254780544

254780544

phosphoglucosamine mutase protein

GeneID in NCBI database:8209540Locus tag:CLIBASIA_02155
Protein GI in NCBI database:254780544Protein Accession:YP_003064957.1
Gene range:+(736874, 738220)Protein Length:448aa
Gene description:phosphoglucosamine mutase protein
COG prediction:[G] Phosphomannomutase
KEGG prediction:phosphoglucosamine mutase protein; K03431 phosphoglucosamine mutase [EC:5.4.2.10]
SEED prediction:Phosphoglucosamine mutase (EC 5.4.2.10)
Pathway involved in KEGG:Amino sugar and nucleotide sugar metabolism [PATH:las00520]
Subsystem involved in SEED:UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS
cccccccccccEEEcccccccHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEEEccccccccccEEEEccccccccHHHHHHHHHHHHHHcccccccccccccEEEEccHHHHHHHHHHHHccccHHccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHHHccccEEEEEcccccEEEEEcccccEEcHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHcccEEEEEcccHHHHHHHHHHcccEEEEEccccEEcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccEEccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHc
cccccccccccEEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHcHHEEEccccccHHHHHHHHHHHHcccEEEEEcccccccccEEEEccccccccHHHHHHHHHHHHcccccccccHHHcccEEEcccHHHHHHHHHHccccccccccccEEEEEccccHHHHHHHHHHHHHccEEEEEcccccccccccccccccHHHHHHHHHHHcccEEEEEcccccEEEEEEccccEccHHHHHHHHHHHHHHccccccccEEEEHHcHHHHHHHHHHccccEEEEccccHHHHHHHHHcccEEccccccEEEEEccccccHHHHHHHHHHHHHHHccccHHHHHHHccccccEEEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHcc
mkrrffgtdgirgksntfpitpnfMMRIGIAVGYLfrgkkkhrrvvigkdtrlsgymlENSLVAGFtaagmdafilgpipspAVAMLTRSLRADVGVMIsashnpyqdngiklfgpdgykvsTDIEDRIETLLEDDLTSYLSCydsighakrvdgVHDRYIEHVkrtlprdvtlqGLRIVVDcangasykvAPEVFWELGADVvvigdkpngininldcgstnvLSLQRKVHEVRADIGialdgdgdrviivdekgaivnGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKnngfnvggeqsghiilsdygstgDGLVAALQVLRYIKqydkpvstichcfeeypqflrsvsvkdtsilNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLakvipmids
mkrrffgtdgirgksntfpitpnfMMRIGIAVGYlfrgkkkhrrvvigkdtrlsgyMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISAShnpyqdngiklfgPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVkrtlprdvtlqGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADigialdgdgdrviIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADaeselrgiDRLIVRASGTESLIRImaegddlsrikrivddlakvipmids
MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRadigialdgdgdRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS
MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMID*
MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS
****FFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS
MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS
MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target448 phosphoglucosamine mutase protein [Candidatus Liberibac
254781107542 phosphoglucomutase [Candidatus Liberibacter asiati 1e-15
>gi|254781107|ref|YP_003065520.1| phosphoglucomutase [Candidatus Liberibacter asiaticus str. psy62] Length = 542 Back     alignment
 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 99/367 (26%), Positives = 155/367 (42%), Gaps = 62/367 (16%)

Query: 7   GTDGIRGKSNTF---PITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           GT G+R K + F     T NF+  I   V          + +V+G D R   +++   ++
Sbjct: 17  GTSGLRKKVSVFQQNSYTENFIQAIFNNV------DCAEKTLVVGGDGRFYNHIVIQKII 70

Query: 64  AGFTAAGMDAFILGP---IPSPAVAMLTRSLRADVGVMISASHNP---YQDNGIKLFGPD 117
               A G    I+G    + +PAV+ L R  +A  G++++ASHNP    QD GIK     
Sbjct: 71  KIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSS 130

Query: 118 GYKVSTDIEDRIETLLEDD--LTSYLSCYDSIGHAKRVDGVH-----------------D 158
           G   S   E + E + E+   +TSY      I  A  VD  H                 +
Sbjct: 131 GGSAS---EQQTEDIFEESKKITSY-----QIIEANDVDINHIGTKELANMTISVIDPIE 182

Query: 159 RYIEHVKRTLPRDVTLQ----GLRIVVDCANGASYKVAPEVFW-ELGADVVVIGDKPNGI 213
            Y+  ++     D   +    G RI +DC N  +   A E+   +LGA     G   N I
Sbjct: 183 NYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPT---GSVRNFI 239

Query: 214 NINLDCGST----NVLSLQ----RKVHEVRADIGIALDGDGDRVIIVDEKGAIVN-GDQI 264
            +  D G      N++  +    R +    AD G A DGDGDR +I+  KG  VN  D +
Sbjct: 240 PLE-DFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILG-KGIFVNPSDSL 297

Query: 265 MALIAREWMSHSLLRG-NGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGF 323
             ++A   +      G  G+  ++ ++  L+R    L L L  T  G ++    ++N   
Sbjct: 298 AIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMI 357

Query: 324 NVGGEQS 330
            + GE+S
Sbjct: 358 TICGEES 364

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target448 phosphoglucosamine mutase protein [Candidatus Liberibac
315122872448 phosphoglucosamine mutase protein [Candidatus Liberibac 1 0.0
327193461450 phosphoglucosamine mutase protein [Rhizobium etli CNPAF 1 0.0
190893270450 phosphoglucosamine mutase [Rhizobium etli CIAT 652] Len 1 0.0
222086968450 phosphoglucosamine mutase [Agrobacterium radiobacter K8 1 0.0
241206179450 phosphoglucosamine mutase [Rhizobium leguminosarum bv. 1 0.0
116253704450 phosphoglucosamine mutase [Rhizobium leguminosarum bv. 1 0.0
86359048450 phosphosugar isomerase protein [Rhizobium etli CFN 42] 1 1e-180
209550771450 phosphoglucosamine mutase [Rhizobium leguminosarum bv. 1 1e-180
163758785450 putative phosphoglucosamine mutase [Hoeflea phototrophi 1 1e-177
15966487450 putative phosphosugar isomerase protein [Sinorhizobium 1 1e-173
>gi|315122872|ref|YP_004063361.1| phosphoglucosamine mutase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 448 Back     alignment and organism information
 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/448 (86%), Positives = 426/448 (95%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+R+FGTDGIRGKSN FPITP+ MMR+GI VGYL  GKK++RRVVIGKDTRLSGYMLEN
Sbjct: 1   MKQRYFGTDGIRGKSNIFPITPDVMMRVGIVVGYLLGGKKRNRRVVIGKDTRLSGYMLEN 60

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +LVAGFT+AGM++FILGPIPSPAVAMLTRSLRADVGVMISASHN Y DNGIKLFG DGYK
Sbjct: 61  ALVAGFTSAGMNSFILGPIPSPAVAMLTRSLRADVGVMISASHNQYHDNGIKLFGSDGYK 120

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +STDIED IE+LLE DLT YLSCYDSIG+AKR+DGVHDRYIEHVKRTLPRDVTLQGLRIV
Sbjct: 121 ISTDIEDHIESLLEGDLTPYLSCYDSIGNAKRIDGVHDRYIEHVKRTLPRDVTLQGLRIV 180

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIGI 240
           VDCANGASYKVAP VFWELGADVVVIGDKPNG+NINL+CGSTNVLSLQ+KVHEVRADIGI
Sbjct: 181 VDCANGASYKVAPAVFWELGADVVVIGDKPNGMNINLNCGSTNVLSLQKKVHEVRADIGI 240

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           ALDGDGDR+IIVDEK A+VNGDQIMALIAREWMS+SLL+GNGIVTTVMSN+GLERF++ +
Sbjct: 241 ALDGDGDRIIIVDEKSAVVNGDQIMALIAREWMSNSLLKGNGIVTTVMSNVGLERFLSEI 300

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
           GLSLKRT+VGDRY+MEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVL YIK+YDK
Sbjct: 301 GLSLKRTQVGDRYVMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLSYIKKYDK 360

Query: 361 PVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRGIDRLIVRASGTESLI 420
           PVSTICHCFEEYPQFLRS+ VKD+ ILN+  +VQAIADAESELRG+DRL+VRASGTE LI
Sbjct: 361 PVSTICHCFEEYPQFLRSIKVKDSFILNNPLVVQAIADAESELRGMDRLVVRASGTEPLI 420

Query: 421 RIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
           RIMAEG+  S+I+RIVDDLAKVIPMIDS
Sbjct: 421 RIMAEGESFSKIRRIVDDLAKVIPMIDS 448


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327193461|gb|EGE60357.1| phosphoglucosamine mutase protein [Rhizobium etli CNPAF512] Length = 450 Back     alignment and organism information
>gi|190893270|ref|YP_001979812.1| phosphoglucosamine mutase [Rhizobium etli CIAT 652] Length = 450 Back     alignment and organism information
>gi|222086968|ref|YP_002545502.1| phosphoglucosamine mutase [Agrobacterium radiobacter K84] Length = 450 Back     alignment and organism information
>gi|241206179|ref|YP_002977275.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 450 Back     alignment and organism information
>gi|116253704|ref|YP_769542.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. viciae 3841] Length = 450 Back     alignment and organism information
>gi|86359048|ref|YP_470940.1| phosphosugar isomerase protein [Rhizobium etli CFN 42] Length = 450 Back     alignment and organism information
>gi|209550771|ref|YP_002282688.1| phosphoglucosamine mutase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 450 Back     alignment and organism information
>gi|163758785|ref|ZP_02165872.1| putative phosphoglucosamine mutase [Hoeflea phototrophica DFL-43] Length = 450 Back     alignment and organism information
>gi|15966487|ref|NP_386840.1| putative phosphosugar isomerase protein [Sinorhizobium meliloti 1021] Length = 450 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target448 phosphoglucosamine mutase protein [Candidatus Liberibac
PRK14315448 PRK14315, glmM, phosphoglucosamine mutase; Provisional 0.0
PRK10887443 PRK10887, glmM, phosphoglucosamine mutase; Provisional 1e-178
TIGR01455443 TIGR01455, glmM, phosphoglucosamine mutase 1e-168
PRK14314450 PRK14314, glmM, phosphoglucosamine mutase; Provisional 1e-168
PRK14316448 PRK14316, glmM, phosphoglucosamine mutase; Provisional 1e-148
PRK14324446 PRK14324, glmM, phosphoglucosamine mutase; Provisional 1e-140
PRK14318448 PRK14318, glmM, phosphoglucosamine mutase; Provisional 1e-123
PRK14323440 PRK14323, glmM, phosphoglucosamine mutase; Provisional 1e-115
COG1109464 COG1109, {ManB}, Phosphomannomutase [Carbohydrate trans 1e-113
PRK14317465 PRK14317, glmM, phosphoglucosamine mutase; Provisional 1e-110
PRK14319430 PRK14319, glmM, phosphoglucosamine mutase; Provisional 1e-92
cd03087439 cd03087, PGM_like1, This archaeal PGM-like (phosphogluc 6e-84
PRK14320443 PRK14320, glmM, phosphoglucosamine mutase; Provisional 7e-82
PRK14322429 PRK14322, glmM, phosphoglucosamine mutase; Provisional 2e-80
cd03089443 cd03089, PMM_PGM, The phosphomannomutase/phosphoglucomu 2e-65
PRK14321449 PRK14321, glmM, phosphoglucosamine mutase; Provisional 4e-53
cd05800461 cd05800, PGM_like2, This PGM-like (phosphoglucomutase-l 5e-51
cd05803445 cd05803, PGM_like4, This PGM-like (phosphoglucomutase-l 7e-46
PRK09542445 PRK09542, manB, phosphomannomutase/phosphoglucomutase; 3e-37
cd05805441 cd05805, MPG1_transferase, GTP-mannose-1-phosphate guan 1e-30
cd05799487 cd05799, PGM2, This CD includes PGM2 (phosphoglucomutas 2e-28
cd03088459 cd03088, ManB, ManB is a bacterial phosphomannomutase ( 4e-25
cd05802434 cd05802, GlmM, GlmM is a bacterial phosphoglucosamine m 0.0
cd03084355 cd03084, phosphohexomutase, The alpha-D-phosphohexomuta 2e-64
pfam02878138 pfam02878, PGM_PMM_I, Phosphoglucomutase/phosphomannomu 5e-41
pfam02880111 pfam02880, PGM_PMM_III, Phosphoglucomutase/phosphomanno 8e-32
PLN02371583 PLN02371, PLN02371, phosphoglucosamine mutase family pr 5e-29
COG0033524 COG0033, Pgm, Phosphoglucomutase [Carbohydrate transpor 1e-22
TIGR01132543 TIGR01132, pgm, phosphoglucomutase, alpha-D-glucose pho 1e-15
PTZ00150584 PTZ00150, PTZ00150, phosphoglucomutase-2-like protein; 5e-13
KOG1220607 KOG1220, KOG1220, KOG1220, Phosphoglucomutase/phosphoma 1e-28
PRK15414456 PRK15414, PRK15414, phosphomannomutase CpsG; Provisiona 2e-21
PRK07564543 PRK07564, PRK07564, phosphoglucomutase; Validated 3e-15
cd05801522 cd05801, PGM_like3, This bacterial PGM-like (phosphoglu 6e-13
KOG0625558 KOG0625, KOG0625, KOG0625, Phosphoglucomutase [Carbohyd 5e-12
pfam02879103 pfam02879, PGM_PMM_II, Phosphoglucomutase/phosphomannom 1e-18
PLN02895562 PLN02895, PLN02895, phosphoacetylglucosamine mutase 0.004
PTZ00302 585 PTZ00302, PTZ00302, N-acetylglucosamine-phosphate mutas 2e-08
cd03086 513 cd03086, PGM3, PGM3 (phosphoglucomutase 3), also known 6e-08
KOG2537 539 KOG2537, KOG2537, KOG2537, Phosphoglucomutase/phosphoma 5e-06
pfam0040871 pfam00408, PGM_PMM_IV, Phosphoglucomutase/phosphomannom 3e-08
PTZ00302585 PTZ00302, PTZ00302, N-acetylglucosamine-phosphate mutas 0.004
KOG2537539 KOG2537, KOG2537, KOG2537, Phosphoglucomutase/phosphoma 3e-08
cd03086513 cd03086, PGM3, PGM3 (phosphoglucomutase 3), also known 3e-07
PTZ00302585 PTZ00302, PTZ00302, N-acetylglucosamine-phosphate mutas 4e-07
PLN02895 562 PLN02895, PLN02895, phosphoacetylglucosamine mutase 3e-06
cd03085548 cd03085, PGM1, Phosphoglucomutase 1 (PGM1) catalyzes th 6e-06
>gnl|CDD|184615 PRK14315, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|182812 PRK10887, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|130522 TIGR01455, glmM, phosphoglucosamine mutase Back     alignment and domain information
>gnl|CDD|184614 PRK14314, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184616 PRK14316, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184621 PRK14324, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184618 PRK14318, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184620 PRK14323, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|31306 COG1109, {ManB}, Phosphomannomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184617 PRK14317, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|172795 PRK14319, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|100089 cd03087, PGM_like1, This archaeal PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates Back     alignment and domain information
>gnl|CDD|172796 PRK14320, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184619 PRK14322, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|100091 cd03089, PMM_PGM, The phosphomannomutase/phosphoglucomutase (PMM/PGM) bifunctional enzyme catalyzes the reversible conversion of 1-phospho to 6-phospho-sugars (e Back     alignment and domain information
>gnl|CDD|172797 PRK14321, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|100093 cd05800, PGM_like2, This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria Back     alignment and domain information
>gnl|CDD|100096 cd05803, PGM_like4, This PGM-like (phosphoglucomutase-like) domain is located C-terminal to a mannose-1-phosphate guanyltransferase domain in a protein of unknown function that is found in both prokaryotes and eukaryotes Back     alignment and domain information
>gnl|CDD|181937 PRK09542, manB, phosphomannomutase/phosphoglucomutase; Reviewed Back     alignment and domain information
>gnl|CDD|100097 cd05805, MPG1_transferase, GTP-mannose-1-phosphate guanyltransferase (MPG1 transferase), also known as GDP-mannose pyrophosphorylase, is a bifunctional enzyme with both phosphomannose isomerase (PMI) activity and GDP-mannose phosphorylase (GMP) activity Back     alignment and domain information
>gnl|CDD|100092 cd05799, PGM2, This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1) Back     alignment and domain information
>gnl|CDD|100090 cd03088, ManB, ManB is a bacterial phosphomannomutase (PMM) that catalyzes the conversion of mannose 6-phosphate to mannose-1-phosphate in the second of three steps in the GDP-mannose pathway, in which GDP-D-mannose is synthesized from fructose-6-phosphate Back     alignment and domain information
>gnl|CDD|100095 cd05802, GlmM, GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily Back     alignment and domain information
>gnl|CDD|100086 cd03084, phosphohexomutase, The alpha-D-phosphohexomutase superfamily includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates Back     alignment and domain information
>gnl|CDD|145827 pfam02878, PGM_PMM_I, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I Back     alignment and domain information
>gnl|CDD|145829 pfam02880, PGM_PMM_III, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III Back     alignment and domain information
>gnl|CDD|177999 PLN02371, PLN02371, phosphoglucosamine mutase family protein Back     alignment and domain information
>gnl|CDD|30382 COG0033, Pgm, Phosphoglucomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130202 TIGR01132, pgm, phosphoglucomutase, alpha-D-glucose phosphate-specific Back     alignment and domain information
>gnl|CDD|185482 PTZ00150, PTZ00150, phosphoglucomutase-2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|36434 KOG1220, KOG1220, KOG1220, Phosphoglucomutase/phosphomannomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|185312 PRK15414, PRK15414, phosphomannomutase CpsG; Provisional Back     alignment and domain information
>gnl|CDD|181032 PRK07564, PRK07564, phosphoglucomutase; Validated Back     alignment and domain information
>gnl|CDD|100094 cd05801, PGM_like3, This bacterial PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily Back     alignment and domain information
>gnl|CDD|35844 KOG0625, KOG0625, KOG0625, Phosphoglucomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|145828 pfam02879, PGM_PMM_II, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II Back     alignment and domain information
>gnl|CDD|178483 PLN02895, PLN02895, phosphoacetylglucosamine mutase Back     alignment and domain information
>gnl|CDD|185546 PTZ00302, PTZ00302, N-acetylglucosamine-phosphate mutase; Provisional Back     alignment and domain information
>gnl|CDD|100088 cd03086, PGM3, PGM3 (phosphoglucomutase 3), also known as PAGM (phosphoacetylglucosamine mutase) and AGM1 (N-acetylglucosamine-phosphate mutase), is an essential enzyme found in eukaryotes that reversibly catalyzes the conversion of GlcNAc-6-phosphate into GlcNAc-1-phosphate as part of the UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthetic pathway Back     alignment and domain information
>gnl|CDD|37748 KOG2537, KOG2537, KOG2537, Phosphoglucomutase/phosphomannomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|144122 pfam00408, PGM_PMM_IV, Phosphoglucomutase/phosphomannomutase, C-terminal domain Back     alignment and domain information
>gnl|CDD|185546 PTZ00302, PTZ00302, N-acetylglucosamine-phosphate mutase; Provisional Back     alignment and domain information
>gnl|CDD|37748 KOG2537, KOG2537, KOG2537, Phosphoglucomutase/phosphomannomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|100088 cd03086, PGM3, PGM3 (phosphoglucomutase 3), also known as PAGM (phosphoacetylglucosamine mutase) and AGM1 (N-acetylglucosamine-phosphate mutase), is an essential enzyme found in eukaryotes that reversibly catalyzes the conversion of GlcNAc-6-phosphate into GlcNAc-1-phosphate as part of the UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthetic pathway Back     alignment and domain information
>gnl|CDD|185546 PTZ00302, PTZ00302, N-acetylglucosamine-phosphate mutase; Provisional Back     alignment and domain information
>gnl|CDD|178483 PLN02895, PLN02895, phosphoacetylglucosamine mutase Back     alignment and domain information
>gnl|CDD|100087 cd03085, PGM1, Phosphoglucomutase 1 (PGM1) catalyzes the bidirectional interconversion of glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P) via a glucose 1,6-diphosphate intermediate, an important metabolic step in prokaryotes and eukaryotes Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 448 phosphoglucosamine mutase protein [Candidatus Liberibac
TIGR01455450 glmM phosphoglucosamine mutase; InterPro: IPR006352 Thi 100.0
cd05802434 GlmM GlmM is a bacterial phosphoglucosamine mutase (PNG 100.0
PRK10887445 glmM phosphoglucosamine mutase; Provisional 100.0
cd05805441 MPG1_transferase GTP-mannose-1-phosphate guanyltransfer 100.0
cd05803445 PGM_like4 This PGM-like (phosphoglucomutase-like) domai 100.0
cd05800461 PGM_like2 This PGM-like (phosphoglucomutase-like) prote 100.0
cd03087439 PGM_like1 This archaeal PGM-like (phosphoglucomutase-li 100.0
cd03089443 PMM_PGM The phosphomannomutase/phosphoglucomutase (PMM/ 100.0
COG1109464 {ManB} Phosphomannomutase [Carbohydrate transport and m 100.0
PRK09542445 manB phosphomannomutase/phosphoglucomutase; Reviewed 100.0
cd05799487 PGM2 This CD includes PGM2 (phosphoglucomutase 2) and P 100.0
cd05801522 PGM_like3 This bacterial PGM-like (phosphoglucomutase-l 100.0
PRK07564544 phosphoglucomutase; Validated 100.0
cd03088459 ManB ManB is a bacterial phosphomannomutase (PMM) that 100.0
PTZ00150593 phosphoglucomutase; Provisional 100.0
cd03084355 phosphohexomutase The alpha-D-phosphohexomutase superfa 100.0
cd03085548 PGM1 Phosphoglucomutase 1 (PGM1) catalyzes the bidirect 100.0
) links the anaerobic or aerobic glycolysis of glucose-6-phosphate and glucose-1-phosphate produced by various glycan phosphorylases by catalysing the transfer of a phosphate group between C-1 and C-6 of glucose . Alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.; GO: 0004614 phosphoglucomutase activity, 0005975 carbohydrate metabolic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01132">TIGR01132553 pgm phosphoglucomutase, alpha-D-glucose phosphate-speci 100.0
KOG1220607 consensus 100.0
COG0033524 Pgm Phosphoglucomutase [Carbohydrate transport and meta 100.0
KOG0625558 consensus 100.0
cd03086513 PGM3 PGM3 (phosphoglucomutase 3), also known as PAGM (p 100.0
PTZ00302604 N-acetylglucosamine-phosphate mutase; Provisional 100.0
pfam02878138 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/ 100.0
KOG2537539 consensus 100.0
pfam02880111 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alph 99.91
pfam02879103 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha 99.85
cd03086513 PGM3 PGM3 (phosphoglucomutase 3), also known as PAGM (p 99.19
PRK12615171 galactose-6-phosphate isomerase subunit LacB; Reviewed 93.21
PRK08622171 galactose-6-phosphate isomerase subunit LacB; Reviewed 92.65
PTZ00302 604 N-acetylglucosamine-phosphate mutase; Provisional 99.16
KOG2537 539 consensus 97.92
COG0426388 FpaA Uncharacterized flavoproteins [Energy production a 93.74
pfam0040871 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-ter 98.99
>TIGR01455 glmM phosphoglucosamine mutase; InterPro: IPR006352 This family describes GlmM, phosphoglucosamine mutase, also designated MrsA and YhbF in Escherichia coli , UreC in Helicobacter pylori , and femR315 or FemD in Staphlococcus aureus Back     alignment and domain information
>cd05802 GlmM GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily Back     alignment and domain information
>PRK10887 glmM phosphoglucosamine mutase; Provisional Back     alignment and domain information
>cd05805 MPG1_transferase GTP-mannose-1-phosphate guanyltransferase (MPG1 transferase), also known as GDP-mannose pyrophosphorylase, is a bifunctional enzyme with both phosphomannose isomerase (PMI) activity and GDP-mannose phosphorylase (GMP) activity Back     alignment and domain information
>cd05803 PGM_like4 This PGM-like (phosphoglucomutase-like) domain is located C-terminal to a mannose-1-phosphate guanyltransferase domain in a protein of unknown function that is found in both prokaryotes and eukaryotes Back     alignment and domain information
>cd05800 PGM_like2 This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria Back     alignment and domain information
>cd03087 PGM_like1 This archaeal PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates Back     alignment and domain information
>cd03089 PMM_PGM The phosphomannomutase/phosphoglucomutase (PMM/PGM) bifunctional enzyme catalyzes the reversible conversion of 1-phospho to 6-phospho-sugars (e Back     alignment and domain information
>COG1109 {ManB} Phosphomannomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09542 manB phosphomannomutase/phosphoglucomutase; Reviewed Back     alignment and domain information
>cd05799 PGM2 This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1) Back     alignment and domain information
>cd05801 PGM_like3 This bacterial PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily Back     alignment and domain information
>PRK07564 phosphoglucomutase; Validated Back     alignment and domain information
>cd03088 ManB ManB is a bacterial phosphomannomutase (PMM) that catalyzes the conversion of mannose 6-phosphate to mannose-1-phosphate in the second of three steps in the GDP-mannose pathway, in which GDP-D-mannose is synthesized from fructose-6-phosphate Back     alignment and domain information
>PTZ00150 phosphoglucomutase; Provisional Back     alignment and domain information
>cd03084 phosphohexomutase The alpha-D-phosphohexomutase superfamily includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates Back     alignment and domain information
>cd03085 PGM1 Phosphoglucomutase 1 (PGM1) catalyzes the bidirectional interconversion of glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P) via a glucose 1,6-diphosphate intermediate, an important metabolic step in prokaryotes and eukaryotes Back     alignment and domain information
>TIGR01132 pgm phosphoglucomutase, alpha-D-glucose phosphate-specific; InterPro: IPR005852 Phosphoglucomutase, alpha-D-glucose phosphate-specific (Back     alignment and domain information
>KOG1220 consensus Back     alignment and domain information
>COG0033 Pgm Phosphoglucomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0625 consensus Back     alignment and domain information
>cd03086 PGM3 PGM3 (phosphoglucomutase 3), also known as PAGM (phosphoacetylglucosamine mutase) and AGM1 (N-acetylglucosamine-phosphate mutase), is an essential enzyme found in eukaryotes that reversibly catalyzes the conversion of GlcNAc-6-phosphate into GlcNAc-1-phosphate as part of the UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthetic pathway Back     alignment and domain information
>PTZ00302 N-acetylglucosamine-phosphate mutase; Provisional Back     alignment and domain information
>pfam02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I Back     alignment and domain information
>KOG2537 consensus Back     alignment and domain information
>pfam02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III Back     alignment and domain information
>pfam02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II Back     alignment and domain information
>cd03086 PGM3 PGM3 (phosphoglucomutase 3), also known as PAGM (phosphoacetylglucosamine mutase) and AGM1 (N-acetylglucosamine-phosphate mutase), is an essential enzyme found in eukaryotes that reversibly catalyzes the conversion of GlcNAc-6-phosphate into GlcNAc-1-phosphate as part of the UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthetic pathway Back     alignment and domain information
>PRK12615 galactose-6-phosphate isomerase subunit LacB; Reviewed Back     alignment and domain information
>PRK08622 galactose-6-phosphate isomerase subunit LacB; Reviewed Back     alignment and domain information
>PTZ00302 N-acetylglucosamine-phosphate mutase; Provisional Back     alignment and domain information
>KOG2537 consensus Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>pfam00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target448 phosphoglucosamine mutase protein [Candidatus Liberibac
1wqa_A455 Crystal Structure Of Pyrococcus Horikoshii Phosphom 2e-57
2f7l_A455 Crystal Structure Of Sulfolobus Tokodaii Phosphoman 2e-54
3i3w_A443 Structure Of A Phosphoglucosamine Mutase From Franc 1e-53
2fkm_X462 PmmPGM S108D MUTANT WITH ALPHA-D-Glucose 1,6-Bispho 4e-44
1k2y_X463 Crystal Structure Of PhosphomannomutasePHOSPHOGLUCO 4e-44
2h4l_X463 Complex Of PmmPGM WITH RIBOSE 1-Phosphate Length = 5e-44
2fkf_A462 PhosphomannomutasePHOSPHOGLUCOMUTASE FROM PSEUDOMON 5e-44
1p5d_X463 Enzyme-Ligand Complex Of P. Aeruginosa PmmPGM Lengt 5e-44
3bkq_X463 Structure Of The P368g Mutant Of PmmPGM IN COMPLEX 3e-43
1k35_A463 Crystal Structure Of PhosphomannomutasePHOSPHOGLUCO 3e-42
1tuo_A464 Crystal Structure Of Putative Phosphomannomutase Fr 8e-40
3olp_A570 Crystal Structure Of A Bacterial Phosphoglucomutase 5e-28
3na5_A570 Crystal Structure Of A Bacterial Phosphoglucomutase 1e-27
2fuv_A549 Phosphoglucomutase From Salmonella Typhimurium. Len 5e-26
2z0f_A524 Crystal Structure Of Putative Phosphoglucomutase Fr 6e-24
2dka_A544 Crystal Structure Of N-Acetylglucosamine-Phosphate 2e-21
1lxt_A561 Structure Of Phosphotransferase Phosphoglucomutase 3e-08
1jdy_A561 Rabbit Muscle Phosphoglucomutase Length = 561 4e-08
1wjw_A112 Solution Structure Of The C-Terminal Domain Of Mous 3e-08
gi|78100844|pdb|1WQA|A Chain A, Crystal Structure Of Pyrococcus Horikoshii PhosphomannomutasePHOSPHOGLUCOMUTASE COMPLEXED WITH MG2+ Length = 455 Back     alignment and structure
 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 122/455 (26%), Positives = 206/455 (45%), Gaps = 18/455 (3%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRR-VVIGKDTRLSGYMLENSL 62
           + FGT G+RG +N   ITP F M+IG+A G L + + + +  VV+G+DTR+SG ML+ +L
Sbjct: 3   KLFGTFGVRGIANEK-ITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEAL 61

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           ++G  + G D   +G  P+PAV   T+   AD G +I+ASHNP + NGIKL  P+G  + 
Sbjct: 62  ISGLLSVGCDVIDVGIAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLK 121

Query: 123 TDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVD 182
            + E  +E L   +       Y+      R + +   YIE +K  +  +   +    VV 
Sbjct: 122 KEREAIVEELFFKEDFDRAKWYE--IGEVRREDIIKPYIEAIKSKVDVEAIKKRKPFVVV 179

Query: 183 CANG---ASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
             +    +                V           N +    N+      V  + AD G
Sbjct: 180 DTSNGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGADFG 239

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DR + +DE G  + GD+  AL+A   +      G  +VTTV ++  L+     
Sbjct: 240 VAQDGDADRAVFIDENGRFIQGDKTFALVADAVLKEKG--GGLLVTTVATSNLLDDIAKK 297

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G  + RT+VGD  +   +  N   +GGE++G +I  ++    DG +   +V+    +  
Sbjct: 298 HGAKVMRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAKSG 357

Query: 360 KPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAIADAESELRG---------IDRLI 410
           K  S +     +Y Q      V+       + + +   +    +              ++
Sbjct: 358 KKFSELIDELPKYYQIKTKRHVEGDRHAIVNKVAEMARERGYTVDTTDGAKIIFEDGWVL 417

Query: 411 VRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPM 445
           VRASGTE +IRI +E     + +  ++   +++  
Sbjct: 418 VRASGTEPIIRIFSEAKSKEKAQEYLNLGIELLEK 452


gi|119389439|pdb|2F7L|A Chain A, Crystal Structure Of Sulfolobus Tokodaii PhosphomannomutasePHOSPHOGLUCOMUTASE Length = 455 Back     alignment and structure
>gi|284055608|pdb|3I3W|A Chain A, Structure Of A Phosphoglucosamine Mutase From Francisella Tularensis Length = 443 Back     alignment and structure
>gi|93279553|pdb|2FKM|X Chain X, PmmPGM S108D MUTANT WITH ALPHA-D-Glucose 1,6-Bisphosphate Bound Length = 462 Back     alignment and structure
>gi|20150646|pdb|1K2Y|X Chain X, Crystal Structure Of PhosphomannomutasePHOSPHOGLUCOMUTASE S108a Mutant From P. Aeruginosa Length = 463 Back     alignment and structure
>gi|114794203|pdb|2H4L|X Chain X, Complex Of PmmPGM WITH RIBOSE 1-Phosphate Length = 463 Back     alignment and structure
>gi|93279551|pdb|2FKF|A Chain A, PhosphomannomutasePHOSPHOGLUCOMUTASE FROM PSEUDOMONAS Aeruginosa With Alpha-D-Glucose 1,6-Bisphosphate Bound Length = 462 Back     alignment and structure
>gi|42543249|pdb|1P5D|X Chain X, Enzyme-Ligand Complex Of P. Aeruginosa PmmPGM Length = 463 Back     alignment and structure
>gi|198443194|pdb|3BKQ|X Chain X, Structure Of The P368g Mutant Of PmmPGM IN COMPLEX WITH Its Substrate Length = 463 Back     alignment and structure
>gi|20150647|pdb|1K35|A Chain A, Crystal Structure Of PhosphomannomutasePHOSPHOGLUCOMUTASE From P.Aeruginosa Length = 463 Back     alignment and structure
>gi|75765260|pdb|1TUO|A Chain A, Crystal Structure Of Putative Phosphomannomutase From Thermus Thermophilus Hb8 Length = 464 Back     alignment and structure
>gi|323463042|pdb|3OLP|A Chain A, Crystal Structure Of A Bacterial Phosphoglucomutase, An Enzyme Important In The Virulence Of Multiple Human Pathogens Length = 570 Back     alignment and structure
>gi|323462896|pdb|3NA5|A Chain A, Crystal Structure Of A Bacterial Phosphoglucomutase, An Enzyme Important In The Virulence Of Several Human Pathogens. Length = 570 Back     alignment and structure
>gi|93279756|pdb|2FUV|A Chain A, Phosphoglucomutase From Salmonella Typhimurium. Length = 549 Back     alignment and structure
gi|160286310|pdb|2Z0F|A Chain A, Crystal Structure Of Putative Phosphoglucomutase From Thermus Thermophilus Hb8 Length = 524 Back     alignment and structure
gi|109157469|pdb|2DKA|A Chain A, Crystal Structure Of N-Acetylglucosamine-Phosphate Mutase, A Member Of The Alpha-D-Phosphohexomutase Superfamily, In The Apo-Form Length = 544 Back     alignment and structure
>gi|1942289|pdb|1LXT|A Chain A, Structure Of Phosphotransferase Phosphoglucomutase From Rabbit Length = 561 Back     alignment and structure
>gi|1942196|pdb|1JDY|A Chain A, Rabbit Muscle Phosphoglucomutase Length = 561 Back     alignment and structure
>gi|159163427|pdb|1WJW|A Chain A, Solution Structure Of The C-Terminal Domain Of Mouse Phosphoacetylglucosamine Mutase (Pagm) Length = 112 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target448 phosphoglucosamine mutase protein [Candidatus Liberibac
1p5d_X463 PMM, phosphomannomutase; alpha/beta protein, phosphohex 4e-93
3i3w_A443 Phosphoglucosamine mutase; csgid, IDP02164, isomerase, 5e-89
1wqa_A455 Phospho-sugar mutase; alpha-beta protein, unphosphoryla 3e-65
1kfi_A572 Phosphoglucomutase 1; parafusin, phosphoprotein PP63, e 1e-60
2f7l_A455 455AA long hypothetical phospho-sugar mutase; phosphoma 2e-58
3pmg_A561 Alpha-D-glucose-1,6-bisphosphate; phosphoglucomutase; H 1e-56
2fuv_A549 Phosphoglucomutase; structural genomics, PSI, protein s 9e-55
2z0f_A524 Putative phosphoglucomutase; isomerase, magnesium, meta 6e-52
1tuo_A464 Putative phosphomannomutase; thermus thermophilus HB8, 4e-50
2dka_A544 Phosphoacetylglucosamine mutase; isomerase; 1.93A {Cand 3e-40
2dka_A 544 Phosphoacetylglucosamine mutase; isomerase; 1.93A {Cand 9e-14
1wjw_A112 Phosphoacetylglucosamine mutase; carbohydrate metabolis 1e-09
>1p5d_X PMM, phosphomannomutase; alpha/beta protein, phosphohexomutase, phosphoserine, enzyme-ligand complex, enzyme-metal complex, isomerase; HET: SEP G1P; 1.60A {Pseudomonas aeruginosa} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1k35_A* 1p5g_X* 1pcj_X* 1pcm_X* 1k2y_X* 2h5a_X* 2h4l_X* 2fkf_A* 3bkq_X* 3c04_A* 2fkm_X* Length = 463 Back     alignment and structure
 Score =  337 bits (864), Expect = 4e-93
 Identities = 117/461 (25%), Positives = 196/461 (42%), Gaps = 35/461 (7%)

Query: 6   FGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAG 65
           F    IRG      +T      IG A+G      +    V +G+D RLSG  L   L+ G
Sbjct: 14  FRAYDIRGVVGD-TLTAETAYWIGRAIGSESL-ARGEPCVAVGRDGRLSGPELVKQLIQG 71

Query: 66  FTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDI 125
               G     +G +P+P +      L    GVM++ SHNP   NG K+        +  I
Sbjct: 72  LVDCGCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVAGETLANEQI 131

Query: 126 EDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCAN 185
           +   E + ++DL S +   + +           RY + ++  +      + +++VVDC N
Sbjct: 132 QALRERIEKNDLASGVGSVEQVDI-------LPRYFKQIRDDIAM---AKPMKVVVDCGN 181

Query: 186 GASYKVAPEVFWELGADVVVIGDKPNGININLDCGST---NVLSLQRKVHEVRADIGIAL 242
           G +  +AP++   LG  V+ +  + +G   N         N+  L  KV    AD+G+A 
Sbjct: 182 GVAGVIAPQLIEALGCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAF 241

Query: 243 DGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGL 302
           DGDGDRV +V   G I+  D+++ L A++ +S     G  I+  V     L   I+G G 
Sbjct: 242 DGDGDRVGVVTNTGTIIYPDRLLMLFAKDVVSR--NPGADIIFDVKCTRRLIALISGYGG 299

Query: 303 SLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGD-GLVAALQVLRYIKQYDKP 361
                + G   I + MK  G  + GE SGH+   +     D G+ +A ++L  + Q  + 
Sbjct: 300 RPVMWKTGHSLIKKKMKETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRD 359

Query: 362 VSTICHCFEEYPQFLRS----VSVKDTSILNSSSIVQAIAD-AESELRGID--------- 407
              +   F  +P  + +    ++V + S       +Q  A   E  +  +D         
Sbjct: 360 SEHV---FSAFPSDISTPEINITVTEDSKFAIIEALQRDAQWGEGNITTLDGVRVDYPKG 416

Query: 408 RLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
             +VRAS T  ++ +  E D    ++RI       +  +DS
Sbjct: 417 WGLVRASNTTPVLVLRFEADTEEELERIKTVFRNQLKAVDS 457


>3i3w_A Phosphoglucosamine mutase; csgid, IDP02164, isomerase, magnesium, metal-binding, phosphoprotein, structural genomics; HET: SEP; 2.30A {Francisella tularensis subsp} Length = 443 Back     alignment and structure
>1wqa_A Phospho-sugar mutase; alpha-beta protein, unphosphorylated form, enzyme-metal complex, isomerase; 2.00A {Pyrococcus horikoshii} Length = 455 Back     alignment and structure
>1kfi_A Phosphoglucomutase 1; parafusin, phosphoprotein PP63, exocytosis, isomerase; 2.40A {Paramecium tetraurelia} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1kfq_A Length = 572 Back     alignment and structure
>2f7l_A 455AA long hypothetical phospho-sugar mutase; phosphomannomutase, phosphoglucomutase, isomerase; 2.80A {Sulfolobus tokodaii} Length = 455 Back     alignment and structure
>3pmg_A Alpha-D-glucose-1,6-bisphosphate; phosphoglucomutase; HET: SEP; 2.40A {Oryctolagus cuniculus} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1c4g_A* 1jdy_A* 1lxt_A 1vkl_A* 1c47_A* Length = 561 Back     alignment and structure
>2fuv_A Phosphoglucomutase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, isomerase; HET: MSE; 2.00A {Salmonella typhimurium LT2} Length = 549 Back     alignment and structure
>2z0f_A Putative phosphoglucomutase; isomerase, magnesium, metal-binding, structural genomics, NPPSFA; 2.52A {Thermus thermophilus HB8} Length = 524 Back     alignment and structure
>1tuo_A Putative phosphomannomutase; thermus thermophilus HB8, biosynthesis of alginate, structural genomics; 1.70A {Thermus thermophilus} Length = 464 Back     alignment and structure
>2dka_A Phosphoacetylglucosamine mutase; isomerase; 1.93A {Candida albicans} PDB: 2dkc_A* 2dkd_A* Length = 544 Back     alignment and structure
>2dka_A Phosphoacetylglucosamine mutase; isomerase; 1.93A {Candida albicans} PDB: 2dkc_A* 2dkd_A* Length = 544 Back     alignment and structure
>1wjw_A Phosphoacetylglucosamine mutase; carbohydrate metabolism, structural genomics, riken structural genomics/proteomics initiative, RSGI, isomerase; NMR {Mus musculus} SCOP: d.129.2.1 Length = 112 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target448 phosphoglucosamine mutase protein [Candidatus Liberibac
1wqa_A455 Phospho-sugar mutase; alpha-beta protein, unphosphoryla 100.0
1p5d_X463 PMM, phosphomannomutase; alpha/beta protein, phosphohex 100.0
2fuv_A549 Phosphoglucomutase; structural genomics, PSI, protein s 100.0
2z0f_A524 Putative phosphoglucomutase; isomerase, magnesium, meta 100.0
3i3w_A443 Phosphoglucosamine mutase; csgid, IDP02164, isomerase, 100.0
2f7l_A455 455AA long hypothetical phospho-sugar mutase; phosphoma 100.0
1kfi_A572 Phosphoglucomutase 1; parafusin, phosphoprotein PP63, e 100.0
3pmg_A561 Alpha-D-glucose-1,6-bisphosphate; phosphoglucomutase, p 100.0
1tuo_A464 Putative phosphomannomutase; thermus thermophilus HB8, 100.0
2dka_A544 Phosphoacetylglucosamine mutase; isomerase; 1.93A {Cand 100.0
1wjw_A112 Phosphoacetylglucosamine mutase; carbohydrate metabolis 99.41
2dka_A544 Phosphoacetylglucosamine mutase; isomerase; 1.93A {Cand 98.76
2vvr_A149 Ribose-5-phosphate isomerase B; RPIB, carbohydrate meta 91.1
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structural g 90.99
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical react 90.96
2ehp_A126 AQ_1627 protein; putative protein, NPPSFA, national pro 90.48
>1wqa_A Phospho-sugar mutase; alpha-beta protein, unphosphorylated form, enzyme-metal complex, isomerase; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
Probab=100.00  E-value=0  Score=675.83  Aligned_cols=440  Identities=31%  Similarity=0.493  Sum_probs=386.7

Q ss_pred             CCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCC-CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             9652033586015506877889999999999999997237-998389996687797999999999999789879996267
Q gi|254780544|r    1 MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKK-KHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPI   79 (448)
Q Consensus         1 m~r~lFGt~GiRG~~~~~~~t~~~v~~i~~a~~~~~~~~~-~~~~vvVg~D~R~~s~~~~~~~~~gl~~~G~~V~~~g~~   79 (448)
                      |.| ||||+||||++|+ +|||+++.++|+|++++++... .+++|+||||+|++|++|++++++||+++|++|+++|.+
T Consensus         1 m~~-~FGt~GiRG~~~~-~~~~~~~~~~~~a~~~~l~~~~~~~~~VviG~D~R~ss~~l~~~~~~~l~~~G~~v~~~g~~   78 (455)
T 1wqa_A            1 MGK-LFGTFGVRGIANE-KITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEALISGLLSVGCDVIDVGIA   78 (455)
T ss_dssp             CCT-TCBTTBEEEEBTT-TBCHHHHHHHHHHHHHHHHHTTCSSCEEEEEECSCTTHHHHHHHHHHHHHHTTCEEEEEEEC
T ss_pred             CCC-CCCCCCCEEECCC-CCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEECCCC
T ss_conf             966-3686680125189-88899999999999999997189999899998997369999999999999869969982878


Q ss_pred             CHHHHHHHHHHHCCCEEEEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             80899999987199258988654777520125640365456783578999999615664334454332221113542566
Q gi|254780544|r   80 PSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDR  159 (448)
Q Consensus        80 ptP~l~~a~~~~~~~gGI~iTaSHNP~~~nGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (448)
                      |||+++|++++++++|||||||||||++|||+|+++++|.++.+..+++||.++........ ....++.... .++.+.
T Consensus        79 ~TP~l~~~v~~~~~~~Gi~iTaShnp~~~nG~K~~~~~g~~~~~~~~~~ie~~~~~~~~~~~-~~~~~~~~~~-~~~~~~  156 (455)
T 1wqa_A           79 PTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLKKEREAIVEELFFKEDFDRA-KWYEIGEVRR-EDIIKP  156 (455)
T ss_dssp             CHHHHHHHHHHTTCSEEEEECCTTSCTTEEEEEEECTTSSBCCHHHHHHHHHHHHHTCCCCC-CGGGCCCEEE-CCCHHH
T ss_pred             CHHHHHHHHHHHCCCCCEEEEECCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCCC-CCCCCCCEEE-CCHHHH
T ss_conf             86999999997298874378734798656865975466876651388898888751242223-4445560463-415899


Q ss_pred             HHHHHHHCCCCH-HHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCHHHHHHHHHCCCCC
Q ss_conf             688776326310-211896699984466543333222123332222222322235577--44221013777642002343
Q gi|254780544|r  160 YIEHVKRTLPRD-VTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGININ--LDCGSTNVLSLQRKVHEVRA  236 (448)
Q Consensus       160 Yi~~l~~~~~~~-~~~~~lkvvvD~~~G~~~~~~~~il~~lg~~~~~i~~~pd~~~~~--~~~~~~~~~~l~~~v~~~~a  236 (448)
                      |++.+.+.+... +..++++|++||+||+++.+++++|+++||+++.++++||+.|++  |+|.++.+..+.+.+++.++
T Consensus       157 Y~~~~~~~~~~~~~~~~~~~iv~d~~~G~~~~~~~~ll~~lg~~v~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~a  236 (455)
T 1wqa_A          157 YIEAIKSKVDVEAIKKRKPFVVVDTSNGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGA  236 (455)
T ss_dssp             HHHHHHTTSCHHHHHHHCCEEEEECTTSGGGGTHHHHHHHHTCEEEEESCSCCTTCSSSCSCCCTTTTHHHHHHHHHHTC
T ss_pred             HHHHHHHHCCHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             99999863354444135762799547886899999999972995799613589988889998752239999999862245


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCHHH
Q ss_conf             03675315521000133223755331135677776553200223433322113600444320012111112332110111
Q gi|254780544|r  237 DIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIME  316 (448)
Q Consensus       237 d~Gia~DgD~DR~~ivd~~G~~i~~d~~~~lla~~ll~~~~~~~~~vv~~v~ss~~i~~~a~~~g~~v~~t~vG~k~i~~  316 (448)
                      |+|+++||||||++++|++|++++++++.++++.+++.+.  +...+++++.++..++.+++++|+++++|+||+||+.+
T Consensus       237 d~g~a~D~DgDR~~~~d~~g~~~~~~~~~~l~~~~~~~~~--~~~~v~~~~~~s~~~~~~~~~~g~~~~~~~tG~k~i~~  314 (455)
T 1wqa_A          237 DFGVAQDGDADRAVFIDENGRFIQGDKTFALVADAVLKEK--GGGLLVTTVATSNLLDDIAKKHGAKVMRTKVGDLIVAR  314 (455)
T ss_dssp             SEEEEECTTSCCEEEEETTSCBCCHHHHHHHHHHHHHHHH--TSCEEEEETTSCTHHHHHHHHTTCEEEEECSSTTHHHH
T ss_pred             CEEEEECCCCCEEEEEECCCCEEECCHHHHHHHHHHHHHC--CCCCCCCCCCCCHHHHHHHHHCCCEEEEECCCHHHHHH
T ss_conf             1677885999879999546967715279999999999755--79984336311079999999729846760461899999


Q ss_pred             HHHCCCCEECCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHH
Q ss_conf             11028970013466236530100014442332024667775588889999865642300000005676511558999998
Q gi|254780544|r  317 YMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILNSSSIVQAI  396 (448)
Q Consensus       317 ~~~~~~~~~g~E~sg~~~~~~~~~~~Dgi~a~l~~le~l~~~~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~~~i~~~~  396 (448)
                      +|.+.++.+|+|+|||++++++.+++||++++++++++++.++++++++++.|+++++...++.++........++.+..
T Consensus       315 ~~~~~~~~~g~E~sg~~~~~~~~~~~D~~~a~~~~le~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  394 (455)
T 1wqa_A          315 ALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAKSGKKFSELIDELPKYYQIKTKRHVEGDRHAIVNKVAEMA  394 (455)
T ss_dssp             HHHHTTCSEEEETTEEEECTTTCSSCCHHHHHHHHHHHHHHHCSCHHHHHHTSCCCEEEEECCBCCSSHHHHHHHHHHHH
T ss_pred             HHHHCCCEEEEECCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHHH
T ss_conf             99825977998444680353211367306899999997766499878999987774065610133431899999999987


Q ss_pred             HHHHHH---CCC------CCEEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             765543---078------86599967798227999961599899999999999998752
Q gi|254780544|r  397 ADAESE---LRG------IDRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMI  446 (448)
Q Consensus       397 ~~~~~~---~~~------~~w~liRpSgTEp~iriy~Ea~~~~~~~~l~~~~~~~i~~i  446 (448)
                      .+....   +||      .+|++||||||||++|||+||+|++.++++++.+.++|+++
T Consensus       395 ~~~~~~~~~~Dgik~~~~~g~~~iRpSGTEp~irvY~Ea~~~e~a~~l~~~~~~~v~~~  453 (455)
T 1wqa_A          395 RERGYTVDTTDGAKIIFEDGWVLVRASGTEPIIRIFSEAKSKEKAQEYLNLGIELLEKA  453 (455)
T ss_dssp             HHTTCEEECTTSEEEECSSCEEEECCCSSSSBCCEEEEESSHHHHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCCCCCEEEEECCCEEEEEEECCCCCEEEEEEEECCHHHHHHHHHHHHHHHHHH
T ss_conf             63378623456389980987999980198117999999799999999999999999997



>1p5d_X PMM, phosphomannomutase; alpha/beta protein, phosphohexomutase, phosphoserine, enzyme-ligand complex, enzyme-metal complex, isomerase; HET: SEP G1P; 1.60A {Pseudomonas aeruginosa} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1k35_A* 1p5g_X* 1pcj_X* 1pcm_X* 1k2y_X* 2h5a_X* 2h4l_X* 2fkf_A* 3bkq_X* 3c04_A* 2fkm_X* Back     alignment and structure
>2fuv_A Phosphoglucomutase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, isomerase; HET: MSE; 2.00A {Salmonella typhimurium LT2} Back     alignment and structure
>2z0f_A Putative phosphoglucomutase; isomerase, magnesium, metal-binding, structural genomics, NPPSFA; 2.52A {Thermus thermophilus HB8} Back     alignment and structure
>3i3w_A Phosphoglucosamine mutase; csgid, IDP02164, isomerase, magnesium, metal-binding, phosphoprotein, structural genomics; HET: SEP; 2.30A {Francisella tularensis subsp} Back     alignment and structure
>2f7l_A 455AA long hypothetical phospho-sugar mutase; phosphomannomutase, phosphoglucomutase, isomerase; 2.80A {Sulfolobus tokodaii} Back     alignment and structure
>1kfi_A Phosphoglucomutase 1; parafusin, phosphoprotein PP63, exocytosis, isomerase; 2.40A {Paramecium tetraurelia} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1kfq_A Back     alignment and structure
>3pmg_A Alpha-D-glucose-1,6-bisphosphate; phosphoglucomutase, phosphotransferase; HET: SEP; 2.40A {Oryctolagus cuniculus} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1c4g_A* 1jdy_A* 1lxt_A 1vkl_A* 1c47_A* Back     alignment and structure
>1tuo_A Putative phosphomannomutase; thermus thermophilus HB8, biosynthesis of alginate, structural genomics; 1.70A {Thermus thermophilus} Back     alignment and structure
>2dka_A Phosphoacetylglucosamine mutase; isomerase; 1.93A {Candida albicans} PDB: 2dkc_A* 2dkd_A* Back     alignment and structure
>1wjw_A Phosphoacetylglucosamine mutase; carbohydrate metabolism, structural genomics, riken structural genomics/proteomics initiative, RSGI, isomerase; NMR {Mus musculus} SCOP: d.129.2.1 Back     alignment and structure
>2dka_A Phosphoacetylglucosamine mutase; isomerase; 1.93A {Candida albicans} PDB: 2dkc_A* 2dkd_A* Back     alignment and structure
>2vvr_A Ribose-5-phosphate isomerase B; RPIB, carbohydrate metabolism, pentose phosphate pathway; 2.10A {Escherichia coli} PDB: 1nn4_A Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1} Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM- barrel, rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>2ehp_A AQ_1627 protein; putative protein, NPPSFA, national project on protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eiu_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 448 phosphoglucosamine mutase protein [Candidatus Liberibac
d3pmga1190 c.84.1.1 (A:1-190) Phosphoglucomutase {Rabbit (Oryctola 3e-27
d1kfia1203 c.84.1.1 (A:3-205) Exocytosis-sensitive phosphoprotein, 9e-24
d1p5dx1146 c.84.1.1 (X:9-154) Phosphomannomutase/phosphoglucomutas 2e-19
d1p5dx2104 c.84.1.1 (X:155-258) Phosphomannomutase/phosphoglucomut 7e-20
d1kfia2118 c.84.1.1 (A:206-323) Exocytosis-sensitive phosphoprotei 1e-15
d3pmga2113 c.84.1.1 (A:191-303) Phosphoglucomutase {Rabbit (Orycto 3e-15
d1p5dx3109 c.84.1.1 (X:259-367) Phosphomannomutase/phosphoglucomut 2e-18
d1kfia3120 c.84.1.1 (A:324-443) Exocytosis-sensitive phosphoprotei 3e-13
d3pmga3117 c.84.1.1 (A:304-420) Phosphoglucomutase {Rabbit (Orycto 3e-12
d1wjwa_112 d.129.2.1 (A:) Phosphoacetylglucosamine mutase {Mouse ( 7e-10
d1p5dx496 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomu 7e-04
>d3pmga1 c.84.1.1 (A:1-190) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 190 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphoglucomutase, first 3 domains
superfamily: Phosphoglucomutase, first 3 domains
family: Phosphoglucomutase, first 3 domains
domain: Phosphoglucomutase
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
 Score =  116 bits (292), Expect = 3e-27
 Identities = 37/156 (23%), Positives = 65/156 (41%), Gaps = 13/156 (8%)

Query: 6   FGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHR-RVVIGKDTRLSGYMLENSLVA 64
            GT G+R +   F  + N+      ++       ++    +V+G D R         +V 
Sbjct: 16  PGTSGLRKRVKVFQSSTNYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAIQLIVR 75

Query: 65  GFTAAGMDAFI---LGPIPSPAVAMLTRSLRADVGVMISASHNPYQ---DNGIKLFGPDG 118
              A G+   +    G + +PAV+ + R ++A  G++++ASHNP     D GIK    +G
Sbjct: 76  IAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNG 135

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVD 154
                 I D+I  +    +  Y      I    +VD
Sbjct: 136 GPAPEAITDKIFQIS-KTIEEYA-----ICPDLKVD 165


>d1kfia1 c.84.1.1 (A:3-205) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Length = 203 Back     information, alignment and structure
>d1p5dx1 c.84.1.1 (X:9-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Length = 146 Back     information, alignment and structure
>d1p5dx2 c.84.1.1 (X:155-258) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Length = 104 Back     information, alignment and structure
>d1kfia2 c.84.1.1 (A:206-323) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Length = 118 Back     information, alignment and structure
>d3pmga2 c.84.1.1 (A:191-303) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 113 Back     information, alignment and structure
>d1p5dx3 c.84.1.1 (X:259-367) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Length = 109 Back     information, alignment and structure
>d1kfia3 c.84.1.1 (A:324-443) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Length = 120 Back     information, alignment and structure
>d3pmga3 c.84.1.1 (A:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 117 Back     information, alignment and structure
>d1wjwa_ d.129.2.1 (A:) Phosphoacetylglucosamine mutase {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1p5dx4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Length = 96 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target448 phosphoglucosamine mutase protein [Candidatus Liberibac
d1p5dx1146 Phosphomannomutase/phosphoglucomutase {Pseudomonas aeru 100.0
d3pmga1190 Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [Tax 100.0
d1kfia1203 Exocytosis-sensitive phosphoprotein, pp63/parafusin {Pa 100.0
d1p5dx3109 Phosphomannomutase/phosphoglucomutase {Pseudomonas aeru 99.88
d3pmga3117 Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [Tax 99.82
d1kfia3120 Exocytosis-sensitive phosphoprotein, pp63/parafusin {Pa 99.8
d1p5dx2104 Phosphomannomutase/phosphoglucomutase {Pseudomonas aeru 99.87
d3pmga2113 Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [Tax 99.87
d1kfia2118 Exocytosis-sensitive phosphoprotein, pp63/parafusin {Pa 99.77
d1wjwa_112 Phosphoacetylglucosamine mutase {Mouse (Mus musculus) [ 99.43
d1p5dx496 Phosphomannomutase/phosphoglucomutase {Pseudomonas aeru 99.27
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal doma 95.07
d3bula2156 Methionine synthase, C-terminal domain {Escherichia col 93.81
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochleariu 92.25
d1nn4a_159 Alternate ribose 5-phosphate isomerase B, RpiB {Escheri 92.2
d2vvpa1156 Alternate ribose 5-phosphate isomerase B, RpiB {Mycobac 90.45
>d1p5dx1 c.84.1.1 (X:9-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglucomutase, first 3 domains
superfamily: Phosphoglucomutase, first 3 domains
family: Phosphoglucomutase, first 3 domains
domain: Phosphomannomutase/phosphoglucomutase
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=100.00  E-value=9.4e-40  Score=262.00  Aligned_cols=135  Identities=27%  Similarity=0.419  Sum_probs=122.7

Q ss_pred             CCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             96520335860155068778899999999999999972379983899966877979999999999997898799962678
Q gi|254780544|r    1 MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPIP   80 (448)
Q Consensus         1 m~r~lFGt~GiRG~~~~~~~t~~~v~~i~~a~~~~~~~~~~~~~vvVg~D~R~~s~~~~~~~~~gl~~~G~~V~~~g~~p   80 (448)
                      |.+++||++||||++|+ +|||+++.++|+|+++++..+ ..++|+||||+|.+|++|++++++||+++|++|+++|.+|
T Consensus         1 ~~~sif~~~dIRGi~~~-~lt~~~~~~ig~a~~~~~~~~-~~~~VvIg~D~R~ss~~~~~~~~~gl~~~G~~V~~~g~~p   78 (146)
T d1p5dx1           1 LPASIFRAYDIRGVVGD-TLTAETAYWIGRAIGSESLAR-GEPCVAVGRDGRLSGPELVKQLIQGLVDCGCQVSDVGMVP   78 (146)
T ss_dssp             CCGGGBCSSSEEEEBTT-TBCHHHHHHHHHHHHHHHHHT-TCCEEEEEECSCTTHHHHHHHHHHHHHTBTCEEEEEEECC
T ss_pred             CCHHHCCCCCEEEECCC-CCCHHHHHHHHHHHHHHHHHC-CCCEEEEEECCCCCHHHHHHHHHEEECCCCEEEEECCCCC
T ss_conf             97556653577025799-969999999999999998755-9988999977864401666532206505764887454456


Q ss_pred             HHHHHHHHHHHCCCEEEEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             0899999987199258988654777520125640365456783578999999615664
Q gi|254780544|r   81 SPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLT  138 (448)
Q Consensus        81 tP~l~~a~~~~~~~gGI~iTaSHNP~~~nGiK~~~~~G~~i~~~~~~~Ie~~~~~~~~  138 (448)
                      ||+++|+++++++++||||||||||++|||+||+.+ |..+.+++.++|++.+++..+
T Consensus        79 TP~l~~~~~~~~~~~GI~ITASHNP~~~NGiK~~~~-g~~~~~~~~~~i~~~~~~~~~  135 (146)
T d1p5dx1          79 TPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVA-GETLANEQIQALRERIEKNDL  135 (146)
T ss_dssp             HHHHHHHHHHSSCSEEEEECCTTSCTTEEEEEEEET-TEECCTHHHHHHHHHHHHTCC
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEECC-CCCCCHHHHHHHHHHHHCCCC
T ss_conf             088999998624673368862478601040898669-996494999999999854774



>d3pmga1 c.84.1.1 (A:1-190) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kfia1 c.84.1.1 (A:3-205) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Back     information, alignment and structure
>d1p5dx3 c.84.1.1 (X:259-367) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3pmga3 c.84.1.1 (A:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kfia3 c.84.1.1 (A:324-443) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Back     information, alignment and structure