254780546

254780546

hypothetical protein CLIBASIA_02165

GeneID in NCBI database:8209542Locus tag:CLIBASIA_02165
Protein GI in NCBI database:254780546Protein Accession:YP_003064959.1
Gene range:+(733340, 734611)Protein Length:423aa
Gene description:hypothetical protein
COG prediction:[D] Predicted ATPase of the PP-loop superfamily implicated in cell cycle control
KEGG prediction:hypothetical protein; K04075 tRNA(Ile)-lysidine synthase [EC:6.3.4.-]
SEED prediction:tRNA(Ile)-lysidine synthetase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA processing;
Cell division-ribosomal stress proteins cluster
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP6 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MFLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTDDRFERVRVRRFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVSIGRVVIDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYRKADVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFGKVFIPRLPFF
ccccHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccccccHHHHccccccccccccEEEcccccccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccEEEEEEccEEEEEcccHHcccccccccccccccccEEEcccccccccccccccccccccccccccHHHHHHccccccccccccHHHHHHHHHHccccccccccccccccHHHccccc
ccccHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccccccHHHHccccccccccccEEEcccccccHHHHHHHHHHccccEEEccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccEEcccEEEEEcccEEEEEcccccccccEEcccccEcccccEEEEEcccccEEEEcccccccccccccccHHHHHHHHHcccccccccEEcccHcccccccHHHHHHHHHHHccccccccccc
MFLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVlsdrsfgkikFSAISVDHCLRETAKDEVRYVSDVCSRLRIAHSVVswknskpqtGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDyaekgmglsgmcDTILYDlnlwisrpflrcRREDIRSFLLQRniswcedpsntddrfERVRVRRFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICggqislpgyrSMERVMLFLKSGKRGCVSIGRVVIDRRANFLWITRAVRnlptlilypeettvwdgryqfqnlsdsliqigpqsyrkadvpsgippiiaqralssmpskeggkpllapfsrfmtkfdlpvAYAFSisfgkvfiprlpff
MFLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLRIahsvvswknskpqtGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLqrniswcedpsntddrfervrvRRFVRDIDLHALYLkmkkfqdlrVKVNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVSIGRVVIDRRANFLWItravrnlptlilYPEETTVWDGRYQFQNLSDSLIQIGPQSYRKADVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFGKVFIPRLPFF
MFLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTddrfervrvrrfvrdIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVSIGRVVIDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYRKADVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFGKVFIPRLPFF
****P*E*VRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLRIAHSVVSWKN**********AREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGM***ILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTDDRFERVRVRRFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVSIGRVVIDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYRKADVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFGKVFIPRLPFF
MFLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTDDRFERVRVRRFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVSIGRVVIDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYRKADVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFGKVFIPRLPFF
*FLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTDDRFERVRVRRFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVSIGRVVIDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYRKADVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFGKVFIP***F*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxx
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTDDRFERVRVRRFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVSIGRVVIDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYRKADVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFGKVFIPRLPFF
MFLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTDDRFERVRVRRFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVSIGRVVIDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYRKADVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFGKVFIPRLPFF
MFLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTDDRFERVRVRRFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVSIGRVVIDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYRKADVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFGKVFIPRLPFF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target423 hypothetical protein CLIBASIA_02165 [Candidatus Liberib
315122874448 hypothetical protein CKC_05650 [Candidatus Liberibacter 1 1e-179
332716440445 tRNA-lysidine synthase [Agrobacterium sp. H13-3] Length 1 3e-75
15891237443 hypothetical protein Atu3711 [Agrobacterium tumefaciens 1 4e-73
190893272458 cell cycle protein MesJ/cytosine deaminase-related prot 1 5e-71
222086970429 cell cycle protein MesJ/cytosine deaminase-related prot 1 5e-70
327193463501 putative cell cycle protein MesJ/cytosine deaminase-rel 1 2e-69
218461257493 putative cell cycle protein MesJ/cytosine deaminase-rel 1 3e-68
227823305445 tRNA(Ile)-lysidine synthase [Sinorhizobium fredii NGR23 1 5e-68
241206181491 tRNA(Ile)-lysidine synthetase [Rhizobium leguminosarum 1 9e-68
222149666454 hypothetical protein Avi_3626 [Agrobacterium vitis S4] 1 8e-67
>gi|315122874|ref|YP_004063363.1| hypothetical protein CKC_05650 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 448 Back     alignment and organism information
 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 302/423 (71%), Positives = 363/423 (85%), Gaps = 1/423 (0%)

Query: 1   MFLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDH 60
           MFLSP+ESV+ FVRSLV PAHILVAVSGGSDS+GLLIALHS+LSD SF  IK SAISVDH
Sbjct: 1   MFLSPVESVKSFVRSLVCPAHILVAVSGGSDSIGLLIALHSILSDNSFRAIKISAISVDH 60

Query: 61  CLRETAKDEVRYVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINAT 120
            +R+ AKDEV+YV D+CSRL I H+VV WK+ KP+TGLMAAAR+ARYALI ++A  I AT
Sbjct: 61  GIRDEAKDEVKYVFDICSRLGIPHAVVVWKDQKPKTGLMAAARKARYALIVDYAMKIGAT 120

Query: 121 LIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSF 180
           L++TAHTFDDQLETVYMRSQRDYAEKGMGLSG+ +T+LYD+ LWI+RPFL CRREDIRSF
Sbjct: 121 LVVTAHTFDDQLETVYMRSQRDYAEKGMGLSGIPETVLYDMRLWIARPFLCCRREDIRSF 180

Query: 181 LLQRNISWCEDPSNTDDRFERVRVRRFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPK 240
           LLQRNI WCEDPSN DDRFERVRVRR ++DID H +Y K++KF++LR+ VNN VA LIP+
Sbjct: 181 LLQRNIGWCEDPSNADDRFERVRVRRLIQDIDPHKMYRKIEKFRNLRIAVNNNVATLIPQ 240

Query: 241 YLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRG 300
           YL VH +S+IA+S+++LNID  LL YLL+VS AICGG+ S PGYRSMERV+ +LK+ K+G
Sbjct: 241 YLKVHCQSVIALSENVLNIDLILLSYLLKVSIAICGGKTSFPGYRSMERVIAYLKNQKQG 300

Query: 301 CVSIGRVVIDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYR 360
           C+SIGRVVIDRR NFLWITRAVR+LPT+ L+ +ET VWDGRY+F N S+  I+IG + Y 
Sbjct: 301 CISIGRVVIDRRVNFLWITRAVRDLPTVKLHFKETAVWDGRYRFTNSSNESIRIGAKVYN 360

Query: 361 KA-DVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFGKVFIPR 419
           K  D  SG+P I+AQRA SS+PS+EGG+P++APFSRF+T FDLPVA+A SISF KVFIP+
Sbjct: 361 KEMDFSSGMPSIVAQRAFSSLPSEEGGEPVIAPFSRFITIFDLPVAHAISISFDKVFIPQ 420

Query: 420 LPF 422
            PF
Sbjct: 421 SPF 423


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332716440|ref|YP_004443906.1| tRNA-lysidine synthase [Agrobacterium sp. H13-3] Length = 445 Back     alignment and organism information
>gi|15891237|ref|NP_356909.1| hypothetical protein Atu3711 [Agrobacterium tumefaciens str. C58] Length = 443 Back     alignment and organism information
>gi|190893272|ref|YP_001979814.1| cell cycle protein MesJ/cytosine deaminase-related protein [Rhizobium etli CIAT 652] Length = 458 Back     alignment and organism information
>gi|222086970|ref|YP_002545504.1| cell cycle protein MesJ/cytosine deaminase-related protein [Agrobacterium radiobacter K84] Length = 429 Back     alignment and organism information
>gi|327193463|gb|EGE60359.1| putative cell cycle protein MesJ/cytosine deaminase-related protein [Rhizobium etli CNPAF512] Length = 501 Back     alignment and organism information
>gi|218461257|ref|ZP_03501348.1| putative cell cycle protein MesJ/cytosine deaminase-related protein [Rhizobium etli Kim 5] Length = 493 Back     alignment and organism information
>gi|227823305|ref|YP_002827277.1| tRNA(Ile)-lysidine synthase [Sinorhizobium fredii NGR234] Length = 445 Back     alignment and organism information
>gi|241206181|ref|YP_002977277.1| tRNA(Ile)-lysidine synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 491 Back     alignment and organism information
>gi|222149666|ref|YP_002550623.1| hypothetical protein Avi_3626 [Agrobacterium vitis S4] Length = 454 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target423 hypothetical protein CLIBASIA_02165 [Candidatus Liberib
TIGR02432189 TIGR02432, lysidine_TilS_N, tRNA(Ile)-lysidine syntheta 2e-44
pfam01171182 pfam01171, ATP_bind_3, PP-loop family 7e-42
COG0037298 COG0037, MesJ, Predicted ATPase of the PP-loop superfam 5e-35
PRK10660436 PRK10660, tilS, tRNA(Ile)-lysidine synthetase; Provisio 1e-16
cd01993185 cd01993, Alpha_ANH_like_II, This is a subfamily of Aden 3e-14
cd01992185 cd01992, PP-ATPase, N-terminal domain of predicted ATPa 1e-44
>gnl|CDD|162854 TIGR02432, lysidine_TilS_N, tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>gnl|CDD|144677 pfam01171, ATP_bind_3, PP-loop family Back     alignment and domain information
>gnl|CDD|30386 COG0037, MesJ, Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|182626 PRK10660, tilS, tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30180 cd01993, Alpha_ANH_like_II, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>gnl|CDD|30179 cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 423 hypothetical protein CLIBASIA_02165 [Candidatus Liberib
PRK10660433 tilS tRNA(Ile)-lysidine synthetase; Provisional 100.0
TIGR02432204 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro 100.0
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of the 100.0
pfam01171182 ATP_bind_3 PP-loop family. This family of proteins belo 100.0
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine nucleo 100.0
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle contr 100.0
PRK10696311 C32 tRNA thiolase; Provisional 100.0
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nucleot 99.69
COG1606269 ATP-utilizing enzymes of the PP-loop superfamily [Gener 99.66
KOG2840347 consensus 99.56
PRK00143355 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 99.54
cd01998349 tRNA_Me_trans tRNA methyl transferase. This family repr 99.48
pfam03054354 tRNA_Me_trans tRNA methyl transferase. This family repr 99.46
TIGR00268263 TIGR00268 conserved hypothetical protein TIGR00268; Int 99.44
COG0482356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate 99.39
PRK00919306 GMP synthase subunit B; Validated 99.25
TIGR00884319 guaA_Cterm GMP synthase, C-terminal domain; InterPro: I 99.23
cd01712177 ThiI ThiI is required for thiazole synthesis in the thi 99.23
cd01713173 PAPS_reductase This domain is found in phosphoadenosine 99.15
PRK00074513 guaA GMP synthase; Reviewed 99.04
pfam01507174 PAPS_reduct Phosphoadenosine phosphosulfate reductase f 99.04
cd01997295 GMP_synthase_C The C-terminal domain of GMP synthetase. 99.03
KOG2805377 consensus 99.03
pfam02568197 ThiI Thiamine biosynthesis protein (ThiI). ThiI is requ 99.02
COG0519315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide 99.01
COG0603222 Predicted PP-loop superfamily ATPase [General function 99.01
cd01995169 ExsB ExsB is a transcription regulator related protein. 98.99
PRK11106231 queuosine biosynthesis protein QueC; Provisional 98.98
TIGR00420394 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methylt 98.91
TIGR00364227 TIGR00364 exsB protein; InterPro: IPR004479 This protei 98.84
PRK08349198 hypothetical protein; Validated 98.78
COG0175261 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransfe 98.75
PRK13820395 argininosuccinate synthase; Provisional 98.73
PRK00509398 argininosuccinate synthase; Provisional 98.72
PRK05370447 argininosuccinate synthase; Validated 98.69
PRK05253300 sulfate adenylyltransferase subunit 2; Provisional 98.68
PRK08576439 hypothetical protein; Provisional 98.66
pfam02540243 NAD_synthase NAD synthase. NAD synthase (EC:6.3.5.1) is 98.62
TIGR03573343 WbuX N-acetyl sugar amidotransferase. This enzyme has b 98.58
PRK04527397 argininosuccinate synthase; Provisional 98.56
PRK02090243 phosphoadenosine phosphosulfate reductase; Provisional 98.56
KOG2594396 consensus 98.53
pfam00764389 Arginosuc_synth Arginosuccinate synthase. This family c 98.49
cd00553248 NAD_synthase NAD+ synthase is a homodimer, which cataly 98.48
PRK13794473 hypothetical protein; Provisional 98.46
PRK01565399 thiamine biosynthesis protein ThiI; Provisional 98.45
PRK12563312 sulfate adenylyltransferase subunit 2; Provisional 98.43
PRK13795630 hypothetical protein; Provisional 98.41
KOG1622552 consensus 98.4
cd01999385 Argininosuccinate_Synthase Argininosuccinate synthase. 98.39
PRK08557420 hypothetical protein; Provisional 98.38
PRK13980264 NAD synthetase; Provisional 98.36
COG0137403 ArgG Argininosuccinate synthase [Amino acid transport a 98.34
pfam00733195 Asn_synthase Asparagine synthase. This family is always 98.29
PRK06850488 hypothetical protein; Provisional 98.29
COG2117198 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouri 98.28
TIGR03183447 DNA_S_dndC putative sulfurtransferase DndC. Members of 98.27
TIGR00032420 argG argininosuccinate synthase; InterPro: IPR001518 Ar 98.27
PRK01269483 thiamine biosynthesis protein ThiI; Provisional 98.25
COG0301383 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzym 98.14
COG0171268 NadE NAD synthase [Coenzyme metabolism] 98.1
COG3969407 Predicted phosphoadenosine phosphosulfate sulfotransfer 98.08
PRK13981543 NAD synthetase; Provisional 97.85
TIGR00342391 TIGR00342 thiamine biosynthesis/tRNA modification prote 97.84
COG1365255 Predicted ATPase (PP-loop superfamily) [General functio 97.77
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine nucleo 97.74
PRK08384310 thiamine biosynthesis protein ThiI; Provisional 97.66
PRK00768274 nadE NAD synthetase; Reviewed 97.41
KOG1706412 consensus 96.98
TIGR00552286 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase 96.91
TIGR00434226 cysH phosophoadenylyl-sulfate reductase; InterPro: IPR0 90.54
pfam06508137 ExsB ExsB. This family includes putative transcriptiona 98.95
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases supe 98.69
cd01991269 Asn_Synthase_B_C The C-terminal domain of Asparagine Sy 98.36
cd0198486 AANH_like Adenine nucleotide alpha hydrolases superfami 97.95
COG0367542 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino 97.56
PRK09431555 asnB asparagine synthetase B; Provisional 97.55
TIGR03104589 trio_amidotrans asparagine synthase family amidotransfe 97.5
TIGR01536646 asn_synth_AEB asparagine synthase (glutamine-hydrolyzin 97.38
cd01987124 USP_OKCHK USP domain is located between the N-terminal 96.93
cd00293130 USP_Like Usp: Universal stress protein family. The univ 94.98
PRK10490 895 sensor protein KdpD; Provisional 94.45
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine Threon 93.19
PRK09982142 universal stress protein UspD; Provisional 92.3
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Signal 91.06
PRK10116142 universal stress protein UspC; Provisional 90.69
cd01996154 Alpha_ANH_like_III This is a subfamily of Adenine nucle 98.34
PRK00876325 nadE NAD synthetase; Reviewed 98.31
PTZ00323294 NAD+ synthase; Provisional 97.97
PRK02628678 nadE NAD synthetase; Reviewed 97.93
TIGR03108628 eps_aminotran_1 exosortase 1 system-associated amidotra 97.65
pfam01902219 ATP_bind_4 ATP-binding region. This family of proteins 97.33
PTZ00077610 asparagine synthetase; Provisional 97.26
TIGR02039295 CysD sulfate adenylyltransferase, small subunit; InterP 97.12
COG2102223 Predicted ATPases of PP-loop superfamily [General funct 96.6
KOG0571543 consensus 95.25
TIGR00289227 TIGR00289 conserved hypothetical protein TIGR00289; Int 93.23
pfam0917969 TilS TilS substrate binding domain. This domain is foun 97.13
KOG0573520 consensus 95.57
PRK13011287 formyltetrahydrofolate deformylase; Reviewed 92.99
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 92.66
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro: IPR012795 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>pfam01171 ATP_bind_3 PP-loop family Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10696 C32 tRNA thiolase; Provisional Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>KOG2840 consensus Back     alignment and domain information
>PRK00143 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; Reviewed Back     alignment and domain information
>cd01998 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>pfam03054 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>TIGR00268 TIGR00268 conserved hypothetical protein TIGR00268; InterPro: IPR005232 This family of conserved hypothetical proteins has no known function but is predicted to be part of the wider PP-loop superfamily Back     alignment and domain information
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase, C-terminal domain; InterPro: IPR001674 The amidotransferase family of enzymes utilises the ammonia derived from the hydrolysis of glutamine for a subsequent chemical reaction catalyzed by the same enzyme Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>pfam01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>KOG2805 consensus Back     alignment and domain information
>pfam02568 ThiI Thiamine biosynthesis protein (ThiI) Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>PRK11106 queuosine biosynthesis protein QueC; Provisional Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; InterPro: IPR004506 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (2 Back     alignment and domain information
>TIGR00364 TIGR00364 exsB protein; InterPro: IPR004479 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK05370 argininosuccinate synthase; Validated Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>pfam02540 NAD_synthase NAD synthase Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information
>PRK04527 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>KOG2594 consensus Back     alignment and domain information
>pfam00764 Arginosuc_synth Arginosuccinate synthase Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>PRK01565 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>KOG1622 consensus Back     alignment and domain information
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase Back     alignment and domain information
>PRK08557 hypothetical protein; Provisional Back     alignment and domain information
>PRK13980 NAD synthetase; Provisional Back     alignment and domain information
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00733 Asn_synthase Asparagine synthase Back     alignment and domain information
>PRK06850 hypothetical protein; Provisional Back     alignment and domain information
>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>PRK01269 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism] Back     alignment and domain information
>COG0171 NadE NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only] Back     alignment and domain information
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>TIGR00342 TIGR00342 thiamine biosynthesis/tRNA modification protein ThiI; InterPro: IPR003720 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell Back     alignment and domain information
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only] Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK00768 nadE NAD synthetase; Reviewed Back     alignment and domain information
>KOG1706 consensus Back     alignment and domain information
>TIGR00552 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase (6 Back     alignment and domain information
>TIGR00434 cysH phosophoadenylyl-sulfate reductase; InterPro: IPR004511 Phosphoadenosine phosphosulphate reductase (1 Back     alignment and domain information
>pfam06508 ExsB ExsB Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing); InterPro: IPR006426 These sequences represent glutamine-hydrolysing asparagine synthase Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK00876 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PTZ00323 NAD+ synthase; Provisional Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>pfam01902 ATP_bind_4 ATP-binding region Back     alignment and domain information
>PTZ00077 asparagine synthetase; Provisional Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit; InterPro: IPR011784 Metabolic assimilation of sulphur from inorganic sulphate, requires sulphate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulphates Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>KOG0571 consensus Back     alignment and domain information
>TIGR00289 TIGR00289 conserved hypothetical protein TIGR00289; InterPro: IPR005237 This family of conserved hypothetical proteins has no known function Back     alignment and domain information
>pfam09179 TilS TilS substrate binding domain Back     alignment and domain information
>KOG0573 consensus Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target423 hypothetical protein CLIBASIA_02165 [Candidatus Liberib
1ni5_A433 Structure Of The Mesj Pp-Atpase From Escherichia Co 2e-43
3a2k_A464 Crystal Structure Of Tils Complexed With Trna Lengt 3e-28
1wy5_A317 Crystal Structure Of Isoluecyl-Trna Lysidine Synthe 5e-24
2e89_B315 Crystal Structure Of Aquifex Aeolicus Tils In A Com 2e-23
2ywc_A503 Crystal Structure Of Gmp Synthetase From Thermus Th 2e-05
2ywb_A503 Crystal Structure Of Gmp Synthetase From Thermus Th 2e-05
2vxo_A697 Human Gmp Synthetase In Complex With Xmp Length = 6 4e-05
2dpl_A308 Crystal Structure Of The Gmp Synthase From Pyrococc 0.004
>gi|28374025|pdb|1NI5|A Chain A, Structure Of The Mesj Pp-Atpase From Escherichia Coli Length = 433 Back     alignment and structure
 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 81/431 (18%), Positives = 146/431 (33%), Gaps = 46/431 (10%)

Query: 14  RSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYV 73
           R L+    ILVA SGG DS  LL  L    ++     +   AI V H L   A   V + 
Sbjct: 8   RQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENP--GVALRAIHVHHGLSANADAWVTHC 65

Query: 74  SDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLE 133
            +VC + ++   V   + ++   G+ A A   +    +     +   +++TA   DDQ E
Sbjct: 66  ENVCQQWQVPLVVERVQLAQEGLGIEAQA--RQARYQAFARTLLPGEVLVTAQHLDDQCE 123

Query: 134 TVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPS 193
           T  +  +R     G+        +       + RP L   R ++  +  Q ++ W ED S
Sbjct: 124 TFLLALKRGSGPAGLSAXA---EVSEFAGTRLIRPLLARTRGELVQWARQYDLRWIEDES 180

Query: 194 NTDDRFERVRVRRFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLT---------V 244
           N DD ++R  +R  V  +    L  +   F +   +     A                  
Sbjct: 181 NQDDSYDRNFLRLRVVPL----LQQRWPHFAEATARSAALCAEQESLLDELLADDLAHCQ 236

Query: 245 HMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVM---LFLKSGKRGC 301
             +  + I   +          ++R   A  G     P   ++ R+       +     C
Sbjct: 237 SPQGTLQIVPXL-AXSDARRAAIIRRWLA--GQNAPXPSRDALVRIWQEVALAREDASPC 293

Query: 302 VSIGRVVIDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYRK 361
           + +G   I R  + LW  ++V      I+       W    Q   L   L  +   +   
Sbjct: 294 LRLGAFEIRRYQSQLWWIKSVTGQSENIVP------WQTWLQPLELPAGLGSVQLNAGGD 347

Query: 362 ADVPSGIPPIIAQ---RALSSMPSKEGGKPL--------LAPFSRFMTK---FDLPVAYA 407
              P     +  +     L  +  + GG+ L        + P+ R  T    +   +  A
Sbjct: 348 IRPPRADEAVSVRFKAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFYGETLIAA 407

Query: 408 FSISFGKVFIP 418
             +   +  + 
Sbjct: 408 AGVFVTQEGVA 418


gi|261824766|pdb|3A2K|A Chain A, Crystal Structure Of Tils Complexed With Trna Length = 464 Back     alignment and structure
gi|66360363|pdb|1WY5|A Chain A, Crystal Structure Of Isoluecyl-Trna Lysidine Synthetase Length = 317 Back     alignment and structure
>gi|159795613|pdb|2YWC|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus In Complex With Xmp Length = 503 Back     alignment and structure
gi|159795609|pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503 Back     alignment and structure
>gi|196049679|pdb|2VXO|A Chain A, Human Gmp Synthetase In Complex With Xmp Length = 697 Back     alignment and structure
gi|119389212|pdb|2DPL|A Chain A, Crystal Structure Of The Gmp Synthase From Pyrococcus Horikoshii Ot3 Length = 308 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target423 hypothetical protein CLIBASIA_02165 [Candidatus Liberib
1ni5_A433 Putative cell cycle protein MESJ; structural genomics, 1e-31
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP- 2e-20
3a2k_A464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligas 3e-18
3k32_A203 Uncharacterized protein MJ0690; predicted subunit of tR 3e-11
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATP, ATPase, PP-type, PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Length = 433 Back     alignment and structure
 Score =  133 bits (334), Expect = 1e-31
 Identities = 72/341 (21%), Positives = 124/341 (36%), Gaps = 16/341 (4%)

Query: 14  RSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYV 73
           R L+    ILVA SGG DS  LL  L    ++     +   AI V H L   A   V + 
Sbjct: 8   RQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENP--GVALRAIHVHHGLSANADAWVTHC 65

Query: 74  SDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLE 133
            +VC + ++   V   + ++   G+ A AR+ARY   +         +++TA   DDQ E
Sbjct: 66  ENVCQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFARTLL--PGEVLVTAQHLDDQCE 123

Query: 134 TVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPS 193
           T  +  +R     G         +       + RP L   R ++  +  Q ++ W ED S
Sbjct: 124 TFLLALKRGS---GPAGLSAMAEVSEFAGTRLIRPLLARTRGELVQWARQYDLRWIEDES 180

Query: 194 NTDDRFERVRVRRFVRDIDLH---ALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSII 250
           N DD ++R  +R  V  +             +   L  +  + +  L+   L        
Sbjct: 181 NQDDSYDRNFLRLRVVPLLQQRWPHFAEATARSAALCAEQESLLDELLADDLAHCQSPQG 240

Query: 251 AISQDILNIDSTLL--FYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVSIGRVV 308
            +    +   S       + R  A       S      + + +   +     C+ +G   
Sbjct: 241 TLQIVPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQEVALAREDASPCLRLGAFE 300

Query: 309 IDRRANFLWITRAVRNLPTLIL----YPEETTVWDGRYQFQ 345
           I R  + LW  ++V      I+    + +   +  G    Q
Sbjct: 301 IRRYQSQLWWIKSVTGQSENIVPWQTWLQPLELPAGLGSVQ 341


>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Length = 317 Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Length = 464 Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Length = 203 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target423 hypothetical protein CLIBASIA_02165 [Candidatus Liberib
1ni5_A433 Putative cell cycle protein MESJ; structural genomics, 100.0
3a2k_A464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligas 100.0
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP- 100.0
3k32_A203 Uncharacterized protein MJ0690; predicted subunit of tR 99.89
2c5s_A413 THII, probable thiamine biosynthesis protein THII; RNA- 99.76
2dpl_A308 GMP synthetase, GMP synthase [glutamine-hydrolyzing] su 99.6
2hma_A376 Probable tRNA (5-methylaminomethyl-2- thiouridylate)-me 99.52
2der_A380 TRNA-specific 2-thiouridylase MNMA; protein-RNA complex 99.46
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfide cr 99.33
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3-phosp 99.32
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP synthetase, X 99.16
3p52_A249 NH(3)-dependent NAD(+) synthetase; structural genomics, 99.14
1zun_A325 Sulfate adenylyltransferase subunit 2; beta barrel, swi 99.13
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine amidotra 99.1
1xng_A268 NH(3)-dependent NAD(+) synthetase; amidotransferase, li 99.08
2vxo_A697 GMP synthase [glutamine-hydrolyzing]; proto-oncogene, p 99.08
3fiu_A249 NH(3)-dependent NAD(+) synthetase; rossman fold, adenin 99.01
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, hypot 98.97
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate redu 98.89
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis 98.86
1vl2_A421 Argininosuccinate synthase; TM1780, structural genomics 98.85
2e18_A257 NH(3)-dependent NAD(+) synthetase; ligase, structural g 98.84
2goy_A275 Adenosine phosphosulfate reductase; iron sulfur cluster 98.81
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferase, nu 98.79
3fwk_A308 FMN adenylyltransferase; FAD biosynthesis, alpha/beta p 98.76
2nz2_A413 Argininosuccinate synthase; amino-acid biosynthesis, as 98.75
1k92_A455 Argininosuccinate synthase, argininosuccinate; N-type A 98.67
3dpi_A285 NAD+ synthetase; ssgcid, decode, structural genomics, P 98.64
1kor_A400 Argininosuccinate synthetase; ligase, riken structural 98.62
1wxi_A275 NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase 98.42
1kqp_A271 NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; liga 98.3
1ct9_A553 Asparagine synthetase B; amidotransferase, substrate ch 97.77
2d13_A227 Hypothetical protein PH1257; structural genomics, NPPSF 97.71
1jgt_A513 Beta-lactam synthetase; asparagine synthetase, clavulan 97.55
1vbk_A307 Hypothetical protein PH1313; structural genomics, riken 97.41
3n05_A590 NH(3)-dependent NAD(+) synthetase; ligase, structural g 97.95
3dla_A680 Glutamine-dependent NAD(+) synthetase; glutaminase, amm 97.6
3ilv_A634 Glutamine-dependent NAD(+) synthetase; protein structur 96.8
1q15_A503 CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lac 97.69
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hypothe 92.07
3mt0_A290 Uncharacterized protein PA1789; structural genomics, PS 91.89
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-responsiv 91.71
2pfs_A150 USP, universal stress protein; structural genomics, PSI 90.09
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATP, ATPase, PP-type, PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=426.22  Aligned_cols=323  Identities=23%  Similarity=0.291  Sum_probs=253.4

Q ss_pred             HHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCC
Q ss_conf             85279983999966942489999999999986489972999999667798784689999999998718988999975047
Q gi|254780546|r   14 RSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLRIAHSVVSWKNSK   93 (423)
Q Consensus        14 ~~l~~~~~i~vAvSGG~DS~aLl~ll~~~~~~~~~~~~~l~a~~vdHglr~~s~~e~~~v~~~~~~lgi~~~~~~~~~~~   93 (423)
                      +++..+.+|+||||||+|||||||+++++....  .++++.|+|||||+|++|++|+++|+++|+++|||+++.+++..+
T Consensus         8 ~~~~~~~~vlva~SGG~DS~~ll~~l~~~~~~~--~~~~~~~~h~~h~~r~~s~~~~~~v~~~~~~~~i~~~~~~~~~~~   85 (433)
T 1ni5_A            8 RQLLTSRQILVAFSGGLDSTVLLHQLVQWRTEN--PGVALRAIHVHHGLSANADAWVTHCENVCQQWQVPLVVERVQLAQ   85 (433)
T ss_dssp             HHHTTCSEEEEECCSBHHHHHHHHHHHHHHTTS--TTCEEEEEEECCSCCSSHHHHHHHHHHHHHHTTCCEEEECCCCCC
T ss_pred             HHCCCCCEEEEEEECCHHHHHHHHHHHHHHHHC--CCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             325899829999818099999999999989758--998199999829889557999999999999759978999996478


Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEECCHHCCC
Q ss_conf             87780378885455554320012344201234566656689999862365444332235764100357968710121042
Q gi|254780546|r   94 PQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCR  173 (423)
Q Consensus        94 ~~~~~~~~ar~~r~~~~~~~~~~~~~~~l~~ah~~dD~~Et~l~rl~r~sg~~g~~l~~~~~~~~~~~~~~i~RPLL~~~  173 (423)
                      ++.++|++||..||..+...+  .++.+++||||+|||+||++|+++||+|+.|+  .||++.+ ...++.++||||.++
T Consensus        86 ~~~~~e~~aR~~Ry~~~~~~~--~~~~~i~~aHh~dD~~Et~l~~l~rg~~~~gl--~~~~~~~-~~~~~~i~RPlL~~~  160 (433)
T 1ni5_A           86 EGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGL--SAMAEVS-EFAGTRLIRPLLART  160 (433)
T ss_dssp             SSSTTTTHHHHHHHHHHHHTC--CTTEEEECCCCHHHHHHHHHHHHTTTCCTTGG--GCCCSEE-EETTEEEECGGGSCC
T ss_pred             CCCCHHHHHHHHHHHHHHHHH--CCCCEEEEEEECHHHHHHHHHHHHCCCCCCCC--CCCCCEE-CCCCCEEEEECCCCC
T ss_conf             888879999999999878654--16570322001103899999987257764334--3432221-157850887500186


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCE
Q ss_conf             899999899818932026678642210189997643453100---667799999999997999999999884004-4997
Q gi|254780546|r  174 REDIRSFLLQRNISWCEDPSNTDDRFERVRVRRFVRDIDLHA---LYLKMKKFQDLRVKVNNAVAMLIPKYLTVH-MRSI  249 (423)
Q Consensus       174 r~~l~~~~~~~~i~wveDpSN~d~~f~R~rlR~~l~~l~~~~---l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~-~~~~  249 (423)
                      |+||++||++++++|+|||||.|++|+||++|+.+.|+..+.   +.....++..............+....... ....
T Consensus       161 k~ei~~y~~~~~i~~~eD~SN~d~~y~RN~IR~~iiP~l~~~~p~~~~~i~~~~~~l~e~~~~l~~~~~~~~~~~~~~~~  240 (433)
T 1ni5_A          161 RGELVQWARQYDLRWIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAEATARSAALCAEQESLLDELLADDLAHCQSPQG  240 (433)
T ss_dssp             HHHHHHHHHHTTCCCBCCCCGGGTTSHHHHHHHTHHHHHHHHCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHBCSSS
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999998746776203667776113378888875304444371699999999999999999999999999986006787


Q ss_pred             EEECHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHC---CCCCEEECCCEEEEEECCEEEEEECCCCCC
Q ss_conf             99847783375578989999999998358999988999999999866---998456107579998899899984534377
Q gi|254780546|r  250 IAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKS---GKRGCVSIGRVVIDRRANFLWITRAVRNLP  326 (423)
Q Consensus       250 ~~~~~~~~~~~~~~~~r~l~~~l~~~~g~~~~p~~~~l~~ll~~l~~---~~~~~~tl~g~~i~~~~~~l~i~RE~~~~~  326 (423)
                      ......+..++...+.++++.|+...+  .+.|+..++.+++..+..   +.+.....+++.+.++++.+++.++....+
T Consensus       241 ~l~~~~l~~l~~~~~~~vl~~~l~~~~--~~~~~~~~l~~il~~l~~~~~~~~~~~~~~~~~i~~~~~~l~~~~~~~~~~  318 (433)
T 1ni5_A          241 TLQIVPMLAMSDARRAAIIRRWLAGQN--APMPSRDALVRIWQEVALAREDASPCLRLGAFEIRRYQSQLWWIKSVTGQS  318 (433)
T ss_dssp             CEESGGGTTSCHHHHHHHHHHHHHHTT--CCCCCHHHHHHHHHHTTTSCGGGCCEEEETTEEEEESSSEEEEEECCCCCT
T ss_pred             EEEHHHHHHCCHHHHHHHHHHHHHHCC--CCCCCHHHHHHHHHHHHHHCCCCCEEEEECCEEEEEECCEEEEEECCCCCC
T ss_conf             575686431789999999999999669--999988999999999975244677277558999999899999981577754


Q ss_pred             CCC----CCCCCCEEECCCEEEE
Q ss_conf             552----3689823207841751
Q gi|254780546|r  327 TLI----LYPEETTVWDGRYQFQ  345 (423)
Q Consensus       327 ~~~----~~~~~~~~wDgR~~i~  345 (423)
                      ...    .......+++|.+.+.
T Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~~  341 (433)
T 1ni5_A          319 ENIVPWQTWLQPLELPAGLGSVQ  341 (433)
T ss_dssp             TCEEECTTTTSCEECSTTCCEEE
T ss_pred             CCCCCCCCCCCCEECCCCCCEEE
T ss_conf             43453223554224258873799



>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii OT3} PDB: 2z0c_A 3a4i_A Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2- thiouridylate)-methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway; 2.10A {Thermus thermophilus HB8} PDB: 2ywc_A* Back     alignment and structure
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphatase, transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli K12} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, structural genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Back     alignment and structure
>1kqp_A NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A Back     alignment and structure
>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1 Back     alignment and structure
>2d13_A Hypothetical protein PH1257; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Pyrococcus horikoshii} SCOP: c.26.2.1 PDB: 3h7e_A* 1ru8_A Back     alignment and structure
>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic acid, AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A* Back     alignment and structure
>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Back     alignment and structure
>3dla_A Glutamine-dependent NAD(+) synthetase; glutaminase, ammonia tunneling, enzyme, glutamine-amido transferase, ATP-binding, ligase; HET: NXX ONL; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A* Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP, protein structure initiative; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>2pfs_A USP, universal stress protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.25A {Nitrosomonas europaea atcc 19718} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 423 hypothetical protein CLIBASIA_02165 [Candidatus Liberib
d1wy5a1216 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex a 2e-20
d1ni5a1227 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, 4e-17
d1vl2a1168 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-term 7e-07
d1j20a1165 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-term 2e-06
d2c5sa1218 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI 1e-04
d1k92a1188 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-term 8e-04
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Length = 216 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PP-loop ATPase
domain: TilS-like protein Aq 1887
species: Aquifex aeolicus [TaxId: 63363]
 Score = 93.9 bits (232), Expect = 2e-20
 Identities = 44/192 (22%), Positives = 75/192 (39%), Gaps = 13/192 (6%)

Query: 21  HILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSR- 79
            +L+A SGG DS+ L   L  + +  S  ++  +    +H LRE+A+ +  +  +     
Sbjct: 26  RVLIAFSGGVDSVVLTDVLLKLKNYFSLKEVALAH--FNHMLRESAERDEEFCKEFAKER 83

Query: 80  ---LRIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVY 136
              + +    V     + +  L  A R  RY  + E  ++     I TAH  +D LET  
Sbjct: 84  NMKIFVGKEDVRAFAKENRMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLNDLLETSL 143

Query: 137 MRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTD 196
           +           G               I RP    +R +I  +   + + W ED +N +
Sbjct: 144 LFFT-------RGTGLDGLIGFLPKEEVIRRPLYYVKRSEIEEYAKFKGLRWVEDETNYE 196

Query: 197 DRFERVRVRRFV 208
               R R+R  V
Sbjct: 197 VSIPRNRIRHRV 208


>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 227 Back     information, alignment and structure
>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 168 Back     information, alignment and structure
>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 165 Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Length = 218 Back     information, alignment and structure
>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target423 hypothetical protein CLIBASIA_02165 [Candidatus Liberib
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal domain { 100.0
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 633 100.0
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal domain { 99.88
d1sura_215 Phosphoadenylyl sulphate (PAPS) reductase {Escherichia 99.4
d1jgta1299 beta-Lactam synthetase {Streptomyces clavuligerus [TaxI 98.07
d1ct9a1324 Asparagine synthetase B, C-terminal domain {Escherichia 97.71
d1vl2a1168 Argininosuccinate synthetase, N-terminal domain {Thermo 99.68
d1j20a1165 Argininosuccinate synthetase, N-terminal domain {Thermu 99.61
d1k92a1188 Argininosuccinate synthetase, N-terminal domain {Escher 99.61
d1gpma1197 GMP synthetase, central domain {Escherichia coli [TaxId 99.53
d1zuna1211 Sulfate adenylyltransferase subunit 2, CysD {Pseudomona 99.46
d2pg3a1230 Queuosine biosynthesis protein QueC {Erwinia carotovora 99.15
d1xnga1255 NH3-dependent NAD+-synthetase {Helicobacter pylori [Tax 99.09
d1wxia1274 NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 98.37
d1kqpa_271 NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId 98.24
d2d13a1226 Hypothetical protein PH1257 {Archaeon Pyrococcus horiko 97.89
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Archaeo 97.7
d1q15a1