254780547

254780547

OmpA/MotB

GeneID in NCBI database:8209543Locus tag:CLIBASIA_02170
Protein GI in NCBI database:254780547Protein Accession:YP_003064960.1
Gene range:+(732535, 733017)Protein Length:160aa
Gene description:OmpA/MotB
COG prediction:[M] Outer membrane protein and related peptidoglycan-associated (lipo)proteins
KEGG prediction:OmpA/MotB; K03640 peptidoglycan-associated lipoprotein
SEED prediction:18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVLNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRANT
cHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEccccccccccccHHHHHcccEEEEEEEcccccc
cHHHHHHEHHHHHHccccccccccccccccccccEEEccccccEEEEccccEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEccccccccEccccHHHHHcccEEEEEEEcccccc
MQYSTIFIILSAITMMSisgidnldtkisspdtvlnesslqeqfsssvgdsvffdtssysirpaDIQVLSNLGswlekhdcdflieghadelgsrnssIALGLRRAYAVFNYFVARGISASRMKVTSygkempsvyghdedayAKNRRAIVFLKGCRANT
MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVLNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRANT
MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVLNESSLQEQfsssvgdsvffdtssYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRANT
***STIFIILSAITMMS*****************************SVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGC****
MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVL************VGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRANT
MQYSTIFIILSAITMMSISGIDNLDTKI***DTVLNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGC****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVLNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRANT
MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVLNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRANT
MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVLNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRANT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target160 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
254780529343 flagellar motor protein MotB [Candidatus Liberibac 0.001
254780953190 OmpA/MotB [Candidatus Liberibacter asiaticus str. 0.007
254780483 581 putative inner membrane protein translocase compon 0.028
>gi|254780529|ref|YP_003064942.1| flagellar motor protein MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Back     alignment
 Score = 34.3 bits (77), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 50  DSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFL-IEGHADELGSRN---SSIALGLRR 105
           ++  FD SS    P  I VL  +G  L  H  + + I GH D    RN    +  L L R
Sbjct: 233 NTPMFDKSSSIPLPETIVVLQKIGEVLA-HSTEVISIRGHTDASPFRNIARDNWRLSLDR 291

Query: 106 AYAVFNYFVARGISASRM 123
           AY+ +   +  G+S  R+
Sbjct: 292 AYSAYQVLMKSGVSEDRI 309

>gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 190 Back     alignment
 Score = 31.6 bits (70), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 24/38 (63%)

Query: 85  IEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASR 122
           I+ H D +G+  +++ +   RA  + +Y + RG+S++R
Sbjct: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150

>gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC [Candidatus Liberibacter asiaticus str. psy62] Length = 581 Back     alignment
 Score = 29.6 bits (65), Expect = 0.028,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 46/118 (38%), Gaps = 7/118 (5%)

Query: 31  PDTVLNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWL---EKHDCDFLIEG 87
           P T  N   +QE F + +GD    +     I  + I       SWL   +K+     I  
Sbjct: 207 PQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPS 266

Query: 88  HADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSY----GKEMPSVYGHDED 141
                 S+   ++ G  R  A F+      +    +  T++     KE P+++ +++D
Sbjct: 267 KETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKD 324

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target160 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
315122875152 OmpA/MotB [Candidatus Liberibacter solanacearum CLso-ZC 1 2e-50
307294752169 peptidoglycan-associated lipoprotein [Sphingobium chlor 1 4e-22
294013407170 peptidoglycan-associated lipoprotein [Sphingobium japon 1 6e-22
299134179162 peptidoglycan-associated lipoprotein [Afipia sp. 1NLS2] 1 2e-21
115526690165 OmpA/MotB domain-containing protein [Rhodopseudomonas p 1 3e-21
146338272149 Outer membrane lipoprotein omp16 [Bradyrhizobium sp. OR 1 4e-21
86748938165 OmpA/MotB [Rhodopseudomonas palustris HaA2] Length = 16 1 4e-21
148258086149 outer membrane lipoprotein omp16 [Bradyrhizobium sp. BT 1 6e-21
75676898167 OmpA/MotB [Nitrobacter winogradskyi Nb-255] Length = 16 1 7e-21
222149664177 peptidoglycan-associated lipoprotein [Agrobacterium vit 1 8e-21
>gi|315122875|ref|YP_004063364.1| OmpA/MotB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 152 Back     alignment and organism information
 Score =  201 bits (512), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 93/156 (59%), Positives = 123/156 (78%), Gaps = 8/156 (5%)

Query: 1   MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVLNESSLQEQFSSSVGDSVFFDTSSYS 60
           M+Y   F+ILS  TM+  SGI+N        +T   ++S+Q+QF+ SV D +FFD +SYS
Sbjct: 1   MKYIAFFLILSVATMVHASGINN--------NTESYDASMQQQFAQSVSDRIFFDINSYS 52

Query: 61  IRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISA 120
           IRP DIQVLS+LGSWLEK+ CDF+IEGH DE G+RNSS+ LGLRRA+ VF+YF+ARGI++
Sbjct: 53  IRPEDIQVLSSLGSWLEKNGCDFIIEGHTDEQGTRNSSLVLGLRRAHTVFDYFLARGINS 112

Query: 121 SRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGC 156
           SRMK+TSYGKE+P+V G+DE AY+KNRR ++ L+ C
Sbjct: 113 SRMKITSYGKEIPAVLGYDESAYSKNRRTVIVLQKC 148


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307294752|ref|ZP_07574594.1| peptidoglycan-associated lipoprotein [Sphingobium chlorophenolicum L-1] Length = 169 Back     alignment and organism information
>gi|294013407|ref|YP_003546867.1| peptidoglycan-associated lipoprotein [Sphingobium japonicum UT26S] Length = 170 Back     alignment and organism information
>gi|299134179|ref|ZP_07027372.1| peptidoglycan-associated lipoprotein [Afipia sp. 1NLS2] Length = 162 Back     alignment and organism information
>gi|115526690|ref|YP_783601.1| OmpA/MotB domain-containing protein [Rhodopseudomonas palustris BisA53] Length = 165 Back     alignment and organism information
>gi|146338272|ref|YP_001203320.1| Outer membrane lipoprotein omp16 [Bradyrhizobium sp. ORS278] Length = 149 Back     alignment and organism information
>gi|86748938|ref|YP_485434.1| OmpA/MotB [Rhodopseudomonas palustris HaA2] Length = 165 Back     alignment and organism information
>gi|148258086|ref|YP_001242671.1| outer membrane lipoprotein omp16 [Bradyrhizobium sp. BTAi1] Length = 149 Back     alignment and organism information
>gi|75676898|ref|YP_319319.1| OmpA/MotB [Nitrobacter winogradskyi Nb-255] Length = 167 Back     alignment and organism information
>gi|222149664|ref|YP_002550621.1| peptidoglycan-associated lipoprotein [Agrobacterium vitis S4] Length = 177 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target160 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
TIGR02802104 TIGR02802, Pal_lipo, peptidoglycan-associated lipoprote 2e-30
cd07185106 cd07185, OmpA_C-like, Peptidoglycan binding domains sim 7e-23
PRK10802173 PRK10802, PRK10802, peptidoglycan-associated outer memb 4e-21
pfam0069197 pfam00691, OmpA, OmpA family 3e-15
COG1360244 COG1360, MotB, Flagellar motor protein [Cell motility a 8e-08
PRK10510219 PRK10510, PRK10510, putative outer membrane lipoprotein 2e-07
PRK08457257 PRK08457, motB, flagellar motor protein MotB; Reviewed 4e-07
PRK10808351 PRK10808, PRK10808, outer membrane protein A; Reviewed 9e-07
PRK09039343 PRK09039, PRK09039, hypothetical protein; Validated 3e-06
PRK06742225 PRK06742, PRK06742, flagellar motor protein MotS; Revie 6e-06
TIGR03789239 TIGR03789, pdsO, proteobacterial sortase system OmpA fa 2e-05
PRK09967160 PRK09967, PRK09967, putative outer membrane lipoprotein 5e-05
PRK09040214 PRK09040, PRK09040, hypothetical protein; Provisional 6e-05
PRK06925230 PRK06925, PRK06925, flagellar motor protein MotS; Revie 3e-04
PRK09038281 PRK09038, PRK09038, flagellar motor protein MotD; Revie 3e-04
TIGR03350137 TIGR03350, type_VI_ompA, type VI secretion system OmpA/ 0.002
COG2885190 COG2885, OmpA, Outer membrane protein and related pepti 3e-23
>gnl|CDD|131849 TIGR02802, Pal_lipo, peptidoglycan-associated lipoprotein Back     alignment and domain information
>gnl|CDD|143586 cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA Back     alignment and domain information
>gnl|CDD|182744 PRK10802, PRK10802, peptidoglycan-associated outer membrane lipoprotein; Provisional Back     alignment and domain information
>gnl|CDD|144333 pfam00691, OmpA, OmpA family Back     alignment and domain information
>gnl|CDD|31551 COG1360, MotB, Flagellar motor protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|182507 PRK10510, PRK10510, putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>gnl|CDD|181435 PRK08457, motB, flagellar motor protein MotB; Reviewed Back     alignment and domain information
>gnl|CDD|182748 PRK10808, PRK10808, outer membrane protein A; Reviewed Back     alignment and domain information
>gnl|CDD|181619 PRK09039, PRK09039, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|102525 PRK06742, PRK06742, flagellar motor protein MotS; Reviewed Back     alignment and domain information
>gnl|CDD|163501 TIGR03789, pdsO, proteobacterial sortase system OmpA family protein Back     alignment and domain information
>gnl|CDD|182172 PRK09967, PRK09967, putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>gnl|CDD|181620 PRK09040, PRK09040, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180754 PRK06925, PRK06925, flagellar motor protein MotS; Reviewed Back     alignment and domain information
>gnl|CDD|181618 PRK09038, PRK09038, flagellar motor protein MotD; Reviewed Back     alignment and domain information
>gnl|CDD|132393 TIGR03350, type_VI_ompA, type VI secretion system OmpA/MotB family protein Back     alignment and domain information
>gnl|CDD|32711 COG2885, OmpA, Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 160 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
PRK09967160 putative outer membrane lipoprotein; Provisional 100.0
PRK10834239 hypothetical protein; Provisional 93.7
TIGR02802104 Pal_lipo peptidoglycan-associated lipoprotein; InterPro 100.0
PRK10802173 peptidoglycan-associated outer membrane lipoprotein; Pr 100.0
PRK10510219 putative outer membrane lipoprotein; Provisional 100.0
COG2885190 OmpA Outer membrane protein and related peptidoglycan-a 100.0
PRK10808347 outer membrane protein A; Reviewed 100.0
PRK09038285 flagellar motor protein MotD; Reviewed 99.97
cd07185106 OmpA_C-like Peptidoglycan binding domains similar to th 99.97
TIGR03350137 type_VI_ompA type VI secretion system OmpA/MotB family 99.96
PRK06742225 flagellar motor protein MotS; Reviewed 99.96
PRK09040215 hypothetical protein; Provisional 99.96
PRK06925230 flagellar motor protein MotS; Reviewed 99.95
PRK07734259 motB flagellar motor protein MotB; Reviewed 99.95
PRK08944305 motB flagellar motor protein MotB; Reviewed 99.95
PRK08126428 hypothetical protein; Provisional 99.95
PRK08457251 motB flagellar motor protein MotB; Reviewed 99.95
PRK07033429 hypothetical protein; Provisional 99.95
PRK09039343 hypothetical protein; Validated 99.94
PRK06667254 motB flagellar motor protein MotB; Validated 99.94
COG1360244 MotB Flagellar motor protein [Cell motility and secreti 99.94
pfam0069197 OmpA OmpA family. The Pfam entry also includes MotB and 99.92
PRK09041317 motB flagellar motor protein MotB; Validated 99.9
PRK06778289 hypothetical protein; Validated 99.9
PRK05996431 motB flagellar motor protein MotB; Validated 99.85
PRK12799 424 motB flagellar motor protein MotB; Reviewed 99.79
PRK07034565 hypothetical protein; Provisional 99.6
pfam09476200 Pilus_CpaD Pilus biogenesis CpaD protein (pilus_cpaD). 91.09
>PRK09967 putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>PRK10834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02802 Pal_lipo peptidoglycan-associated lipoprotein; InterPro: IPR014169 Members in this entry represent the peptidoglycan-associated lipoprotein (Pal or OprL) protein of the Tol-Pal system Back     alignment and domain information
>PRK10802 peptidoglycan-associated outer membrane lipoprotein; Provisional Back     alignment and domain information
>PRK10510 putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>COG2885 OmpA Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10808 outer membrane protein A; Reviewed Back     alignment and domain information
>PRK09038 flagellar motor protein MotD; Reviewed Back     alignment and domain information
>cd07185 OmpA_C-like Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA Back     alignment and domain information
>TIGR03350 type_VI_ompA type VI secretion system OmpA/MotB family protein Back     alignment and domain information
>PRK06742 flagellar motor protein MotS; Reviewed Back     alignment and domain information
>PRK09040 hypothetical protein; Provisional Back     alignment and domain information
>PRK06925 flagellar motor protein MotS; Reviewed Back     alignment and domain information
>PRK07734 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK08944 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK08126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08457 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK07033 hypothetical protein; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK06667 motB flagellar motor protein MotB; Validated Back     alignment and domain information
>COG1360 MotB Flagellar motor protein [Cell motility and secretion] Back     alignment and domain information
>pfam00691 OmpA OmpA family Back     alignment and domain information
>PRK09041 motB flagellar motor protein MotB; Validated Back     alignment and domain information
>PRK06778 hypothetical protein; Validated Back     alignment and domain information
>PRK05996 motB flagellar motor protein MotB; Validated Back     alignment and domain information
>PRK12799 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK07034 hypothetical protein; Provisional Back     alignment and domain information
>pfam09476 Pilus_CpaD Pilus biogenesis CpaD protein (pilus_cpaD) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target160 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
2k1s_A149 Solution Nmr Structure Of The Folded C-Terminal Fra 1e-13
2kgw_A129 Solution Structure Of The Carboxy-Terminal Domain O 2e-13
2aiz_P134 Solution Structure Of Peptidoglycan Associated Lipo 1e-11
1oap_A109 Mad Structure Of The Periplasmique Domain Of The Es 1e-11
2hqs_H118 Crystal Structure Of TolbPAL COMPLEX Length = 118 2e-11
3nb3_A346 The Host Outer Membrane Proteins Ompa And Ompc Are 2e-10
3khn_A174 Crystal Structure Of Putative Motb Like Protein Dvu 2e-09
2zf8_A278 Crystal Structure Of Moty Length = 278 3e-09
3ldt_A169 Crystal Structure Of An Outer Membrane Protein(Ompa 6e-07
3cyp_B138 The Crystal Structure Of The C-Terminal Domain Of H 3e-05
>gi|188036026|pdb|2K1S|A Chain A, Solution Nmr Structure Of The Folded C-Terminal Fragment Of Yiad From Escherichia Coli. Northeast Structural Genomics Consortium Target Er553 Length = 149 Back     alignment and structure
 Score = 79.5 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 61/124 (49%), Gaps = 1/124 (0%)

Query: 32  DTVLNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCD-FLIEGHAD 90
            T ++ +   +    ++ ++V FD+SS +++PA    L+ +   L+++      + G+ D
Sbjct: 16  GTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTD 75

Query: 91  ELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAI 150
             G  + ++ L  +RA +V +  + +G+ ASR++    G   P       +  A+NRR  
Sbjct: 76  STGGHDLNMRLSQQRADSVASALITQGVDASRIRTQGLGPANPIASNSTAEGKAQNRRVE 135

Query: 151 VFLK 154
           + L 
Sbjct: 136 ITLS 139


>gi|290559940|pdb|2KGW|A Chain A, Solution Structure Of The Carboxy-Terminal Domain Of Ompatb, A Pore Forming Protein From Mycobacterium Tuberculosis Length = 129 Back     alignment and structure
>gi|159163741|pdb|2AIZ|P Chain P, Solution Structure Of Peptidoglycan Associated Lipoprotein From Haemophilus Influenza Bound To Udp-N-Acetylmuramoyl-L- Alanyl-D-Glutamyl-Meso-2,6-Diaminopimeloyl-D-Alanyl-D- Alanine Length = 134 Back     alignment and structure
>gi|46015011|pdb|1OAP|A Chain A, Mad Structure Of The Periplasmique Domain Of The Escherichia Coli Pal Protein Length = 109 Back     alignment and structure
>gi|145579534|pdb|2HQS|H Chain H, Crystal Structure Of TolbPAL COMPLEX Length = 118 Back     alignment and structure
>gi|323462898|pdb|3NB3|A Chain A, The Host Outer Membrane Proteins Ompa And Ompc Are Packed At Specific Sites In The Shigella Phage Sf6 Virion As Structural Components Length = 346 Back     alignment and structure
>gi|270047795|pdb|3KHN|A Chain A, Crystal Structure Of Putative Motb Like Protein Dvu_2228 From Desulfovibrio Vulgaris. Length = 174 Back     alignment and structure
>gi|193885262|pdb|2ZF8|A Chain A, Crystal Structure Of Moty Length = 278 Back     alignment and structure
>gi|285803774|pdb|3LDT|A Chain A, Crystal Structure Of An Outer Membrane Protein(Ompa)from Legionella Pneumophila Length = 169 Back     alignment and structure
>gi|193885364|pdb|3CYP|B Chain B, The Crystal Structure Of The C-Terminal Domain Of Helicobacter Pylori Motb (Residues 125-256). Length = 138 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target160 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
2kgw_A129 Outer membrane protein A; OMPA- like, cell membrane, tr 5e-24
2zf8_A278 MOTY, component of sodium-driven polar flagellar motor; 2e-21
3ldt_A169 Outer membrane protein, OMPA family protein; OMPA-like 5e-21
1r1m_A164 Outer membrane protein class 4; 1.90A {Neisseria mening 6e-21
3oon_A123 Outer membrane protein (TPN50); protein structure initi 8e-18
3cyp_B138 Chemotaxis protein MOTB; bacterial flagellar motor, pep 4e-17
2zov_A210 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 7e-15
2k1s_A149 Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha 9e-13
2hqs_H118 Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, t 2e-12
2zvy_A183 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 2e-11
2aiz_P134 Outer membrane protein P6; alpha-beta sandwich; HET: UD 5e-10
3khn_A174 MOTB protein, putative; structural genomics, OMPA-like 4e-09
>2kgw_A Outer membrane protein A; OMPA- like, cell membrane, transmembrane; NMR {Mycobacterium tuberculosis} Length = 129 Back     alignment and structure
 Score =  105 bits (263), Expect = 5e-24
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 1/110 (0%)

Query: 40  LQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKH-DCDFLIEGHADELGSRNSS 98
           LQ   ++  G  + F     S+ PAD ++L+ +   L+   D    I G+ D  GS   +
Sbjct: 14  LQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGIN 73

Query: 99  IALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRR 148
           I L  +RA  V +Y VARG++   +     G   P       +  AKNRR
Sbjct: 74  IPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRR 123


>2zf8_A MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus} Length = 278 Back     alignment and structure
>3ldt_A Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} Length = 169 Back     alignment and structure
>1r1m_A Outer membrane protein class 4; 1.90A {Neisseria meningitidis} SCOP: d.79.7.1 Length = 164 Back     alignment and structure
>3oon_A Outer membrane protein (TPN50); protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; 1.79A {Borrelia burgdorferi} Length = 123 Back     alignment and structure
>3cyp_B Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B* Length = 138 Back     alignment and structure
>2zov_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium} Length = 210 Back     alignment and structure
>2k1s_A Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12} Length = 149 Back     alignment and structure
>2hqs_H Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli} SCOP: d.79.7.1 PDB: 2w8b_C 1oap_A Length = 118 Back     alignment and structure
>2zvy_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A Length = 183 Back     alignment and structure
>2aiz_P Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} SCOP: d.79.7.1 Length = 134 Back     alignment and structure
>3khn_A MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Length = 174 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target160 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
2kgw_A129 Outer membrane protein A; OMPA- like, cell membrane, tr 99.97
3ldt_A169 Outer membrane protein, OMPA family protein; OMPA-like 99.97
2aiz_P134 Outer membrane protein P6; alpha-beta sandwich; HET: UD 99.97
1r1m_A164 Outer membrane protein class 4; 1.90A {Neisseria mening 99.97
2zf8_A278 MOTY, component of sodium-driven polar flagellar motor; 99.96
2k1s_A149 Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha 99.96
2hqs_H118 Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, t 99.96
3khn_A174 MOTB protein, putative; structural genomics, OMPA-like 99.96
3oon_A123 Outer membrane protein (TPN50); protein structure initi 99.95
3cyp_B138 Chemotaxis protein MOTB; bacterial flagellar motor, pep 99.95
2zvy_A183 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 99.94
2zov_A210 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 99.94
>2kgw_A Outer membrane protein A; OMPA- like, cell membrane, transmembrane; NMR {Mycobacterium tuberculosis} Back     alignment and structure
Probab=99.97  E-value=1.5e-31  Score=201.89  Aligned_cols=116  Identities=28%  Similarity=0.461  Sum_probs=107.4

Q ss_pred             HHHHHHHHHHCCEEEEECCCCCCCHHHHHHHHHHHHHHCCC-EEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             12567875203100220475224324799999998430256-05899997226653333200111337999999998528
Q gi|254780547|r   39 SLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKH-DCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARG  117 (160)
Q Consensus        39 ~~~~~~~~~~~~~v~F~~~s~~L~~~~~~~L~~ia~~l~~~-~~~i~I~GhtD~~Gs~~yN~~LS~~RA~aV~~~L~~~G  117 (160)
                      .............|||++||+.|+++++..|+.++.+|+++ +.+|.|+||||+.|+.+||+.||++||.+|++||+.+|
T Consensus        13 ~~~~~~~~~~~~~i~F~~gs~~l~~~~~~~L~~la~~l~~~~~~~i~I~GhtD~~g~~~~n~~LS~~RA~aV~~~L~~~G   92 (129)
T 2kgw_A           13 DLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARG   92 (129)
T ss_dssp             THHHHHHHHHTSCBCCCTTSSCCCHHHHHHHHHHHHHHHTCTTSCEEEEECCCTTSCHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHCHHHHHHHHHHHHHHHHHCC
T ss_conf             04677872037714864997325988999999999999978994799999817988810253799999999999999859


Q ss_pred             CCCEEEEEEEECCCCCCCCCCCHHHHHCCCEEEEEEE
Q ss_conf             9860699997074489899878779842991899997
Q gi|254780547|r  118 ISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLK  154 (160)
Q Consensus       118 i~~~ri~~~g~G~~~P~~~~~~~~~~~~NRRVei~i~  154 (160)
                      |+++||.+.|||+++|++++.++++|++||||||+|.
T Consensus        93 v~~~ri~~~g~G~~~p~~~~~~~~~~~~NRRVei~v~  129 (129)
T 2kgw_A           93 VAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN  129 (129)
T ss_dssp             CCGGGEEEEECTTCSCCSCTTSHHHHHHHSCEEEEEC
T ss_pred             CCHHHEEEEEECCCCCCCCCCCHHHHHHCCCEEEEEC
T ss_conf             9989989999745576799939889985395899979



>3ldt_A Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} Back     alignment and structure
>2aiz_P Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} SCOP: d.79.7.1 Back     alignment and structure
>1r1m_A Outer membrane protein class 4; 1.90A {Neisseria meningitidis} SCOP: d.79.7.1 Back     alignment and structure
>2zf8_A MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus} Back     alignment and structure
>2k1s_A Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12} Back     alignment and structure
>2hqs_H Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli} SCOP: d.79.7.1 PDB: 2w8b_C 1oap_A Back     alignment and structure
>3khn_A MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Back     alignment and structure
>3oon_A Outer membrane protein (TPN50); protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; 1.79A {Borrelia burgdorferi} Back     alignment and structure
>3cyp_B Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B* 3imp_B Back     alignment and structure
>2zvy_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A Back     alignment and structure
>2zov_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 160 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
d1r1ma_140 d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-t 2e-14
d2hqsc1106 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotei 4e-13
d2aizp1134 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein 8e-12
>d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Length = 140 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: OmpA-like
family: OmpA-like
domain: Outer membrane protein class 4, RmpM, C-terminal domain
species: Neisseria meningitidis [TaxId: 487]
 Score = 72.2 bits (176), Expect = 2e-14
 Identities = 31/113 (27%), Positives = 43/113 (38%), Gaps = 1/113 (0%)

Query: 47  SVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKH-DCDFLIEGHADELGSRNSSIALGLRR 105
           S+     F     S+R      L  L   L +       +EGH D +GS   + AL  RR
Sbjct: 9   SLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERR 68

Query: 106 AYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRA 158
           AY V N  V+ G+  SR+     G+    +    E   AK    +   K   A
Sbjct: 69  AYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREA 121


>d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]} Length = 134 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target160 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
d2aizp1134 Peptidoglycan-associated lipoprotein, PAL, periplasmic 99.97
d2hqsc1106 Peptidoglycan-associated lipoprotein, PAL, periplasmic 99.96
d1r1ma_140 Outer membrane protein class 4, RmpM, C-terminal domain 99.96
>d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: OmpA-like
family: OmpA-like
domain: Peptidoglycan-associated lipoprotein, PAL, periplasmic domain
species: Haemophilus influenzae [TaxId: 727]
Probab=99.97  E-value=6.1e-31  Score=197.02  Aligned_cols=104  Identities=40%  Similarity=0.714  Sum_probs=99.6

Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHCCC-EEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEE
Q ss_conf             100220475224324799999998430256-0589999722665333320011133799999999852898606999970
Q gi|254780547|r   50 DSVFFDTSSYSIRPADIQVLSNLGSWLEKH-DCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSY  128 (160)
Q Consensus        50 ~~v~F~~~s~~L~~~~~~~L~~ia~~l~~~-~~~i~I~GhtD~~Gs~~yN~~LS~~RA~aV~~~L~~~Gi~~~ri~~~g~  128 (160)
                      ..|||++||+.|+++++..|+.++.+|+.+ +.+|.|.||||..|+.+||+.||++||++|++||+++||+++||.+.||
T Consensus        30 ~~I~F~~~s~~L~~~~~~~L~~la~~l~~~~~~~i~I~GhtD~~g~~~~N~~LS~~RA~~V~~~L~~~Gi~~~ri~~~g~  109 (134)
T d2aizp1          30 NTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSY  109 (134)
T ss_dssp             CEEECCTTCCCCCHHHHHHHHHHHHHHHHSTTCCEEEEEECCSSSCHHHHHHHHHHHHHHHHHHHHHTTCCGGGEEEEEC
T ss_pred             CEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEC
T ss_conf             81883799812498899999999999986999689996043433221110137899999999899771875345513775


Q ss_pred             CCCCCCCCCCCHHHHHCCCEEEEEE
Q ss_conf             7448989987877984299189999
Q gi|254780547|r  129 GKEMPSVYGHDEDAYAKNRRAIVFL  153 (160)
Q Consensus       129 G~~~P~~~~~~~~~~~~NRRVei~i  153 (160)
                      |+++|+.++.++++|++||||||+.
T Consensus       110 G~~~P~~~~~~~~~~~~NRRVeiv~  134 (134)
T d2aizp1         110 GEEKPAVLGHDEAAYSKNRRAVLAY  134 (134)
T ss_dssp             TTTSCSSCSCSHHHHHHHSEEEEEC
T ss_pred             CCCCCCCCCCCHHHHHCCCCEEEEC
T ss_conf             4337578891977986239899959



>d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 160 OmpA/MotB [Candidatus Liberibacter asiaticus str.
2aiz_P_134 (P:) Outer membrane protein P6; alpha-beta sandwic 2e-17
1r1m_A_164 (A:) Outer membrane protein class 4; 1.90A {Neisse 3e-17
2k1s_A_149 (A:) Inner membrane lipoprotein YIAD; abbababab, O 8e-17
3cyp_B_138 (B:) Chemotaxis protein MOTB; bacterial flagellar 1e-16
3khn_A_174 (A:) MOTB protein, putative; structural genomics, 3e-16
2zf8_A_155-278124 (A:155-278) MOTY, component of sodium-driven polar 4e-16
3ldt_A_169 (A:) Outer membrane protein, OMPA family protein; 5e-16
2hqs_H_118 (H:) Peptidoglycan-associated lipoprotein; TOLB, P 6e-16
2zov_A_210 (A:) Chemotaxis protein MOTB; 2-layer sandwich, ba 9e-16
2zvy_A_183 (A:) Chemotaxis protein MOTB; 2-layer sandwich, ba 2e-15
>2aiz_P (P:) Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae}Length = 134 Back     alignment and structure
 Score = 82.5 bits (203), Expect = 2e-17
 Identities = 42/104 (40%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 47  SVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKH-DCDFLIEGHADELGSRNSSIALGLRR 105
              ++V+F    Y I    +Q+L    ++L        L+EG+ DE G+   +IALG RR
Sbjct: 27  QRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRR 86

Query: 106 AYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRA 149
           A AV  Y   +G+ A ++   SYG+E P+V GHDE AY+KNRRA
Sbjct: 87  ADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRA 130


>1r1m_A (A:) Outer membrane protein class 4; 1.90A {Neisseria meningitidis}Length = 164 Back     alignment and structure
>2k1s_A (A:) Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12}Length = 149 Back     alignment and structure
>3cyp_B (B:) Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B*Length = 138 Back     alignment and structure
>3khn_A (A:) MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str}Length = 174 Back     alignment and structure
>2zf8_A (A:155-278) MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus}Length = 124 Back     alignment and structure
>3ldt_A (A:) Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila}Length = 169 Back     alignment and structure
>2hqs_H (H:) Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli}Length = 118 Back     alignment and structure
>2zov_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium}Length = 210 Back     alignment and structure
>2zvy_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_ALength = 183 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target160 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
2aiz_P_134 Outer membrane protein P6; alpha-beta sandwich; HE 99.97
3ldt_A_169 Outer membrane protein, OMPA family protein; OMPA- 99.96
2k1s_A_149 Inner membrane lipoprotein YIAD; abbababab, OMPA, 99.96
3khn_A_174 MOTB protein, putative; structural genomics, OMPA- 99.96
2hqs_H_118 Peptidoglycan-associated lipoprotein; TOLB, PAL, T 99.96
2zf8_A_155-278124 MOTY, component of sodium-driven polar flagellar m 99.95
1r1m_A_164 Outer membrane protein class 4; 1.90A {Neisseria m 99.95
2zov_A_210 Chemotaxis protein MOTB; 2-layer sandwich, bacteri 99.95
3cyp_B_138 Chemotaxis protein MOTB; bacterial flagellar motor 99.95
2zvy_A_183 Chemotaxis protein MOTB; 2-layer sandwich, bacteri 99.95
>2aiz_P (P:) Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} Back     alignment and structure
Probab=99.97  E-value=5.5e-31  Score=199.54  Aligned_cols=132  Identities=32%  Similarity=0.524  Sum_probs=115.7

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCE-EEEEEEEECCCCCCCCCCCH
Q ss_conf             56666656655444420125678752031002204752243247999999984302560-58999972266533332001
Q gi|254780547|r   22 DNLDTKISSPDTVLNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHD-CDFLIEGHADELGSRNSSIA  100 (160)
Q Consensus        22 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~F~~~s~~L~~~~~~~L~~ia~~l~~~~-~~i~I~GhtD~~Gs~~yN~~  100 (160)
                      ..........................+...|+|++||+.|++++++.|+.++.+|++++ ..|.|+||||..|+.+||+.
T Consensus         2 p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~F~~~s~~l~~~~~~~L~~~a~~l~~~p~~~i~I~Ghtd~~g~~~~N~~   81 (134)
T 2aiz_P            2 SSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIA   81 (134)
T ss_dssp             CCCCCSSSSCSCSCCBTTBCHHHHTTTSCEEECCTTCCCCCHHHHHHHHHHHHHHHHSTTCCEEEEEECCSSSCHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHH
T ss_conf             69888766577776666425999960588088059980049889999999999998699848999731243433210125


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCHHHHHCCCEEEEEE
Q ss_conf             11337999999998528986069999707448989987877984299189999
Q gi|254780547|r  101 LGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFL  153 (160)
Q Consensus       101 LS~~RA~aV~~~L~~~Gi~~~ri~~~g~G~~~P~~~~~~~~~~~~NRRVei~i  153 (160)
                      ||++||.+|++||++.|++++||.+.|||+++|++++++++++++||||||+.
T Consensus        82 LS~~RA~aV~~~l~~~g~~~~ri~~~g~G~~~p~~~~~~~~~~~~NRRVei~~  134 (134)
T 2aiz_P           82 LGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAX  134 (134)
T ss_dssp             HHHHHHHHHHHHHHHTTCCGGGEEEEECTTTSCSSCSCSHHHHHHHSEEEEEC
T ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCHHHHHCCCCEEEEC
T ss_conf             78999999999999708753203457634437788891977875339899959



>3ldt_A (A:) Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} Back     alignment and structure
>2k1s_A (A:) Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12} Back     alignment and structure
>3khn_A (A:) MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Back     alignment and structure
>2hqs_H (H:) Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli} Back     alignment and structure
>2zf8_A (A:155-278) MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus} Back     alignment and structure
>1r1m_A (A:) Outer membrane protein class 4; 1.90A {Neisseria meningitidis} Back     alignment and structure
>2zov_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3cyp_B (B:) Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B* Back     alignment and structure
>2zvy_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A Back     alignment and structure