254780530

254780530

hypothetical protein CLIBASIA_02085

GeneID in NCBI database:8209525Locus tag:CLIBASIA_02085
Protein GI in NCBI database:254780530Protein Accession:YP_003064943.1
Gene range:+(751227, 751877)Protein Length:216aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MSDAVLSRLEDFSRLGSLSDKIVLSETIISNSTADVTFSSIADFQKEQDKAYQEGYNKAIHDRELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDFLKKGDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADTVEFSTKIFGSVIKTRLESWLSDVKAKIVSQQVSK
ccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHccccccccccccccEEccccccEEcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHcccHHHHEEHHcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcc
MSDAVLSRLEDfsrlgslsdkiVLSETIisnstadvtfSSIADFQKEQDKAYQEGYNKAIHDRELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDFLkkgdcgkivihgpkNLHSLIEECLGEyssavcyenadtveFSTKIFGSVIKTRLESWLSDVKAKIVSQQVSK
msdavlsrledfsrlgslsdkivLSETiisnstadvtFSSIADFQKEQDKAYQEGYNKAIHDRELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDFLKKGDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADTVEFSTKIFGSVIKTRLeswlsdvkakivsqqvsk
MSDAVLSRLEDFSRLGSLSDKIVLSETIISNSTADVTFSSIADFQKEQDKAYQEGYNKAIHDRELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDFLKKGDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADTVEFSTKIFGSVIKTRLESWLSDVKAKIVSQQVSK
***AVLSRLEDF***************************************YQEGYNKAIHDRELY****************ADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDFLKKGDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADTVEFSTKIFGSVIKTRLESWLSDVKAKIVSQ****
MSDAVLSRLEDFSRLGSLSDKIVLSETIISNSTADVTFSSIADFQKEQDKAYQEGYNKAIHDRELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDFLKKGDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADTVEFSTKIFGSVIKTRLESWLSDVKA*********
**************LGSLSDKIVLSETIISNSTADVTFSSIADFQKEQDKAYQEGYNKAIHDRELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDFLKKGDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADTVEFSTKIFGSVIKTRLESWLSDVKAKIVSQQV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDAVLSRLEDFSRLGSLSDKIVLSETIISNSTADVTFSSIADFQKEQDKAYQEGYNKAIHDRELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDFLKKGDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADTVEFSTKIFGSVIKTRLESWLSDVKAKIVSQQVSK
MSDAVLSRLEDFSRLGSLSDKIVLSETIISNSTADVTFSSIADFQKEQDKAYQEGYNKAIHDRELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDFLKKGDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADTVEFSTKIFGSVIKTRLESWLSDVKAKIVSQQVSK
MSDAVLSRLEDFSRLGSLSDKIVLSETIISNSTADVTFSSIADFQKEQDKAYQEGYNKAIHDRELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKSVLDIGLSRKAAIEFAAVVVDFLKKGDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADTVEFSTKIFGSVIKTRLESWLSDVKAKIVSQQVSK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target216 hypothetical protein CLIBASIA_02085 [Candidatus Liberib
315122278209 hypothetical protein CKC_02650 [Candidatus Liberibacter 1 2e-71
209547940209 hypothetical protein Rleg2_0332 [Rhizobium leguminosaru 1 2e-11
222084879210 hypothetical protein Arad_0901 [Agrobacterium radiobact 1 6e-11
241203118209 hypothetical protein Rleg_0364 [Rhizobium leguminosarum 1 7e-11
86356324209 hypothetical protein RHE_CH00673 [Rhizobium etli CFN 42 1 7e-09
218675468209 hypothetical protein RetlG_30921 [Rhizobium etli GR56] 1 5e-08
15887913218 hypothetical protein Atu0568 [Agrobacterium tumefaciens 1 5e-08
190890376209 hypothetical protein RHECIAT_CH0000751 [Rhizobium etli 1 1e-07
218516718201 hypothetical protein Retl8_25408 [Rhizobium etli 8C-3] 1 2e-07
218460722209 hypothetical protein RetlK5_14991 [Rhizobium etli Kim 5 1 2e-07
>gi|315122278|ref|YP_004062767.1| hypothetical protein CKC_02650 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 209 Back     alignment and organism information
 Score =  272 bits (696), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 140/217 (64%), Positives = 167/217 (76%), Gaps = 13/217 (5%)

Query: 3   DAVLSRLEDFSRLGSLSDKIVLSETIISNSTADVTFSSIADFQKEQDKAYQEGYNKAIHD 62
           DA+LSRLEDF R+ SLSD   L          D   +   D QKE+DKAYQEGY  AI D
Sbjct: 2   DAILSRLEDFGRVNSLSDVAAL----------DDETNYAKDIQKERDKAYQEGYAAAICD 51

Query: 63  RELYWKSKNDFIQRSHDNEIADLRELFESSTSKAIAIAVRDSFKCFSDSLECEVIRILKS 122
           RELYW+SKN+ +Q+SHDNEIADLRELFES TS+AI+ A+RDS KC S+SLE EV+RIL+S
Sbjct: 52  RELYWRSKNECLQQSHDNEIADLRELFESCTSEAISKAIRDSVKCLSNSLEYEVMRILES 111

Query: 123 VLDIGLSRKAAIEFAAVVVDFLKKGDCGKIVIHGPKNLHSLIEECLGEYSSAVCYENADT 182
           VL+IG+SRKAAIEF+ +++D LKKGDCG I I  PKN HSLIEECLGEYSS VCYE+++ 
Sbjct: 112 VLEIGISRKAAIEFSEIIIDLLKKGDCGHIKIQAPKNFHSLIEECLGEYSSMVCYEDSEK 171

Query: 183 VEFSTKIFGSVIKTRLESWLSDVK---AKIVSQQVSK 216
           VEFS+KI G VI TRLESW SDVK   A+  S ++SK
Sbjct: 172 VEFSSKICGGVITTRLESWFSDVKKIEARRFSNELSK 208


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209547940|ref|YP_002279857.1| hypothetical protein Rleg2_0332 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 209 Back     alignment and organism information
>gi|222084879|ref|YP_002543408.1| hypothetical protein Arad_0901 [Agrobacterium radiobacter K84] Length = 210 Back     alignment and organism information
>gi|241203118|ref|YP_002974214.1| hypothetical protein Rleg_0364 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 209 Back     alignment and organism information
>gi|86356324|ref|YP_468216.1| hypothetical protein RHE_CH00673 [Rhizobium etli CFN 42] Length = 209 Back     alignment and organism information
>gi|218675468|ref|ZP_03525137.1| hypothetical protein RetlG_30921 [Rhizobium etli GR56] Length = 209 Back     alignment and organism information
>gi|15887913|ref|NP_353594.1| hypothetical protein Atu0568 [Agrobacterium tumefaciens str. C58] Length = 218 Back     alignment and organism information
>gi|190890376|ref|YP_001976918.1| hypothetical protein RHECIAT_CH0000751 [Rhizobium etli CIAT 652] Length = 209 Back     alignment and organism information
>gi|218516718|ref|ZP_03513558.1| hypothetical protein Retl8_25408 [Rhizobium etli 8C-3] Length = 201 Back     alignment and organism information
>gi|218460722|ref|ZP_03500813.1| hypothetical protein RetlK5_14991 [Rhizobium etli Kim 5] Length = 209 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 216 hypothetical protein CLIBASIA_02085 [Candidatus Liberib
TIGR03321246 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC a 98.02
PRK06032208 fliH flagellar assembly protein H; Validated 97.89
PRK05687252 fliH flagellar assembly protein H; Validated 97.61
PRK06669268 fliH flagellar assembly protein H; Validated 94.63
COG1317234 FliH Flagellar biosynthesis/type III secretory pathway 96.75
PRK09098229 type III secretion system protein HrpB; Validated 94.84
PRK06937204 type III secretion system protein; Reviewed 94.28
PRK06328223 type III secretion system protein; Validated 96.62
PRK13386236 fliH flagellar assembly protein H; Provisional 94.48
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B Back     alignment and domain information
>PRK06032 fliH flagellar assembly protein H; Validated Back     alignment and domain information
>PRK05687 fliH flagellar assembly protein H; Validated Back     alignment and domain information
>PRK06669 fliH flagellar assembly protein H; Validated Back     alignment and domain information
>COG1317 FliH Flagellar biosynthesis/type III secretory pathway protein [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09098 type III secretion system protein HrpB; Validated Back     alignment and domain information
>PRK06937 type III secretion system protein; Reviewed Back     alignment and domain information
>PRK06328 type III secretion system protein; Validated Back     alignment and domain information
>PRK13386 fliH flagellar assembly protein H; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00