254780545

254780545

metalloprotease

GeneID in NCBI database:8209541Locus tag:CLIBASIA_02160
Protein GI in NCBI database:254780545Protein Accession:YP_003064958.1
Gene range:+(734770, 736713)Protein Length:647aa
Gene description:metalloprotease
COG prediction:[O] ATP-dependent Zn proteases
KEGG prediction:ftsH; metalloprotease; K03798 cell division protease FtsH [EC:3.4.24.-]
SEED prediction:Cell division protein FtsH (EC 3.4.24.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Cell division-ribosomal stress proteins cluster;
Bacterial Cell Division
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------
MIALCLIASFSIFQAPSAGQDGVQDISYSQFIKDVDAGRVRKISVIGTHITGFYVNGESSFQTYMPLVGSKLLDKLQSKDIEISSRPVNDGSPGLLSYLGSWFPLVLVVLVWMFLMRQIQGGGARGAMGFGKSKAKLLSGNVGSVTFKDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLDAALLRPGRFDRQITVPNPDIVGREHILMVHSRNVPLAPNVILKTIARGTPGFSGADLRNLVNEAALMAARRNRRLVTMQEFEDAKDKILMGAERRSTAMTEEEKKITAYHEAGHAVVACHVPKADPLHKATIIPRGRALGMVMQLPEADRHSTTYVWMTSRLTILMGGRVAEEFTFGEDNVTSGAMSDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEALLSHPVSRPRSISEETAQKIDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASLIRGEKISRPSEDDGVALCASVPQAGVQEAEVSCSEEKDNENIDSSNTDDLEKEDTKSVQ
cHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccEEEEEEEccEEEEEEEcccccEEEEcccccHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHcHHHHHHccccccccEEEEEcccccHHHHHHHHHHHccccEEEEcHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEEcHHHHcccccccccccccHHHHHHcccHHccccccccccEEEEEEcccHHHccHHHHccccccEEEEcccccHHHHHHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccccEEEEEccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccEEEEEEEcEEEEEEEEccccEEEEccccccHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHccHccccccHHcccccHHHHHHHHHHHHHHcccHHHHHcccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEcHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccHHHHHHHHHHHHccccccccEEEEEEEccccccccHHHccccccccEEEEcccccccHHHHHEEHHccccccccccHHHEEcccccccHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHccHHHccccccHHHHHHHHHHHcccEEHHHccccccHHHHHHHHHHHHHHHEEEEccccccccccHHHHHHHHHHHHcccHHHHHEccccccccccccHHHHHHHHHHHHHHHccccHccccEEEEcccccEEEcccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHccccccccccc
MIALCLIAsfsifqapsagqdgvqdisysqfikdvdagrvrkISVIGTHITgfyvngessfqtyMPLVGSKLLDklqskdieissrpvndgspgllsylgsWFPLVLVVLVWMFLMRQIqgggargamgfgkSKAKllsgnvgsvtfkdvagvdeAKEDLQEIVDFlcdpqkfkrlggriphgvllvgppgtgkTLLARAVageanvpfftisgsDFVELFVGVGASRVRDMFEqaknnspcivfvdeidavgrhrgiglgggndeREQTLNQLLVEMDGFESSEGVILIAATnrpdvldaallrpgrfdrqitvpnpdivgrEHILMVHsrnvplapnvilktiargtpgfsgaDLRNLVNEAALMAARRNRRLVTMQEFEDAKDKILMGAERRSTAMTEEEKKITAYHEAGHAVvachvpkadplhkatiiprgralgmvmqlpeadrhstTYVWMTSRLTILMGgrvaeeftfgednvtsgamsDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEAllshpvsrprsiseETAQKIDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASLIrgekisrpseddgVALCasvpqagvqEAEVscseekdnenidssntddlekedtksvq
MIALCLIASFSIFQAPSAGQDGVQDISYSQFIKDVDAGRVRKISVIGTHITGFYVNGESSFQTYMPLVGSKLLDKLQSKDIEIssrpvndgsPGLLSYLGSWFPLVLVVLVWMFLMRQIQGGGARGAMGFGKSKAKLLSGNVGSVTFKDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFeqaknnspcivFVDEIDAVGRHRgiglgggndeREQTLNQLLVEMDGFESSEGVILIAATNRPDVLDAAllrpgrfdrqitvpnpdiVGREHILMVHSRNVPLAPNVILKTIARGTPGFSGADLRNLVNEAALMAARrnrrlvtmqefedakdkilmgaerrstamTEEEKKITAYHEAGHAVVACHVPKADPLHKATIIPRGRALGMVMQLPEADRHSTTYVWMTSRLTILMGGRVAEEFtfgednvtsgaMSDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEAllshpvsrprsisEETAQKIDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASLIRGEKISRPSEDDGVALCASVPQAGVQEAevscseekdnenidssntddlekedtksvq
MIALCLIASFSIFQAPSAGQDGVQDISYSQFIKDVDAGRVRKISVIGTHITGFYVNGESSFQTYMPLVGSKLLDKLQSKDIEISSRPVNDGSPGLLSYLGSWFPlvlvvlvWMFLmrqiqgggargamgfgKSKAKLLSGNVGSVTFKDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVgrhrgiglgggNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLDAALLRPGRFDRQITVPNPDIVGREHILMVHSRNVPLAPNVILKTIARGTPGFSGADLRNLVNEaalmaarrnrrlVTMQEFEDAKDKILMGAERRSTAMTEEEKKITAYHEAGHAVVACHVPKADPLHKATIIPRGRALGMVMQLPEADRHSTTYVWMTSRLTILMGGRVAEEFTFGEDNVTSGAMSDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEALLSHPVSRPRSISEETAQKIDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASLIRGEKISRPSEDDGVALCASVPQAGVQEAEVSCSEEKDNENIDSSNTDDLEKEDTKSVQ
MIALCLIASFSI****************SQFIKDVDAGRVRKISVIGTHITGFYVNGESSFQTYMPLVGSKLLDKLQSKDIEISSRPVNDGSPGLLSYLGSWFPLVLVVLVWMFLM******************AKLLSGNVGSVTFKDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLDAALLRPGRFDRQITVPNPDIVGREHILMVHSRNVPLAPNVILKTIARGTPGFSGADLRNLVNEAALMAARRNRRLVTMQEFEDAKDKILMGAERRSTAMTEEEKKITAYHEAGHAVVACHVPKADPLHKATIIPRGRALGMVMQLPEADRHSTTYVWMTSRLTILMGGRVAEEFTFGEDNVTSGAMSDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEALL**************AQKIDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASL***********************************************************
MIALCLIASFSIFQAPSAGQDGVQDISYSQFIKDVDAGRVRKISVIGTHITGFYVNGESSFQTYMPLVGSKLLDKLQSKDIEISSRPVNDGSPGLLSYLGSWFPLVLVVLVWMFLMRQIQGGGARGAMGFGKSKAKLLSGNVGSVTFKDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLDAALLRPGRFDRQITVPNPDIVGREHILMVHSRNVPLAPNVILKTIARGTPGFSGADLRNLVNEAALMAARRNRRLVTMQEFEDAKDKILMGAERRSTAMTEEEKKITAYHEAGHAVVACHVPKADPLHKATIIPRGRALGMVMQLPEADRHSTTYVWMTSRLTILMGGRVAEEFTFGEDNVTSGAMSDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEALLSHPVSRPRSISEETAQKIDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASLIRGEKISRPSEDDGVALCASVPQA***********************************
MIALCLIASFSIFQAPS******QDISYSQFIKDVDAGRVRKISVIGTHITGFYVNGESSFQTYMPLVGSKLLDKLQSKDIEISSRPVNDGSPGLLSYLGSWFPLVLVVLVWMFLMRQIQGGG*****************NVGSVTFKDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLDAALLRPGRFDRQITVPNPDIVGREHILMVHSRNVPLAPNVILKTIARGTPGFSGADLRNLVNEAALMAARRNRRLVTMQEFEDAKDKILMGAERRSTAMTEEEKKITAYHEAGHAVVACHVPKADPLHKATIIPRGRALGMVMQLPEADRHSTTYVWMTSRLTILMGGRVAEEFTFGEDNVTSGAMSDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEALLSHPVSRPRSISEETAQKIDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASLIRGE*******************************************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIALCLIASFSIFQAPSAGQDGVQDISYSQFIKDVDAGRVRKISVIGTHITGFYVNGESSFQTYMPLVGSKLLDKLQSKDIEISSRPVNDGSPGLLSYLGSWFPLVLVVLVWMFLMRQIQGGGARGAMGFGKSKAKLLSGNVGSVTFKDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLDAALLRPGRFDRQITVPNPDIVGREHILMVHSRNVPLAPNVILKTIARGTPGFSGADLRNLVNEAALMAARRNRRLVTMQEFEDAKDKILMGAERRSTAMTEEEKKITAYHEAGHAVVACHVPKADPLHKATIIPRGRALGMVMQLPEADRHSTTYVWMTSRLTILMGGRVAEEFTFGEDNVTSGAMSDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEALLSHPVSRPRSISEETAQKIDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASLIRGEKISRPSEDDGVALCASVPQAGVQEAEVSCSEEKDNENIDSSNTDDLEKEDTKSVQ
MIALCLIASFSIFQAPSAGQDGVQDISYSQFIKDVDAGRVRKISVIGTHITGFYVNGESSFQTYMPLVGSKLLDKLQSKDIEISSRPVNDGSPGLLSYLGSWFPLVLVVLVWMFLMRQIQGGGARGAMGFGKSKAKLLSGNVGSVTFKDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLDAALLRPGRFDRQITVPNPDIVGREHILMVHSRNVPLAPNVILKTIARGTPGFSGADLRNLVNEAALMAARRNRRLVTMQEFEDAKDKILMGAERRSTAMTEEEKKITAYHEAGHAVVACHVPKADPLHKATIIPRGRALGMVMQLPEADRHSTTYVWMTSRLTILMGGRVAEEFTFGEDNVTSGAMSDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEALLSHPVSRPRSISEETAQKIDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASLIRGEKISRPSEDDGVALCASVPQAGVQEAEVSCSEEKDNENIDSSNTDDLEKEDTKSVQ
MIALCLIASFSIFQAPSAGQDGVQDISYSQFIKDVDAGRVRKISVIGTHITGFYVNGESSFQTYMPLVGSKLLDKLQSKDIEISSRPVNDGSPGLLSYLGSWFPLVLVVLVWMFLMRQIQGGGARGAMGFGKSKAKLLSGNVGSVTFKDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLDAALLRPGRFDRQITVPNPDIVGREHILMVHSRNVPLAPNVILKTIARGTPGFSGADLRNLVNEAALMAARRNRRLVTMQEFEDAKDKILMGAERRSTAMTEEEKKITAYHEAGHAVVACHVPKADPLHKATIIPRGRALGMVMQLPEADRHSTTYVWMTSRLTILMGGRVAEEFTFGEDNVTSGAMSDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEALLSHPVSRPRSISEETAQKIDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASLIRGEKISRPSEDDGVALCASVPQAGVQEAEVSCSEEKDNENIDSSNTDDLEKEDTKSVQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target647 metalloprotease [Candidatus Liberibacter asiaticus str.
254780829437 ATP-dependent protease ATP-binding subunit [Candid 4e-06
254780271424 ATP-dependent protease ATP-binding subunit ClpX [C 6e-05
254780270820 ATP-dependent protease La [Candidatus Liberibacter 9e-05
254780552334 Holliday junction DNA helicase RuvB [Candidatus Li 6e-04
>gi|254780829|ref|YP_003065242.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 437 Back     alignment
 Score = 45.1 bits (105), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 180 IPHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVEL-FVGVGASR-VRDMFEQAK 237
           +P  +LLVGP G GKT ++R +A  A  PF  +  + F E+ +VG    + +RD+ + A 
Sbjct: 52  MPKNILLVGPTGVGKTAISRRLARLAGAPFIKVEVTKFTEIGYVGRNVEQIIRDLVDVAI 111

Query: 238 N 238
           N
Sbjct: 112 N 112

>gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Back     alignment
 Score = 40.8 bits (94), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 184 VLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVEL-FVGVGASRVRDMFEQAKNNS-- 240
           +LLVGP G GKT LA+ +A   +VPF     +   E  +VG     +     QA + +  
Sbjct: 116 ILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVE 175

Query: 241 ---PCIVFVDEIDAVGR 254
                IV++DE+D + R
Sbjct: 176 RAQRGIVYIDEVDKISR 192

>gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score = 40.4 bits (93), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 59/115 (51%), Gaps = 16/115 (13%)

Query: 148 KDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRIPHGVLLVGPPGTGKTLLARAVAGEANV 207
           +D  G+++ KE    I+++L    +  +  G I   +  VGPPG GKT LA+++A     
Sbjct: 339 QDHFGLEKVKE---RIIEYLAVQMRVIKNKGLI---LCFVGPPGVGKTSLAQSIAKATGR 392

Query: 208 PFFTIS-GSDFVE--------LFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVG 253
            +  +S G  + E         ++G    R+    ++AK ++P ++ +DEID +G
Sbjct: 393 QYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQSLKRAKRSNP-LLLLDEIDKMG 446

>gi|254780552|ref|YP_003064965.1| Holliday junction DNA helicase RuvB [Candidatus Liberibacter asiaticus str. psy62] Length = 334 Back     alignment
 Score = 37.7 bits (86), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (67%)

Query: 184 VLLVGPPGTGKTLLARAVAGEANVPFFTISG 214
           VL VGPPG GKT LA+ VA E  V F + SG
Sbjct: 57  VLFVGPPGLGKTTLAQVVARELGVNFRSTSG 87

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target647 metalloprotease [Candidatus Liberibacter asiaticus str.
315122873660 metalloprotease [Candidatus Liberibacter solanacearum C 1 0.0
222149667681 metalloprotease [Agrobacterium vitis S4] Length = 681 1 0.0
86359049643 cell division metalloproteinase protein [Rhizobium etli 1 0.0
241206180648 ATP-dependent metalloprotease FtsH [Rhizobium leguminos 1 0.0
209550772643 ATP-dependent metalloprotease FtsH [Rhizobium leguminos 1 0.0
190893271643 cell division metalloproteinase [Rhizobium etli CIAT 65 1 0.0
159185871648 metalloprotease [Agrobacterium tumefaciens str. C58] Le 1 0.0
116253705643 cell division protein FtsH [Rhizobium leguminosarum bv. 1 0.0
222086969647 cell division metalloproteinase protein [Agrobacterium 1 0.0
332716439654 cell division protein [Agrobacterium sp. H13-3] Length 1 0.0
>gi|315122873|ref|YP_004063362.1| metalloprotease [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 660 Back     alignment and organism information
 Score = 1122 bits (2901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/648 (82%), Positives = 596/648 (91%), Gaps = 2/648 (0%)

Query: 1   MIALCLIASFSIFQAPSAGQDGVQDISYSQFIKDVDAGRVRKISVIGTHITGFYVNGESS 60
           +IALCLIASFSIFQAP +G+DGVQDISYSQFIKD+DAGR+RK+S++G +I+G YV GESS
Sbjct: 13  IIALCLIASFSIFQAPFSGKDGVQDISYSQFIKDIDAGRIRKVSIVGRYISGTYVKGESS 72

Query: 61  FQTYMPLVGSKLLDKLQSKDIEISSRPVNDGSPGLLSYLGSWFPLVLVVLVWMFLMRQIQ 120
           FQTY+P+V  K+LDKLQ+KD+EI S+PVND SP ++SYL SWFPL++VV +W+F MRQIQ
Sbjct: 73  FQTYVPVVTDKMLDKLQAKDVEIFSKPVNDSSPSMMSYLSSWFPLIVVVFIWIFFMRQIQ 132

Query: 121 GGGARGAMGFGKSKAKLLSGNVGSVTFKDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRI 180
           GGGARGAMGFGKSKAKLLSGN   +TF DVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRI
Sbjct: 133 GGGARGAMGFGKSKAKLLSGNGVRITFDDVAGVDEAKEDLQEIVDFLCDPQKFKRLGGRI 192

Query: 181 PHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNS 240
           PHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNS
Sbjct: 193 PHGVLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVELFVGVGASRVRDMFEQAKNNS 252

Query: 241 PCIVFVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLD 300
           PCI+FVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLD
Sbjct: 253 PCIIFVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLD 312

Query: 301 AALLRPGRFDRQITVPNPDIVGREHILMVHSRNVPLAPNVILKTIARGTPGFSGADLRNL 360
            ALLRPGRFDRQITVPNPD+VGRE IL VHSRNVPLAPNV+LKTIARGTPGFSGADLRNL
Sbjct: 313 PALLRPGRFDRQITVPNPDVVGRERILKVHSRNVPLAPNVVLKTIARGTPGFSGADLRNL 372

Query: 361 VNEAALMAARRNRRLVTMQEFEDAKDKILMGAERRSTAMTEEEKKITAYHEAGHAVVACH 420
           VNEAAL+AARRNRRLVTMQEFEDAKDKILMGAERRST MTE EKKITAYHEAGHAVVACH
Sbjct: 373 VNEAALVAARRNRRLVTMQEFEDAKDKILMGAERRSTVMTEAEKKITAYHEAGHAVVACH 432

Query: 421 VPKADPLHKATIIPRGRALGMVMQLPEADRHSTTYVWMTSRLTILMGGRVAEEFTFGEDN 480
           VP+ADPLHKATIIPRGRALGMVMQLPEADRHS++Y WM SRL ILMGGRVAEE  FG++N
Sbjct: 433 VPQADPLHKATIIPRGRALGMVMQLPEADRHSSSYTWMISRLAILMGGRVAEEIIFGKEN 492

Query: 481 VTSGAMSDIEYATKLARVMVTQFGFSNLLGKVSYEEGQQEALLSHPVSRPRSISEETAQK 540
           VTSGAMSD+EYATKLARVMVTQFGFS+LLG+V Y E QQ+  L HP+SR RSISE+TA K
Sbjct: 493 VTSGAMSDLEYATKLARVMVTQFGFSDLLGRVFYGESQQDISLGHPISRSRSISEDTAHK 552

Query: 541 IDKEVFRLIEEAYQKAKSIIQEKNDNFVAIAEALLEYETLSGKEIASLIRGEKISRPSED 600
           IDKEVFRLI+EAYQKA+SII+EKN++FVAIAE LLEYETLSGKEIASLI+GEKI+R  ED
Sbjct: 553 IDKEVFRLIDEAYQKARSIIEEKNNDFVAIAEGLLEYETLSGKEIASLIKGEKINRSLED 612

Query: 601 DGVAL-CASVPQAGVQEAEVSCSEEKDNE-NIDSSNTDDLEKEDTKSV 646
           D  ++ CASVP+AG+ E E+  SE+++ E +IDS+   D  KE++ ++
Sbjct: 613 DDNSMRCASVPKAGISEEEIHGSEKEEEEYSIDSTKKSDDSKEESTNI 660


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149667|ref|YP_002550624.1| metalloprotease [Agrobacterium vitis S4] Length = 681 Back     alignment and organism information
>gi|86359049|ref|YP_470941.1| cell division metalloproteinase protein [Rhizobium etli CFN 42] Length = 643 Back     alignment and organism information
>gi|241206180|ref|YP_002977276.1| ATP-dependent metalloprotease FtsH [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 648 Back     alignment and organism information
>gi|209550772|ref|YP_002282689.1| ATP-dependent metalloprotease FtsH [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 643 Back     alignment and organism information
>gi|190893271|ref|YP_001979813.1| cell division metalloproteinase [Rhizobium etli CIAT 652] Length = 643 Back     alignment and organism information
>gi|159185871|ref|NP_356910.2| metalloprotease [Agrobacterium tumefaciens str. C58] Length = 648 Back     alignment and organism information
>gi|116253705|ref|YP_769543.1| cell division protein FtsH [Rhizobium leguminosarum bv. viciae 3841] Length = 643 Back     alignment and organism information
>gi|222086969|ref|YP_002545503.1| cell division metalloproteinase protein [Agrobacterium radiobacter K84] Length = 647 Back     alignment and organism information
>gi|332716439|ref|YP_004443905.1| cell division protein [Agrobacterium sp. H13-3] Length = 654 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target647 metalloprotease [Candidatus Liberibacter asiaticus str.
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH 0.0
CHL00176638 CHL00176, ftsH, cell division protein; Validated 1e-166
KOG0731774 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing 1e-151
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed 0.0
KOG0734752 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing 1e-166
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttranslat 0.0
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleotidase; 5e-84
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regulatory 1e-77
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 family 4e-71
KOG0730693 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttransl 1e-63
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslat 2e-61
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily 4e-61
KOG0733 802 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subf 2e-58
KOG0729435 KOG0729, KOG0729, KOG0729, 26S proteasome regulatory co 2e-58
KOG0728404 KOG0728, KOG0728, KOG0728, 26S proteasome regulatory co 6e-57
KOG0652424 KOG0652, KOG0652, KOG0652, 26S proteasome regulatory co 7e-56
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4- 4e-54
KOG0726440 KOG0726, KOG0726, KOG0726, 26S proteasome regulatory co 8e-54
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B- 6e-53
KOG0736953 KOG0736, KOG0736, KOG0736, Peroxisome assembly factor 2 2e-49
KOG0727408 KOG0727, KOG0727, KOG0727, 26S proteasome regulatory co 2e-49
KOG0738491 KOG0738, KOG0738, KOG0738, AAA+-type ATPase [Posttransl 6e-46
KOG0651388 KOG0651, KOG0651, KOG0651, 26S proteasome regulatory co 1e-44
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [ 2e-44
KOG0730693 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttransl 1e-41
KOG0737386 KOG0737, KOG0737, KOG0737, AAA+-type ATPase [Posttransl 7e-40
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslat 3e-35
KOG0741744 KOG0741, KOG0741, KOG0741, AAA+-type ATPase [Posttransl 3e-35
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 2e-33
KOG0740428 KOG0740, KOG0740, KOG0740, AAA+-type ATPase [Posttransl 3e-31
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 4e-21
KOG0735952 KOG0735, KOG0735, KOG0735, AAA+-type ATPase [Posttransl 4e-11
COG1474366 COG1474, CDC6, Cdc6-related protein, AAA superfamily AT 5e-04
pfam01434192 pfam01434, Peptidase_M41, Peptidase family M41 1e-66
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily 4e-56
KOG0733802 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subf 1e-54
KOG0735952 KOG0735, KOG0735, KOG0735, AAA+-type ATPase [Posttransl 1e-49
KOG0739439 KOG0739, KOG0739, KOG0739, AAA+-type ATPase [Posttransl 5e-41
KOG0732 1080 KOG0732, KOG0732, KOG0732, AAA+-type ATPase containing 2e-40
KOG0736953 KOG0736, KOG0736, KOG0736, Peroxisome assembly factor 2 1e-17
TIGR02881261 TIGR02881, spore_V_K, stage V sporulation protein K 7e-08
pfam00004131 pfam00004, AAA, ATPase family associated with various c 2e-46
smart00382148 smart00382, AAA, ATPases associated with a variety of c 5e-17
KOG0744423 KOG0744, KOG0744, KOG0744, AAA+-type ATPase [Posttransl 1e-07
pfam07728139 pfam07728, AAA_5, AAA domain (dynein-related subfamily) 3e-06
KOG0741744 KOG0741, KOG0741, KOG0741, AAA+-type ATPase [Posttransl 2e-04
COG0542 786 COG0542, ClpA, ATPases with chaperone activity, ATP-bin 4e-04
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 0.004
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 5e-24
KOG0743457 KOG0743, KOG0743, KOG0743, AAA+-type ATPase [Posttransl 2e-16
KOG0742630 KOG0742, KOG0742, KOG0742, AAA+-type ATPase [Posttransl 4e-13
CHL00206 2281 CHL00206, ycf2, Ycf2; Provisional 8e-06
COG0593408 COG0593, DnaA, ATPase involved in DNA replication initi 0.001
PRK13342413 PRK13342, PRK13342, recombination factor protein RarA; 2e-11
COG2256436 COG2256, MGS1, ATPase related to the helicase subunit o 2e-09
TIGR00763775 TIGR00763, lon, ATP-dependent protease La 1e-07
KOG2004906 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent 1e-05
KOG2028554 KOG2028, KOG2028, KOG2028, ATPase related to the helica 2e-05
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding regulato 3e-05
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase subun 5e-05
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Re 5e-05
COG1220444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), AT 2e-04
TIGR00390441 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase s 3e-04
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB s 6e-04
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 0.001
cd04105203 cd04105, SR_beta, Signal recognition particle receptor, 0.002
KOG0745564 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-t 0.002
COG0542786 COG0542, ClpA, ATPases with chaperone activity, ATP-bin 0.003
PRK13341 725 PRK13341, PRK13341, recombination factor protein RarA/u 0.003
COG0714329 COG0714, COG0714, MoxR-like ATPases [General function p 2e-10
PRK04195482 PRK04195, PRK04195, replication factor C large subunit; 8e-09
COG0466782 COG0466, Lon, ATP-dependent Lon protease, bacterial typ 2e-07
COG2255332 COG2255, RuvB, Holliday junction resolvasome, helicase 8e-06
PRK00440319 PRK00440, rfc, replication factor C small subunit; Revi 6e-04
PRK12402337 PRK12402, PRK12402, replication factor C small subunit 0.001
pfam06480104 pfam06480, FtsH_ext, FtsH Extracellular 4e-07
COG1224450 COG1224, TIP49, DNA helicase TIP49, TBP-interacting pro 7e-07
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 9e-07
KOG1942456 KOG1942, KOG1942, KOG1942, DNA helicase, TBP-interactin 6e-06
PHA02544316 PHA02544, 44, clamp loader, small subunit; Provisional 8e-06
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subunit C 4e-04
TIGR00678188 TIGR00678, holB, DNA polymerase III, delta' subunit 6e-04
COG0470325 COG0470, HolB, ATPase involved in DNA replication [DNA 0.002
TIGR02397355 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamm 0.002
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding subu 1e-04
pfam05496234 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB 0.002
>gnl|CDD|162266 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|177080 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|35950 KOG0731, KOG0731, KOG0731, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|35953 KOG0734, KOG0734, KOG0734, AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30813 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|31415 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|35949 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30812 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162267 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|35952 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35948 KOG0729, KOG0729, KOG0729, 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35947 KOG0728, KOG0728, KOG0728, 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35871 KOG0652, KOG0652, KOG0652, 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|35945 KOG0726, KOG0726, KOG0726, 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185633 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|35955 KOG0736, KOG0736, KOG0736, Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35946 KOG0727, KOG0727, KOG0727, 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35957 KOG0738, KOG0738, KOG0738, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35870 KOG0651, KOG0651, KOG0651, 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31416 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|35949 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35956 KOG0737, KOG0737, KOG0737, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30812 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35960 KOG0741, KOG0741, KOG0741, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163401 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|35959 KOG0740, KOG0740, KOG0740, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|35954 KOG0735, KOG0735, KOG0735, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|31663 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|144872 pfam01434, Peptidase_M41, Peptidase family M41 Back     alignment and domain information
>gnl|CDD|162267 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|35952 KOG0733, KOG0733, KOG0733, Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35954 KOG0735, KOG0735, KOG0735, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35958 KOG0739, KOG0739, KOG0739, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35951 KOG0732, KOG0732, KOG0732, AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35955 KOG0736, KOG0736, KOG0736, Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163057 TIGR02881, spore_V_K, stage V sporulation protein K Back     alignment and domain information
>gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|35963 KOG0744, KOG0744, KOG0744, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|149019 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|35960 KOG0741, KOG0741, KOG0741, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30888 COG0542, ClpA, ATPases with chaperone activity, ATP-binding subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|35962 KOG0743, KOG0743, KOG0743, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35961 KOG0742, KOG0742, KOG0742, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177097 CHL00206, ycf2, Ycf2; Provisional Back     alignment and domain information
>gnl|CDD|30938 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|183986 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|32437 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|162028 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|37215 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|37239 KOG2028, KOG2028, KOG2028, ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|161849 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|31412 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|178847 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|31413 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|161852 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|116338 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|133305 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>gnl|CDD|35964 KOG0745, KOG0745, KOG0745, Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30888 COG0542, ClpA, ATPases with chaperone activity, ATP-binding subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183985 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|179778 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|30814 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|32436 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|179026 PRK00440, rfc, replication factor C small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183503 PRK12402, PRK12402, replication factor C small subunit 2; Reviewed Back     alignment and domain information
>gnl|CDD|148219 pfam06480, FtsH_ext, FtsH Extracellular Back     alignment and domain information
>gnl|CDD|31417 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|37153 KOG1942, KOG1942, KOG1942, DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|177379 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|161993 TIGR00678, holB, DNA polymerase III, delta' subunit Back     alignment and domain information
>gnl|CDD|73174 COG0470, HolB, ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|162839 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>gnl|CDD|180029 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|147593 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 647 metalloprotease [Candidatus Liberibacter asiaticus str.
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 100.0
KOG0734752 consensus 100.0
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 100.0
CHL00176631 ftsH cell division protein; Validated 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational modi 100.0
KOG0731774 consensus 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 100.0
PRK03992390 proteasome-activating nucleotidase; Provisional 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 100.0
KOG0730693 consensus 100.0
KOG0733 802 consensus 100.0
TIGR01243980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 100.0
KOG0736953 consensus 100.0
KOG0733802 consensus 100.0
CHL00195491 ycf46 Ycf46; Provisional 100.0
KOG0729435 consensus 100.0
KOG0738491 consensus 100.0
KOG0726440 consensus 100.0
KOG0727408 consensus 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 100.0
KOG0652424 consensus 100.0
KOG0728404 consensus 100.0
KOG0735952 consensus 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 100.0
KOG0737386 consensus 100.0
KOG0739439 consensus 100.0
KOG0651388 consensus 100.0
KOG0732 1080 consensus 100.0
KOG0730693 consensus 100.0
KOG0740428 consensus 100.0
KOG0742630 consensus 99.93
KOG0736953 consensus 99.9
KOG0744423 consensus 99.86
PRK04195403 replication factor C large subunit; Provisional 99.79
PRK13342417 recombination factor protein RarA; Reviewed 99.76
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.71
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.68
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 99.63
PRK00440318 rfc replication factor C small subunit; Reviewed 99.6
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.55
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 99.53
TIGR00763941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 99.53
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.53
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 99.52
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 99.52
KOG2028554 consensus 99.51
PRK07270557 DNA polymerase III subunits gamma and tau; Validated 99.5
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 99.48
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 99.46
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 99.45
PRK08451523 DNA polymerase III subunits gamma and tau; Validated 99.44
PRK06674563 DNA polymerase III subunits gamma and tau; Validated 99.43
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 99.43
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 99.42
PRK06647560 DNA polymerase III subunits gamma and tau; Validated 99.4
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 99.37
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.36
PRK00149447 dnaA chromosomal replication initiation protein; Review 99.25
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 99.19
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 99.17
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 99.16
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 99.16
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 99.14
PRK09111600 DNA polymerase III subunits gamma and tau; Validated 99.14
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 99.03
PRK12422455 chromosomal replication initiation protein; Provisional 99.01
PRK05642234 DNA replication initiation factor; Validated 99.0
PRK08084235 DNA replication initiation factor; Provisional 98.99
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 98.95
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 98.94
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 98.91
KOG1969877 consensus 98.91
PRK08727233 hypothetical protein; Validated 98.9
pfam05621302 TniB Bacterial TniB protein. This family consists of se 98.88
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 98.82
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 98.68
PRK06620214 hypothetical protein; Validated 98.62
PRK09087226 hypothetical protein; Validated 98.61
PRK10365441 transcriptional regulatory protein ZraR; Provisional 98.57
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 98.54
PRK05022510 anaerobic nitric oxide reductase transcription regulato 98.52
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.46
PTZ00112650 origin recognition complex 1 protein; Provisional 98.42
pfam03215490 Rad17 Rad17 cell cycle checkpoint protein. 98.18
TIGR01818471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 97.82
TIGR01817574 nifA Nif-specific regulatory protein; InterPro: IPR0101 97.05
COG1067647 LonB Predicted ATP-dependent protease [Posttranslationa 96.64
PRK12337492 2-phosphoglycerate kinase; Provisional 95.91
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 100.0
TIGR02902532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.37
pfam01434192 Peptidase_M41 Peptidase family M41. 100.0
KOG0741744 consensus 100.0
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 98.61
KOG0991333 consensus 98.26
COG1855604 ATPase (PilT family) [General function prediction only] 95.77
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 99.98
KOG0735952 consensus 99.81
pfam00931285 NB-ARC NB-ARC domain. 97.63
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 96.39
pfam00004131 AAA ATPase family associated with various cellular acti 99.97
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.83
COG0714329 MoxR-like ATPases [General function prediction only] 99.48
smart00382148 AAA ATPases associated with a variety of cellular activ 99.44
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 99.31
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 99.25
pfam07726131 AAA_3 ATPase family associated with various cellular ac 99.1
KOG0741744 consensus 99.06
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 99.05
KOG0745564 consensus 98.73
PRK08116262 hypothetical protein; Validated 98.72
PRK06871324 DNA polymerase III subunit delta'; Validated 98.44
PRK09183258 transposase/IS protein; Provisional 98.4
PRK08769319 DNA polymerase III subunit delta'; Validated 98.37
PRK05707328 DNA polymerase III subunit delta'; Validated 98.36
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 98.35
PRK07132303 DNA polymerase III subunit delta'; Validated 98.34
PRK06526254 transposase; Provisional 98.32
PRK06921265 hypothetical protein; Provisional 98.3
PRK08181269 transposase; Validated 98.29
PRK05917290 DNA polymerase III subunit delta'; Validated 98.27
PRK06090319 DNA polymerase III subunit delta'; Validated 98.19
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 98.15
PRK08699325 DNA polymerase III subunit delta'; Validated 98.15
PRK06964342 DNA polymerase III subunit delta'; Validated 98.13
PRK07993334 DNA polymerase III subunit delta'; Validated 98.11
PRK13531498 regulatory ATPase RavA; Provisional 98.03
PHA02244383 ATPase-like protein 97.93
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.54
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 97.54
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 97.52
KOG0478804 consensus 97.46
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 97.45
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 97.32
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.26
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 97.24
KOG0477854 consensus 97.15
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.09
cd03246173 ABCC_Protease_Secretion This family represents the ABC 97.08
PRK02496185 adk adenylate kinase; Provisional 97.06
cd03115173 SRP The signal recognition particle (SRP) mediates the 97.06
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 97.04
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 97.03
PRK08118167 topology modulation protein; Reviewed 96.91
PRK11823454 DNA repair protein RadA; Provisional 96.9
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 96.88
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 96.82
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.79
pfam00406186 ADK Adenylate kinase. 96.79
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.61
PRK07276290 DNA polymerase III subunit delta'; Validated 96.54
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 96.45
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.43
PRK07261171 topology modulation protein; Provisional 96.4
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.31
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.19
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 96.17
PRK00279215 adk adenylate kinase; Reviewed 96.16
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.0
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 95.98
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 95.95
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 95.95
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 95.88
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 95.81
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 95.71
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 95.71
KOG2543438 consensus 95.6
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 95.52
PRK03846198 adenylylsulfate kinase; Provisional 95.51
TIGR00362493 DnaA chromosomal replication initiator protein DnaA; In 95.49
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 95.44
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The MutS 95.24
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS prot 95.16
PRK06217185 hypothetical protein; Validated 95.13
pfam00488234 MutS_V MutS domain V. This domain is found in proteins 95.11
KOG2228408 consensus 95.08
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 94.85
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 94.75
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 94.7
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 94.66
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS family 94.65
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS prot 94.61
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 94.58
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 94.57
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS prot 94.49
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein 94.49
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 94.1
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes. Th 94.08
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 93.57
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 93.23
COG4988559 CydD ABC-type transport system involved in cytochrome b 93.22
KOG0743457 consensus 99.93
CHL00026 2286 ycf2 Ycf2 99.92
CHL00179 2262 consensus 99.92
CHL00178 2133 consensus 99.91
COG1241682 MCM2 Predicted ATPase involved in replication control, 97.38
PTZ00111916 DNA replication licensing factor MCM4; Provisional 96.91
CHL00181287 cbbX CbbX; Provisional 99.81
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.71
PRK12402337 replication factor C small subunit 2; Reviewed 99.53
PRK05564313 DNA polymerase III subunit delta'; Validated 99.34
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 99.27
pfam00308219 Bac_DnaA Bacterial dnaA protein. 99.24
KOG0989346 consensus 99.18
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 99.07
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 99.07
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 99.07
PRK09112352 DNA polymerase III subunit delta'; Validated 99.07
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 99.06
PRK07940395 DNA polymerase III subunit delta'; Validated 99.05
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 98.89
PRK07471363 DNA polymerase III subunit delta'; Validated 98.88
PRK07399314 DNA polymerase III subunit delta'; Validated 98.67
COG1221403 PspF Transcriptional regulators containing an AAA-type 98.49
KOG2680454 consensus 98.44
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 98.33
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 98.17
KOG2227529 consensus 98.08
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 98.01
KOG1968871 consensus 97.87
COG1485367 Predicted ATPase [General function prediction only] 97.72
KOG1970634 consensus 97.63
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 97.59
TIGR02974349 phageshock_pspF psp operon transcriptional activator Ps 97.11
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 99.58
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.31
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.3
CHL00095823 clpC Clp protease ATP binding subunit 99.26
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.24
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.22
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 99.13
PRK08939306 primosomal protein DnaI; Reviewed 98.71
PRK07952242 DNA replication protein DnaC; Validated 98.65
PRK06835330 DNA replication protein DnaC; Validated 98.51
PRK12377248 putative replication protein; Provisional 98.18
KOG1051898 consensus 97.69
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 95.75
TIGR01743269 purR_Bsub pur operon repressor; InterPro: IPR010078 Thi 95.32
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 99.57
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 99.37
KOG1942456 consensus 99.03
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 99.01
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 98.88
PRK04132 863 replication factor C small subunit; Provisional 98.62
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 98.51
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 97.66
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 97.09
KOG2170344 consensus 96.87
COG4650531 RtcR Sigma54-dependent transcription regulator containi 96.46
PRK06696227 uridine kinase; Validated 94.63
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 94.53
pfam00519432 PPV_E1_C Papillomavirus helicase. This protein is a DNA 94.08
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.47
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Posttra 99.44
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.43
KOG2004906 consensus 99.41
PRK10865 857 protein disaggregation chaperone; Provisional 99.38
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 99.37
CHL00095 823 clpC Clp protease ATP binding subunit 99.36
PRK10865857 protein disaggregation chaperone; Provisional 99.34
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 99.33
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.29
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.27
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 99.09
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 99.08
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 98.97
PRK08058329 DNA polymerase III subunit delta'; Validated 98.92
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 98.88
KOG1051 898 consensus 98.77
pfam00493327 MCM MCM2/3/5 family. 98.77
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 98.66
PRK11608325 pspF phage shock protein operon transcriptional activat 98.56
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 98.52
smart00350509 MCM minichromosome maintenance proteins. 98.23
KOG0990360 consensus 98.2
COG2204464 AtoC Response regulator containing CheY-like receiver, 97.97
KOG0480764 consensus 97.27
TIGR02329658 propionate_PrpR propionate catabolism operon regulatory 96.4
KOG0482721 consensus 96.17
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 95.9
pfam05272198 VirE Virulence-associated protein E. This family contai 95.82
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.42
PRK13765637 ATP-dependent protease Lon; Provisional 99.18
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 99.09
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 98.96
PRK09862506 putative ATP-dependent protease; Provisional 98.9
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 98.34
TIGR00602670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 97.25
PRK06067241 flagellar accessory protein FlaH; Validated 97.06
pfam10236274 DAP3 Mitochondrial ribosomal death-associated protein 3 96.61
pfam06309127 Torsin Torsin. This family consists of several eukaryot 96.51
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 95.03
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 94.34
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 93.41
PRK08903227 hypothetical protein; Validated 99.01
PRK06893229 DNA replication initiation factor; Validated 98.82
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.8
KOG1514767 consensus 98.57
KOG2383467 consensus 98.2
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 97.9
PRK13406584 bchD magnesium chelatase subunit D; Provisional 97.88
KOG07321080 consensus 97.65
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 97.54
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 97.36
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.91
TIGR02031 705 BchD-ChlD magnesium chelatase ATPase subunit D; InterPr 96.86
PRK12339197 2-phosphoglycerate kinase; Provisional 96.29
PRK05818262 DNA polymerase III subunit delta'; Validated 95.45
KOG0481729 consensus 94.87
PRK04220306 2-phosphoglycerate kinase; Provisional 94.09
COG1484254 DnaC DNA replication protein [DNA replication, recombin 98.42
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 97.54
PRK09302501 circadian clock protein KaiC; Reviewed 97.49
PRK00131175 aroK shikimate kinase; Reviewed 97.46
PRK13948182 shikimate kinase; Provisional 97.41
PRK13946195 shikimate kinase; Provisional 97.39
PRK13949169 shikimate kinase; Provisional 97.38
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 97.13
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 97.06
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 96.51
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 96.37
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.25
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.09
PRK13700732 conjugal transfer protein TraD; Provisional 95.78
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 95.7
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 95.63
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 95.56
PRK13851343 type IV secretion system protein VirB11; Provisional 95.16
pfam01202158 SKI Shikimate kinase. 94.66
pfam02456370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 94.42
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 94.07
cd04105203 SR_beta Signal recognition particle receptor, beta subu 93.94
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 93.89
COG3172187 NadR Predicted ATPase/kinase involved in NAD metabolism 93.83
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 93.73
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 93.37
pfam04851103 ResIII Type III restriction enzyme, res subunit. 93.3
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 93.26
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 98.36
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 97.43
PRK13764605 ATPase; Provisional 96.5
pfam06480104 FtsH_ext FtsH Extracellular. This domain is found in th 97.88
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 94.68
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 97.68
pfam06745231 KaiC KaiC. This family represents a conserved region wi 97.64
PRK05057172 aroK shikimate kinase I; Reviewed 97.49
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 97.46
PRK13947171 shikimate kinase; Provisional 97.41
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 97.41
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 97.39
cd01394218 radB RadB. The archaeal protein radB shares similarity 97.34
cd01124187 KaiC KaiC is a circadian clock protein primarily found 97.33
PRK03731172 aroL shikimate kinase II; Reviewed 97.22
PRK00625173 shikimate kinase; Provisional 97.12
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 97.11
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 97.1
PRK10536262 hypothetical protein; Provisional 97.02
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 96.98
PRK04328250 hypothetical protein; Provisional 96.91
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 96.84
PRK04301318 radA DNA repair and recombination protein RadA; Validat 96.83
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 96.83
PRK13808297 adenylate kinase; Provisional 96.78
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate synthase 96.78
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 96.76
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 96.75
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 96.74
PRK03839180 putative kinase; Provisional 96.72
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 96.7
KOG3347176 consensus 96.7
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 96.68
PRK09825176 idnK D-gluconate kinase; Provisional 96.65
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 96.64
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 96.64
PRK09354350 recA recombinase A; Provisional 96.64
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 96.62
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 96.6
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 96.57
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 96.54
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 96.53
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 96.47
pfam00625182 Guanylate_kin Guanylate kinase. 96.38
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 96.38
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 96.35
PRK09302501 circadian clock protein KaiC; Reviewed 96.23
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 96.22
PTZ00088225 adenylate kinase 1; Provisional 96.22
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 96.21
PRK11545177 gntK gluconate kinase 1; Provisional 96.19
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.19
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 96.19
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 96.16
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 96.14
PRK00300208 gmk guanylate kinase; Provisional 96.14
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 96.12
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 96.12
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 96.11
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 96.07
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 96.06
PRK04182178 cytidylate kinase; Provisional 96.06
pfam01057271 Parvo_NS1 Parvovirus non-structural protein NS1. This f 96.03
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 96.01
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 95.99
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.99
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 95.97
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 95.94
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 95.93
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 95.91
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 95.83
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 95.78
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 95.73
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 95.63
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 95.63
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.58
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 95.43
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 95.35
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.34
KOG3928461 consensus 95.27
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 95.23
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 95.2
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 95.2
PTZ00035350 Rad51; Provisional 95.17
COG1127263 Ttg2A ABC-type transport system involved in resistance 95.13
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 95.09
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 95.07
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 95.05
COG3839338 MalK ABC-type sugar transport systems, ATPase component 95.0
KOG3595 1395 consensus 94.97
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.93
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 94.88
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 94.82
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 94.81
PRK05541176 adenylylsulfate kinase; Provisional 94.78
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 94.7
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 94.69
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 94.67
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 94.48
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 94.46
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 94.46
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 94.36
PRK00023225 cmk cytidylate kinase; Provisional 94.33
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 94.3
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 94.23
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 94.18
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 94.12
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 94.07
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 94.07
PRK13536306 nodulation factor exporter subunit NodI; Provisional 94.06
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 93.98