4; 1.90A {Neisseria meningitidis} Back     alignment and structure
>2zf8_A (A:155-278) MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus} Back     alignment and structure