254780564

254780564

hypothetical protein CLIBASIA_02255

GeneID in NCBI database:8209561Locus tag:CLIBASIA_02255
Protein GI in NCBI database:254780564Protein Accession:YP_003064977.1
Gene range:-(716513, 716836)Protein Length:107aa
Gene description:hypothetical protein
COG prediction:[H] ABC-type thiamine transport system, periplasmic component
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK
cccHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHEEccccccccccccHHHHHHHHHHccccc
cccccEEEEEEccccEEEEEEccccccccccEEEEcHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHcccccc
minassvaifknhhsevsvsytpflpkdignILCSTvggiaesskkkSVATQFLRFLLLPIVQQYIATALgeypiikgiitnrkfndqtytnrESFELIKTAQNPPK
MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTnresfeliktaqnppk
MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK
MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFEL*********
MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGI********VATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELI********
*INASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQ****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK
MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK
MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target107 hypothetical protein CLIBASIA_02255 [Candidatus Liberib
254780183159 single-strand binding protein (ssb) [Candidatus Li 0.019
>gi|254780183|ref|YP_003064596.1| single-strand binding protein (ssb) [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Back     alignment
 Score = 29.3 bits (64), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 58  LLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELI 99
           L  IV+QY+      Y  I+G +  RK+ DQ+  NR + E+I
Sbjct: 64  LCRIVEQYLRKGSKVY--IEGSLQTRKWQDQSGNNRYTTEII 103

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target107 hypothetical protein CLIBASIA_02255 [Candidatus Liberib
312114161331 extracellular solute-binding protein family 1 [Rhodomic 1 2e-11
218296266331 extracellular solute-binding protein family 1 [Thermus 1 3e-08
182441092328 iron ABC transporter, periplasmic iron-binding protein 1 1e-06
260771842332 ferric iron ABC transporter iron-binding protein [Vibri 1 1e-06
320451372331 iron(III)-binding protein [Thermus scotoductus SA-01] L 1 1e-06
46199566330 iron(III)-binding protein [Thermus thermophilus HB27] L 1 9e-06
55981597330 iron ABC transporter periplasmic iron-binding protein [ 1 1e-05
310830323331 ferric iron ABC transporter iron-binding protein [Ketog 1 2e-05
313680521330 extracellular solute-binding protein family 1 [Oceanith 1 0.001
297567102353 family 1 extracellular solute-binding protein [Meiother 1 0.002
>gi|312114161|ref|YP_004011757.1| extracellular solute-binding protein family 1 [Rhodomicrobium vannielii ATCC 17100] Length = 331 Back     alignment and organism information
 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 53/82 (64%)

Query: 1   MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLP 60
           ++N+  +  F    ++V V+ T F   DIGN+L  +  GI E+SK K+ A + L F L P
Sbjct: 212 LVNSYYLTRFVARDAKVPVAQTFFEKGDIGNLLFVSGAGIVETSKNKADAAKLLDFFLSP 271

Query: 61  IVQQYIATALGEYPIIKGIITN 82
            VQQ+ A+A+GEYP+IKG+I N
Sbjct: 272 AVQQHFASAIGEYPVIKGVIPN 293


Species: Rhodomicrobium vannielii
Genus: Rhodomicrobium
Family: Hyphomicrobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218296266|ref|ZP_03497022.1| extracellular solute-binding protein family 1 [Thermus aquaticus Y51MC23] Length = 331 Back     alignment and organism information
>gi|182441092|dbj|BAG24189.1| iron ABC transporter, periplasmic iron-binding protein [Thermus thermophilus] Length = 328 Back     alignment and organism information
>gi|260771842|ref|ZP_05880760.1| ferric iron ABC transporter iron-binding protein [Vibrio metschnikovii CIP 69.14] Length = 332 Back     alignment and organism information
>gi|320451372|ref|YP_004203468.1| iron(III)-binding protein [Thermus scotoductus SA-01] Length = 331 Back     alignment and organism information
>gi|46199566|ref|YP_005233.1| iron(III)-binding protein [Thermus thermophilus HB27] Length = 330 Back     alignment and organism information
>gi|55981597|ref|YP_144894.1| iron ABC transporter periplasmic iron-binding protein [Thermus thermophilus HB8] Length = 330 Back     alignment and organism information
>gi|310830323|ref|YP_003965423.1| ferric iron ABC transporter iron-binding protein [Ketogulonicigenium vulgare Y25] Length = 331 Back     alignment and organism information
>gi|313680521|ref|YP_004058260.1| extracellular solute-binding protein family 1 [Oceanithermus profundus DSM 14977] Length = 330 Back     alignment and organism information
>gi|297567102|ref|YP_003686074.1| family 1 extracellular solute-binding protein [Meiothermus silvanus DSM 9946] Length = 353 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target107 hypothetical protein CLIBASIA_02255 [Candidatus Liberib
PRK11205330 PRK11205, tbpA, thiamine transporter substrate binding 0.001
TIGR01254304 TIGR01254, sfuA, ABC transporter periplasmic binding pr 0.002
COG4143336 COG4143, TbpA, ABC-type thiamine transport system, peri 0.001
>gnl|CDD|183039 PRK11205, tbpA, thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130321 TIGR01254, sfuA, ABC transporter periplasmic binding protein, thiB subfamily Back     alignment and domain information
>gnl|CDD|33896 COG4143, TbpA, ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 107 hypothetical protein CLIBASIA_02255 [Candidatus Liberib
PRK11205326 tbpA thiamine transporter substrate binding subunit; Pr 99.77
TIGR03227367 PhnS 2-aminoethylphosphonate ABC transporter, periplasm 99.6
COG4143336 TbpA ABC-type thiamine transport system, periplasmic co 99.57
TIGR01254324 sfuA ABC transporter periplasmic binding protein, thiB 99.52
TIGR01276326 thiB thiamin/thiamin pyrophosphate ABC transporter, thi 98.91
COG1653433 UgpB ABC-type sugar transport system, periplasmic compo 97.94
PRK10974439 glycerol-3-phosphate transporter periplasmic binding pr 97.51
PRK11622401 putative ABC transporter solute-binding protein; Provis 97.39
COG2182420 MalE Maltose-binding periplasmic proteins/domains [Carb 97.3
PRK10752329 sulfate transporter subunit; Provisional 96.38
PRK10852338 thiosulfate transporter subunit; Provisional 96.21
TIGR00971320 3a0106s03 sulfate ABC transporter, sulfate-binding prot 90.23
TIGR03261334 phnS2 putative 2-aminoethylphosphonate ABC transport sy 99.7
COG1840299 AfuA ABC-type Fe3+ transport system, periplasmic compon 99.54
COG1613348 Sbp ABC-type sulfate transport system, periplasmic comp 95.69
PRK09501348 potD spermidine/putrescine ABC transporter periplasmic 98.74
PRK10682370 putrescine transporter subunit: periplasmic-binding com 98.42
pfam01547260 SBP_bac_1 Bacterial extracellular solute-binding protei 98.33
COG0687363 PotD Spermidine/putrescine-binding periplasmic protein 98.2
PRK09474394 malE maltose ABC transporter periplasmic protein; Revie 97.83
PRK03537188 hypothetical protein; Provisional 97.21
COG4134384 ABC-type uncharacterized transport system, periplasmic 96.5
COG2998280 TupB ABC-type tungstate transport system, permease comp 95.15
PRK04168336 hypothetical protein; Provisional 97.98
COG0725258 ModA ABC-type molybdate transport system, periplasmic c 97.38
PRK10677257 modA molybdate transporter periplasmic protein; Provisi 96.9
TIGR01256225 modA molybdate ABC transporter, periplasmic molybdate-b 96.82
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily; InterPro: IPR005948 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>TIGR01276 thiB thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin pyrophospate-binding protein; InterPro: IPR005967 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional Back     alignment and domain information
>PRK11622 putative ABC transporter solute-binding protein; Provisional Back     alignment and domain information
>COG2182 MalE Maltose-binding periplasmic proteins/domains [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10752 sulfate transporter subunit; Provisional Back     alignment and domain information
>PRK10852 thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR00971 3a0106s03 sulfate ABC transporter, sulfate-binding protein; InterPro: IPR005669 Thiosulphate-binding proteins (gene cysP) specifically binds thiosulphate and are involved in the transport systems for this nutrients , Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transport system, 1-aminoethylphosphonate-binding protein component Back     alignment and domain information
>COG1840 AfuA ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1613 Sbp ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>pfam01547 SBP_bac_1 Bacterial extracellular solute-binding protein Back     alignment and domain information
>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK03537 hypothetical protein; Provisional Back     alignment and domain information
>COG4134 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>COG2998 TupB ABC-type tungstate transport system, permease component [Coenzyme metabolism] Back     alignment and domain information
>PRK04168 hypothetical protein; Provisional Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>TIGR01256 modA molybdate ABC transporter, periplasmic molybdate-binding protein; InterPro: IPR005950 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target107 hypothetical protein CLIBASIA_02255 [Candidatus Liberib
1y4t_A322 Ferric Binding Protein From Campylobacter Jejuni Le 9e-22
2voz_A346 Apo Futa2 From Synechocystis Pcc6803 Length = 346 2e-21
2pt1_A334 Futa1 Synechocystis Pcc 6803 Length = 334 3e-20
1y9u_A323 Bordetella Ferric Binding Protein Length = 323 1e-19
1q35_A320 Crystal Structure Of Pasteurella Haemolytica Apo Fe 6e-19
1d9y_A309 Neisseria Gonorrhoeae Ferric Binding Protein Length 5e-11
1r1n_A309 Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding 7e-11
1o7t_A309 Metal Nanoclusters Bound To The Ferric Binding Prot 7e-11
1qw0_A309 Crystal Structure Of Haemophilus Influenzae N175l M 7e-11
2o68_A309 Crystal Structure Of Haemophilus Influenzae Q58l Mu 8e-11
1d9v_A309 Haemophilus Influenzae Ferric-Binding Protein Apo F 9e-11
2o6a_A309 Crystal Structure Of The Haemophilus Influenzae E57 1e-10
1nnf_A309 Crystal Structure Analysis Of Haemophlius Influenza 1e-10
1qvs_A309 Crystal Structure Of Haemophilus Influenzae H9a Mut 1e-10
1xvy_A309 Crystal Structure Of Iron-Free Serratia Marcescens 2e-10
1xvx_A312 Crystal Structure Of Iron-Loaded Yersinia Enterocol 3e-10
3kn7_A309 Crystal Structure Of Haemophilus Influenzae Y195a M 9e-10
3kn8_A309 Crystal Structure Of Haemophilus Influenzae Y196a M 1e-09
2o69_A309 Crystal Structure Of Haemophilus Influenzae N193l M 1e-09
2qry_A330 Periplasmic Thiamin Binding Protein Length = 330 5e-06
>gi|60594117|pdb|1Y4T|A Chain A, Ferric Binding Protein From Campylobacter Jejuni Length = 322 Back     alignment and structure
 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 48/113 (42%), Gaps = 6/113 (5%)

Query: 1   MINASSVAIFKNH----HSEVSVSYTPFLPKD--IGNILCSTVGGIAESSKKKSVATQFL 54
           ++N   + + KN       EV  S     P     G  +  +   + +SSK +  A +F+
Sbjct: 195 VMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTHINISGIAMTKSSKNQDAAKKFM 254

Query: 55  RFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK 107
            F+L P +Q+ +  +  E+PI   +  ++   D      +   + K A+N  +
Sbjct: 255 EFMLSPEIQKILTDSNYEFPIRNDVELSQTVKDFGTFKEDQIPVSKIAENIKE 307


gi|170785082|pdb|2VOZ|A Chain A, Apo Futa2 From Synechocystis Pcc6803 Length = 346 Back     alignment and structure
>gi|152149368|pdb|2PT1|A Chain A, Futa1 Synechocystis Pcc 6803 Length = 334 Back     alignment and structure
>gi|60594186|pdb|1Y9U|A Chain A, Bordetella Ferric Binding Protein Length = 323 Back     alignment and structure
>gi|39654597|pdb|1Q35|A Chain A, Crystal Structure Of Pasteurella Haemolytica Apo Ferric Ion- Binding Protein A Length = 320 Back     alignment and structure
>gi|6573535|pdb|1D9Y|A Chain A, Neisseria Gonorrhoeae Ferric Binding Protein Length = 309 Back     alignment and structure
>gi|47168691|pdb|1R1N|A Chain A, Tri-Nuclear Oxo-Iron Clusters In The Ferric Binding Protein From N. Gonorrhoeae Length = 309 Back     alignment and structure
>gi|28948312|pdb|1O7T|A Chain A, Metal Nanoclusters Bound To The Ferric Binding Protein From Neisseria Gonorrhoeae. Length = 309 Back     alignment and structure
>gi|38492941|pdb|1QW0|A Chain A, Crystal Structure Of Haemophilus Influenzae N175l Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|145579973|pdb|2O68|A Chain A, Crystal Structure Of Haemophilus Influenzae Q58l Mutant Fbpa Length = 309 Back     alignment and structure
>gi|6573533|pdb|1D9V|A Chain A, Haemophilus Influenzae Ferric-Binding Protein Apo Form Length = 309 Back     alignment and structure
>gi|145579975|pdb|2O6A|A Chain A, Crystal Structure Of The Haemophilus Influenzae E57a Mutant Fbpa Length = 309 Back     alignment and structure
>gi|29726721|pdb|1NNF|A Chain A, Crystal Structure Analysis Of Haemophlius Influenzae Ferric- Ion Binding Protein H9q Mutant Form Length = 309 Back     alignment and structure
>gi|38492940|pdb|1QVS|A Chain A, Crystal Structure Of Haemophilus Influenzae H9a Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|61679631|pdb|1XVY|A Chain A, Crystal Structure Of Iron-Free Serratia Marcescens Sfua Length = 309 Back     alignment and structure
>gi|61679630|pdb|1XVX|A Chain A, Crystal Structure Of Iron-Loaded Yersinia Enterocolitica Yfua Length = 312 Back     alignment and structure
>gi|306991648|pdb|3KN7|A Chain A, Crystal Structure Of Haemophilus Influenzae Y195a Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|306991649|pdb|3KN8|A Chain A, Crystal Structure Of Haemophilus Influenzae Y196a Mutant Holo Ferric Ion-Binding Protein A Length = 309 Back     alignment and structure
>gi|145579974|pdb|2O69|A Chain A, Crystal Structure Of Haemophilus Influenzae N193l Mutant Fbpa Length = 309 Back     alignment and structure
>gi|167013282|pdb|2QRY|A Chain A, Periplasmic Thiamin Binding Protein Length = 330 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target107 hypothetical protein CLIBASIA_02255 [Candidatus Liberib
2voz_A346 FUTA2, periplasmic iron-binding protein; ferric binding 7e-06
2pt1_A334 Iron transport protein; C-clamp, iron-binding protein, 1e-05
3e13_X322 Putative iron-uptake ABC transport system, periplasmic 4e-05
2qry_A330 Thiamine-binding periplasmic protein; thiamin binding p 1e-04
1elj_A381 Maltodextrin-binding protein; protein-carbohydrate comp 2e-04
3c9h_A355 ABC transporter, substrate binding protein; structural 3e-04
1q35_A320 Iron binding protein FBPA; metal binding protein; 1.20A 5e-04
1nnf_A309 Iron-utilization periplasmic protein; iron-binding prot 6e-04
1y9u_A323 Putative iron binding protein; periplasmic binding prot 6e-04
1xvx_A312 YFUA; periplasmic iron binding protein; 1.53A {Yersinia 0.002
>2voz_A FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A* Length = 346 Back     alignment and structure
 Score = 44.0 bits (102), Expect = 7e-06
 Identities = 18/107 (16%), Positives = 40/107 (37%)

Query: 1   MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLP 60
            +  S+    +    +VS+ +      + G  +  +  G+ +++  +  A  FL +L   
Sbjct: 229 RLQKSTDPADQEVVEKVSLFFPNTGSGERGTHVNVSGAGVLKNAPNRDAAIAFLEYLASD 288

Query: 61  IVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK 107
             Q+Y A    EYP+I G+  +           +   +    +  P 
Sbjct: 289 DAQRYFAEGNNEYPVIPGVPIDPVLAAHGQLKGDPLNVSNLGRYQPD 335


>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, periplasmic binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Length = 334 Back     alignment and structure
>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} PDB: 1y4t_A Length = 322 Back     alignment and structure
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Length = 330 Back     alignment and structure
>1elj_A Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus} SCOP: c.94.1.1 Length = 381 Back     alignment and structure
>3c9h_A ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Length = 355 Back     alignment and structure
>1q35_A Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} SCOP: c.94.1.1 PDB: 1si0_A 1si1_A Length = 320 Back     alignment and structure
>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 1qvs_A 2o6a_A 2o68_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A Length = 309 Back     alignment and structure
>1y9u_A Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} SCOP: c.94.1.1 PDB: 2ows_A 2owt_A Length = 323 Back     alignment and structure
>1xvx_A YFUA; periplasmic iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A* Length = 312 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target107 hypothetical protein CLIBASIA_02255 [Candidatus Liberib
2voz_A346 FUTA2, periplasmic iron-binding protein; ferric binding 99.73
1q35_A320 Iron binding protein FBPA; metal binding protein; 1.20A 99.73
1y9u_A323 Putative iron binding protein; periplasmic binding prot 99.69
3e13_X322 Putative iron-uptake ABC transport system, periplasmic 99.68
1xvx_A312 YFUA; periplasmic iron binding protein; 1.53A {Yersinia 99.64
1nnf_A309 Iron-utilization periplasmic protein; iron-binding prot 99.62
2pt1_A334 Iron transport protein; C-clamp, iron-binding protein, 99.61
2qry_A330 Thiamine-binding periplasmic protein; thiamin binding p 99.42
3c9h_A355 ABC transporter, substrate binding protein; structural 99.05
3k6v_A354 Solute-binding protein MA_0280; MODA, molybdate, peripl 98.73
3k01_A412 Acarbose/maltose binding protein GACH; ABC transporter, 98.73
1urs_A402 Maltose-binding protein; maltodextrin-binding protein, 98.7
2b3f_A400 Glucose-binding protein; protein-carbohydrate complex, 98.57
2heu_A401 Sugar ABC transporter, sugar-binding protein; periplasm 98.55
2zyo_A397 Solute-binding protein; open form, sugar binding protei 98.54
2xd3_A416 MALX, maltose/maltodextrin-binding protein; solute-bind 98.46
1eu8_A409 Trehalose/maltose binding protein; protein-carbohydrate 98.3
1elj_A381 Maltodextrin-binding protein; protein-carbohydrate comp 98.16
2w7y_A430 FCSSBP, probable sugar ABC transporter, sugar-binding p 97.83
1pot_A325 POTD, spermidine/putrescine-binding protein; polyamine 99.13
3lr1_A236 Tungstate ABC transporter, periplasmic tungstate- bindi 99.03
2v84_A343 Spermidine/putrescine ABC transporter, periplasmic bind 98.99
1atg_A231 MODA, periplasmic molybdate-binding protein; tungstate, 98.97
3cg1_A296 UPF0100 protein PF0080; ABC transporter, binding protei 98.93
1a99_A344 POTF, putrescine-binding protein; transport, periplasmi 98.86
3gzg_A253 Molybdate-binding periplasmic protein; permease; molybd 98.82
3kn3_A242 Putative periplasmic protein; alpha-beta structure, per 98.8
1sbp_A310 Sulfate-binding protein; 1.70A {Salmonella typhimurium} 98.78
3cfx_A296 UPF0100 protein MA_0280; ABC transporter, binding prote 98.72
3cij_A295 UPF0100 protein AF_0094; archaeal periplasmic binding p 98.69
3muq_A237 Uncharacterized conserved protein; structural genomics, 98.67
2gh9_A386 Maltose/maltodextrin-binding protein; MBP, maltose bind 98.6
3thi_A371 Protein (thiaminase I); thiamin degradation, transferas 98.53
1amf_A233 Molybdate transport protein MODA; periplasmic, binding 98.52
3f5f_A 658 Maltose-binding periplasmic protein, heparan sulfate 2- 98.48
3cvg_A294 Putative metal binding protein; PSI-II, NYSGXRC, peripl 98.27
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 cata 98.19
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MATA1, 98.09
1y4c_A 494 Maltose binding protein fused with designed helical pro 98.09
1r6z_P 509 Chimera of maltose-binding periplasmic protein and argo 98.08
3o3u_N 581 Maltose-binding periplasmic protein, advanced Gly END p 98.02
2vgq_A 477 Maltose-binding periplasmic protein, mitochondrial anti 98.0
3h3g_A 539 Fusion protein of maltose-binding periplasmic domain an 97.99
3iot_A 449 Maltose-binding protein, huntingtin fusion protein; HTT 97.99
2gha_A382 Maltose ABC transporter, periplasmic maltose- binding p 97.96
1hsj_A 487 Fusion protein consisting of staphylococcus accessary r 97.93
3mq9_A 471 Bone marrow stromal antigen 2 fused to maltose-BI perip 97.91
2zxt_A 465 Maltose-binding periplasmic protein, linker, mitochondr 97.89
3kjt_A372 Maltose-binding periplasmic protein; alternate conforma 97.86
3h4z_A 568 Maltose-binding periplasmic protein fused with Al DERP7 97.8
3csg_A 461 MBP, maltose-binding protein monobody YS1 fusion, MMBP; 97.78
3cfz_A292 UPF0100 protein MJ1186; ABC transporter, binding protei 97.64
3dm0_A 694 Maltose-binding periplasmic protein fused with RACK1; M 97.47
2uvj_A408 TOGB, ABC type periplasmic sugar-binding protein; perip 97.35
2z8f_A412 Galacto-N-biose/lacto-N-biose I transporter substrate-b 96.97
2hxw_A237 Major antigenic peptide PEB3; periplasmic binding prote 98.27
1j1n_A 492 ALGQ2; alginate, suger binding protein; HET: BEM MAV LG 97.32
3omb_A 535 Extracellular solute-binding protein, family 1; PSI-2, 97.3
3i3v_A405 Probable secreted solute-binding lipoprotein; transport 97.15
1twy_A290 ABC transporter, periplasmic substrate-binding protein; 96.52
>2voz_A FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A* Back     alignment and structure
Probab=99.73  E-value=4.1e-18  Score=117.37  Aligned_cols=82  Identities=18%  Similarity=0.353  Sum_probs=77.2

Q ss_pred             CCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHC
Q ss_conf             89985106865412163169988999999999839999999974002100106876742101255447256586578630
Q gi|254780564|r   25 LPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQN  104 (107)
Q Consensus        25 ~~~D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~~~~~~~~~~~d~~~l~~~a~n  104 (107)
                      .|++ |+++.+.+.+|+|+++|+++|++||+||+|+|+|+.+++.+++|||+++|+.++.++++..|+++.+|+..++++
T Consensus       254 ~p~e-G~~~~~~~~~i~k~a~n~e~A~~Fi~fllspe~Q~~~a~~~~~~Pv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  332 (346)
T 2voz_A          254 SGER-GTHVNVSGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNEYPVIPGVPIDPVLAAHGQLKGDPLNVSNLGRY  332 (346)
T ss_dssp             TTSC-CBCEEEEEEEEBTTCTTHHHHHHHHHHHTSHHHHHHHHHHTTCEESSTTSCCCHHHHTTCCCCBCCSCTHHHHHT
T ss_pred             CCCC-CCEEEEEEEECCCCCCCHHHHHHHHHHHCCHHHHHHHHHHCCEEECCCCCCCCHHHCCCCCCCCCCCCHHHHHHC
T ss_conf             4788-846988743302699998999999999769999999997274531789999980016733268787899999753


Q ss_pred             CCC
Q ss_conf             789
Q gi|254780564|r  105 PPK  107 (107)
Q Consensus       105 ~pk  107 (107)
                      +++
T Consensus       333 ~~~  335 (346)
T 2voz_A          333 QPD  335 (346)
T ss_dssp             HHH
T ss_pred             CHH
T ss_conf             299



>1q35_A Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} SCOP: c.94.1.1 PDB: 1si0_A 1si1_A Back     alignment and structure
>1y9u_A Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} SCOP: c.94.1.1 PDB: 2ows_A 2owt_A Back     alignment and structure
>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} PDB: 1y4t_A Back     alignment and structure
>1xvx_A YFUA; periplasmic iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A* Back     alignment and structure
>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 1qvs_A 2o6a_A 2o68_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A Back     alignment and structure
>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, periplasmic binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Back     alignment and structure
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Back     alignment and structure
>3c9h_A ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k6v_A Solute-binding protein MA_0280; MODA, molybdate, periplasmic binding protein, ABC transporter, transport protein, ligand; HET: CIT; 1.69A {Methanosarcina acetivorans} PDB: 3k6u_A* 3k6w_A 3k6x_A Back     alignment and structure
>3k01_A Acarbose/maltose binding protein GACH; ABC transporter, acarbose-binding protein, transport protein; 1.35A {Streptomyces glaucescens} PDB: 3jzj_A* 3k00_A* 3k02_A* Back     alignment and structure
>1urs_A Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius} SCOP: c.94.1.1 PDB: 1urg_A* 1urd_A* Back     alignment and structure
>2b3f_A Glucose-binding protein; protein-carbohydrate complex, periplasmic binding protein, galactose, GBP, sugar binding protein; HET: GAL; 1.56A {Thermus thermophilus HB27} PDB: 2b3b_A* Back     alignment and structure
>2heu_A Sugar ABC transporter, sugar-binding protein; periplasmic binding protein, transport protein; 1.04A {Streptococcus pneumoniae} PDB: 2hq0_A 2i58_A* 2hfb_A Back     alignment and structure
>2zyo_A Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A* Back     alignment and structure
>2xd3_A MALX, maltose/maltodextrin-binding protein; solute-binding protein, sugar binding protein, virulence, alpha-glucan, sugar transport; HET: GLC; 2.00A {Streptococcus pneumoniae} PDB: 2xd2_A* Back     alignment and structure
>1eu8_A Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} SCOP: c.94.1.1 Back     alignment and structure
>1elj_A Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus} SCOP: c.94.1.1 Back     alignment and structure
>2w7y_A FCSSBP, probable sugar ABC transporter, sugar-binding protein; solute-binding protein, blood group antigen, carbohydrate transport; HET: A2G GAL FUC; 2.35A {Streptococcus pneumoniae} Back     alignment and structure
>1pot_A POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} SCOP: c.94.1.1 PDB: 1poy_1* Back     alignment and structure
>3lr1_A Tungstate ABC transporter, periplasmic tungstate- binding protein; the tungstate ABC transporter, structural genomics, PSI, MCSG; 1.80A {Geobacter sulfurreducens} Back     alignment and structure
>2v84_A Spermidine/putrescine ABC transporter, periplasmic binding protein; polyamine binding, syphilis, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum} Back     alignment and structure
>1atg_A MODA, periplasmic molybdate-binding protein; tungstate, ABC transporter; 1.20A {Azotobacter vinelandii} SCOP: c.94.1.1 Back     alignment and structure
>3cg1_A UPF0100 protein PF0080; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Pyrococcus furiosus} PDB: 3cg3_A Back     alignment and structure
>1a99_A POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} SCOP: c.94.1.1 Back     alignment and structure
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A Back     alignment and structure
>3kn3_A Putative periplasmic protein; alpha-beta structure, periplasmic binding protein fold, structural genomics, PSI-2; HET: GTT CIT; 2.41A {Wolinella succinogenes} Back     alignment and structure
>1sbp_A Sulfate-binding protein; 1.70A {Salmonella typhimurium} SCOP: c.94.1.1 Back     alignment and structure
>3cfx_A UPF0100 protein MA_0280; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Methanosarcina acetivorans} Back     alignment and structure
>3cij_A UPF0100 protein AF_0094; archaeal periplasmic binding protein, unknown function, metal binding protein, transport protein; 1.07A {Archaeoglobus fulgidus} PDB: 2ons_A 2onk_E 2onr_A Back     alignment and structure
>3muq_A Uncharacterized conserved protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.05A {Vibrio parahaemolyticus} Back     alignment and structure
>2gh9_A Maltose/maltodextrin-binding protein; MBP, maltose binding protein, thermophilic protein, periplasmic binding protein; HET: MLR; 1.95A {Thermus thermophilus HB27} Back     alignment and structure
>3thi_A Protein (thiaminase I); thiamin degradation, transferase; 2.00A {Bacillus subtilis} SCOP: c.94.1.1 PDB: 2thi_A 4thi_A Back     alignment and structure
>1amf_A Molybdate transport protein MODA; periplasmic, binding protein; 1.75A {Escherichia coli} SCOP: c.94.1.1 PDB: 1wod_A Back     alignment and structure
>3f5f_A Maltose-binding periplasmic protein, heparan sulfate 2-O-sulfotransferase 1; maltose binding protein, fusion, heparan sulfate biosynthesis; HET: GLC A3P; 2.65A {Escherichia coli k-12} Back     alignment and structure
>3cvg_A Putative metal binding protein; PSI-II, NYSGXRC, periplasmic, structural genomics, protein structure initiative; 1.97A {Coccidioides immitis RS} Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1y4c_A Maltose binding protein fused with designed helical protein; de novo designed helical protein, maltose binding protein fusion, de novo protein; HET: GLC; 1.90A {Escherichia coli} Back     alignment and structure
>1r6z_P Chimera of maltose-binding periplasmic protein and argonaute 2; deviant OB fold, RNAI, gene regulation; HET: MAL; 2.80A {Escherichia coli} SCOP: b.34.14.1 c.94.1.1 PDB: 1t2r_A 1t2s_A Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3cjj_A 2e5e_A Back     alignment and structure
>2vgq_A Maltose-binding periplasmic protein, mitochondrial antiviral-signaling protein; immune system/transport, IPS1/MAVS/VISA/cardif; HET: MTT; 2.1A {Escherichia coli} Back     alignment and structure
>3h3g_A Fusion protein of maltose-binding periplasmic domain and human parathyroid hormone...; GPCR, extracellular domain, PTHRP, PTH, PThr1, periplasm, sugar transport, transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* 3ehs_A* 3ehu_A* 3eht_A* Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protein; HTT-EX1, HD, sugar transport, transport, apoptosis, cytoplasm, disease mutation; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>2gha_A Maltose ABC transporter, periplasmic maltose- binding protein; periplasmic binding protein, MBP, maltotriose, sugar binding protein; HET: MLR; 1.60A {Thermotoga maritima MSB8} PDB: 2ghb_A 2fnc_A* Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2zxt_A Maltose-binding periplasmic protein, linker, mitochondrial intermembrane space import...; disulfide bond, alpha helix, fusion, sugar transport; HET: MAL; 3.00A {Escherichia coli} Back     alignment and structure
>3kjt_A Maltose-binding periplasmic protein; alternate conformation, sugar transport, transpor transport protein; 1.50A {Escherichia coli k-12} PDB: 3hpi_A 1anf_A* 1dmb_A* 1ez9_A* 1jw4_A 1jw5_A* 1lls_A 1omp_A 2d21_A 2r6g_E* 3mbp_A* 4mbp_A* 1fqa_A* 1fqb_A* 1fqc_A* 1fqd_A* 1ezo_A 1ezp_A 2h25_A 2klf_A ... Back     alignment and structure
>3h4z_A Maltose-binding periplasmic protein fused with Al DERP7; MBP fusion, AHA1/BPI domain-like, super roll, sugar T transport, allergen; HET: GLC; 2.35A {Escherichia coli} PDB: 1mg1_A* Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* 3g7v_A* Back     alignment and structure
>3cfz_A UPF0100 protein MJ1186; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2uvj_A TOGB, ABC type periplasmic sugar-binding protein; periplasmic binding protein, pectin degradation, trigalacturonic acid; HET: ADA; 1.8A {Yersinia enterocolitica} PDB: 2uvi_A* 2uvh_A* 2uvg_A Back     alignment and structure
>2z8f_A Galacto-N-biose/lacto-N-biose I transporter substrate-binding protein; ABC transporter, mucin core-1, human MILK oligosacchalide; HET: BGC GAL NAG MES; 1.65A {Bifidobacterium longum} PDB: 2z8e_A* 2z8d_A* Back     alignment and structure
>2hxw_A Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A* Back     alignment and structure
>1j1n_A ALGQ2; alginate, suger binding protein; HET: BEM MAV LGU; 1.60A {Sphingomonas SP} SCOP: c.94.1.1 PDB: 1kwh_A 1y3n_A* 1y3p_A* 1y3q_A Back     alignment and structure
>3omb_A Extracellular solute-binding protein, family 1; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG; 2.10A {Bifidobacterium longum subsp} Back     alignment and structure
>3i3v_A Probable secreted solute-binding lipoprotein; transporter, PSI-II, structural genomics, protein structure initiative; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>1twy_A ABC transporter, periplasmic substrate-binding protein; nysgxrc target, structural genomics, protein structure initiative; 1.65A {Vibrio cholerae o1 biovar eltor str} SCOP: c.94.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 107 hypothetical protein CLIBASIA_02255 [Candidatus Liberib
d1y4ta_317 c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacte 2e-05
d1y9ua_318 c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella p 3e-05
d1xvxa_311 c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia ent 2e-04
d1q35a_318 c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia h 8e-04
d2onsa1311 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Ar 0.002
>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]} Length = 317 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Ferric-binding protein FbpA
species: Campylobacter jejuni [TaxId: 197]
 Score = 41.3 bits (95), Expect = 2e-05
 Identities = 15/69 (21%), Positives = 32/69 (46%)

Query: 11  KNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATAL 70
           K+     S+        + G  +  +   + +SSK +  A +F+ F+L P +Q+ +  + 
Sbjct: 210 KDVEVGNSLGIIFPNQDNRGTHINISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSN 269

Query: 71  GEYPIIKGI 79
            E+PI   +
Sbjct: 270 YEFPIRNDV 278


>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]} Length = 318 Back     information, alignment and structure
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Length = 311 Back     information, alignment and structure
>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} Length = 318 Back     information, alignment and structure
>d2onsa1 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target107 hypothetical protein CLIBASIA_02255 [Candidatus Liberib
d1q35a_318 Ferric-binding protein FbpA {Mannheimia haemolytica [Ta 99.73
d1y9ua_318 Ferric-binding protein FbpA {Bordetella pertussis [TaxI 99.69
d1y4ta_317 Ferric-binding protein FbpA {Campylobacter jejuni [TaxI 99.68
d1xvxa_311 Ferric-binding protein FbpA {Yersinia enterocolitica, Y 99.65
d1nnfa_308 Ferric-binding protein FbpA {Haemophilus influenzae [Ta 99.61
d1sbpa_309 Sulphate-binding protein {Salmonella typhimurium [TaxId 98.87
d1a99a_341 Putrescine receptor (PotF) {Escherichia coli [TaxId: 56 98.84
d2onsa1311 Molybdate-binding protein, ModA {Archaeoglobus fulgidus 98.77
d1ursa_367 D-maltodextrin-binding protein, MBP {Alicyclobacillus a 98.6
d1eu8a_407 D-maltodextrin-binding protein, MBP {Archaeon Thermococ 98.27
d1elja_380 D-maltodextrin-binding protein, MBP {Archaeon Pyrococcu 98.24
d1pota_322 Spermidine/putrescine-binding protein PotD {Escherichia 99.1
d1atga_231 Molybdate-binding protein, ModA {Azotobacter vinelandii 98.95
d1amfa_231 Molybdate-binding protein, ModA {Escherichia coli [TaxI 98.68
d3thia_362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 492 98.49
d1laxa_369 D-maltodextrin-binding protein, MBP {Escherichia coli [ 97.76
d1j1na_ 492 Alginate-binding periplasmic protein AlgQ2 {Sphingomona 97.66
d1twya_249 ABC transporter, periplasmic substrate-binding protein 96.23
>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Ferric-binding protein FbpA
species: Mannheimia haemolytica [TaxId: 75985]
Probab=99.73  E-value=2.7e-18  Score=117.09  Aligned_cols=81  Identities=21%  Similarity=0.176  Sum_probs=76.7

Q ss_pred             CCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHCC
Q ss_conf             99851068654121631699889999999998399999999740021001068767421012554472565865786307
Q gi|254780564|r   26 PKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNP  105 (107)
Q Consensus        26 ~~D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~~~~~~~~~~~d~~~l~~~a~n~  105 (107)
                      ....|+++.+.++||+|+++|+++|++||+||+|+|+|+.+++.+++|||+++|.+++.+++|+.++++.+++..+++++
T Consensus       222 ~~~~G~~~~~~~~~i~k~a~~~~~A~~fi~fllspe~Q~~~a~~~~~~Pv~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~  301 (318)
T d1q35a_         222 SGEHGTHKNISGVVIAKHSPNKANAVKLIEYLSGEKAQGLYAELNHEYPVKEGIEPSAIVKGWGTFKSDTIKLEDIAKNY  301 (318)
T ss_dssp             CSTTCBEEEEEEEEEBTTCTTHHHHHHHHHHHHSHHHHHHHHHHHCCEESSTTCCCCHHHHHTCCCCBCCCCHHHHHTTH
T ss_pred             CCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHCCHHHHHHHHHHCCEECCCCCCCCCHHHCCCCCCCCCCCCHHHHHHHH
T ss_conf             34565312110378978999879999999997499999999851643117889998922346554687778899998636


Q ss_pred             C
Q ss_conf             8
Q gi|254780564|r  106 P  106 (107)
Q Consensus       106 p  106 (107)
                      +
T Consensus       302 ~  302 (318)
T d1q35a_         302 E  302 (318)
T ss_dssp             H
T ss_pred             H
T ss_conf             9



>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]} Back     information, alignment and structure
>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Back     information, alignment and structure
>d1nnfa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onsa1 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure
>d1laxa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j1na_ c.94.1.1 (A:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]} Back     information, alignment and structure
>d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 107 hypothetical protein CLIBASIA_02255 [Candidatus Li
2voz_A_346 (A:) FUTA2, periplasmic iron-binding protein; ferr 1e-06
2pt1_A_334 (A:) Iron transport protein; C-clamp, iron-binding 2e-06
1y9u_A_323 (A:) Putative iron binding protein; periplasmic bi 3e-06
3e13_X_322 (X:) Putative iron-uptake ABC transport system, pe 5e-06
3thi_A_371 (A:) Protein (thiaminase I); thiamin degradation; 1e-05
3c9h_A_355 (A:) ABC transporter, substrate binding protein; s 2e-05
1q35_A_320 (A:) Iron binding protein FBPA; metal binding prot 3e-05
1elj_A_1-163_221-338281 (A:1-163,A:221-338) Maltodextrin-binding protein; 5e-05
1nnf_A_309 (A:) Iron-utilization periplasmic protein; iron-bi 5e-05
3k01_A_1-142_290-369222 (A:1-142,A:290-369) Acarbose/maltose binding prote 1e-04
1eu8_A_1-174_231-358302 (A:1-174,A:231-358) Trehalose/maltose binding prot 3e-04
2heu_A_401 (A:) Sugar ABC transporter, sugar-binding protein; 0.001
2qry_A_1-128_240-318207 (A:1-128,A:240-318) Thiamine-binding periplasmic p 0.001
3cvg_A_294 (A:) Putative metal binding protein; PSI-II, NYSGX 0.002
1xvx_A_312 (A:) YFUA; periplasmic iron binding protein; 1.53A 0.003
2zyo_A_1-129_272-355213 (A:1-129,A:272-355) Solute-binding protein; open f 4e-04
1urs_A_1-143_279-355220 (A:1-143,A:279-355) Maltose-binding protein; malto 6e-04
2b3f_A_1-121_269-349202 (A:1-121,A:269-349) Glucose-binding protein; prote 0.001
>2voz_A (A:) FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A*Length = 346 Back     alignment and structure
 Score = 46.4 bits (108), Expect = 1e-06
 Identities = 18/107 (16%), Positives = 40/107 (37%)

Query: 1   MINASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLP 60
            +  S+    +    +VS+ +      + G  +  +  G+ +++  +  A  FL +L   
Sbjct: 229 RLQKSTDPADQEVVEKVSLFFPNTGSGERGTHVNVSGAGVLKNAPNRDAAIAFLEYLASD 288

Query: 61  IVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNPPK 107
             Q+Y A    EYP+I G+  +           +   +    +  P 
Sbjct: 289 DAQRYFAEGNNEYPVIPGVPIDPVLAAHGQLKGDPLNVSNLGRYQPD 335


>2pt1_A (A:) Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, periplasmic binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_ALength = 334 Back     alignment and structure
>1y9u_A (A:) Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I}Length = 323 Back     alignment and structure
>3e13_X (X:) Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} PDB: 1y4t_ALength = 322 Back     alignment and structure
>3thi_A (A:) Protein (thiaminase I); thiamin degradation; 2.00A {Bacillus subtilis}Length = 371 Back     alignment and structure
>3c9h_A (A:) ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str}Length = 355 Back     alignment and structure
>1q35_A (A:) Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica}Length = 320 Back     alignment and structure
>1elj_A (A:1-163,A:221-338) Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus}Length = 281 Back     alignment and structure
>1nnf_A (A:) Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae}Length = 309 Back     alignment and structure
>3k01_A (A:1-142,A:290-369) Acarbose/maltose binding protein GACH; ABC transporter, acarbose-binding protein, transport protein; 1.35A {Streptomyces glaucescens} PDB: 3jzj_A* 3k00_A* 3k02_A*Length = 222 Back     alignment and structure
>1eu8_A (A:1-174,A:231-358) Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis}Length = 302 Back     alignment and structure
>2heu_A (A:) Sugar ABC transporter, sugar-binding protein; periplasmic binding protein, transport protein; 1.04A {Streptococcus pneumoniae} PDB: 2hq0_A 2i58_A* 2hfb_ALength = 401 Back     alignment and structure
>2qry_A (A:1-128,A:240-318) Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli}Length = 207 Back     alignment and structure
>3cvg_A (A:) Putative metal binding protein; PSI-II, NYSGXRC, periplasmic, structural genomics, protein structure initiative; 1.97A {Coccidioides immitis RS}Length = 294 Back     alignment and structure
>1xvx_A (A:) YFUA; periplasmic iron binding protein; 1.53A {Yersinia enterocolitica}Length = 312 Back     alignment and structure
>2zyo_A (A:1-129,A:272-355) Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A*Length = 213 Back     alignment and structure
>1urs_A (A:1-143,A:279-355) Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius}Length = 220 Back     alignment and structure
>2b3f_A (A:1-121,A:269-349) Glucose-binding protein; protein-carbohydrate complex, periplasmic binding protein, galactose, GBP, sugar binding protein; HET: GAL; 1.56A {Thermus thermophilus HB27} PDB: 2b3b_A*Length = 202 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target107 hypothetical protein CLIBASIA_02255 [Candidatus Liberib
2qry_A_1-128_240-318207 Thiamine-binding periplasmic protein; thiamin bind 99.56
1y9u_A_323 Putative iron binding protein; periplasmic binding 99.23
2voz_A_346 FUTA2, periplasmic iron-binding protein; ferric bi 99.21
1eu8_A_1-174_231-358302 Trehalose/maltose binding protein; protein-carbohy 99.18
1q35_A_320 Iron binding protein FBPA; metal binding protein; 99.16
2pt1_A_334 Iron transport protein; C-clamp, iron-binding prot 99.16
3e13_X_322 Putative iron-uptake ABC transport system, peripla 99.1
1xvx_A_312 YFUA; periplasmic iron binding protein; 1.53A {Yer 99.09
1nnf_A_309 Iron-utilization periplasmic protein; iron-binding 99.09
3cvg_A_294 Putative metal binding protein; PSI-II, NYSGXRC, p 99.05
2b3f_A_1-121_269-349202 Glucose-binding protein; protein-carbohydrate comp 98.97
3k6v_A_1-123_293-354185 Solute-binding protein MA_0280; MODA, molybdate, p 98.95
3thi_A_371 Protein (thiaminase I); thiamin degradation; 2.00A 98.94
2zyo_A_1-129_272-355213 Solute-binding protein; open form, sugar binding p 98.84
3c9h_A_355 ABC transporter, substrate binding protein; struct 98.83
1urs_A_1-143_279-355220 Maltose-binding protein; maltodextrin-binding prot 98.8
1twy_A_290 ABC transporter, periplasmic substrate-binding pro 98.78
1pot_A_325 POTD, spermidine/putrescine-binding protein; polya 98.78
3k01_A_1-142_290-369222 Acarbose/maltose binding protein GACH; ABC transpo 98.74
2hxw_A_237 Major antigenic peptide PEB3; periplasmic binding 98.72
1a99_A_344 POTF, putrescine-binding protein; transport, perip 98.69
2gh9_A_386 Maltose/maltodextrin-binding protein; MBP, maltose 98.65
2heu_A_401 Sugar ABC transporter, sugar-binding protein; peri 98.65
2v84_A_1-131_251-327208 Spermidine/putrescine ABC transporter, periplasmic 98.61
2gha_A_1-111_253-336195 Maltose ABC transporter, periplasmic maltose- bind 98.54
2zxt_A_1-112_252-333194 Maltose-binding periplasmic protein, linker, mitoc 98.52
3f5f_A_1-112_252-333194 Maltose-binding periplasmic protein, heparan sulfa 98.48
3h3g_A_1-114_254-335196 Fusion protein of maltose-binding periplasmic doma 98.45
3kjt_A_1-114_254-335196 Maltose-binding periplasmic protein; alternate con 98.44
2vgq_A_1-127_263-348213 Maltose-binding periplasmic protein, mitochondrial 98.41
2nvu_B_1-117_252-337203 Maltose binding protein/NEDD8-activating enzyme E1 98.4
1mg1_A_1-108_252-329186 Protein (HTLV-1 GP21 ectodomain/maltose-binding pr 98.34
2uvj_A_1-117_285-340173 TOGB, ABC type periplasmic sugar-binding protein; 98.27
1y4c_A_1-112_256-332189 Maltose binding protein fused with designed helica 98.15
1pc3_A_350 Phosphate-binding protein 1; phosphate transport r 97.86
2z8f_A_1-130_281-345195 Galacto-N-biose/lacto-N-biose I transporter substr 97.62
1elj_A_1-163_221-338281 Maltodextrin-binding protein; protein-carbohydrate 98.86
3kn3_A_242 Putative periplasmic protein; alpha-beta structure 98.56
3gzg_A_1-103_211-253146 Molybdate-binding periplasmic protein; permease; m 97.67
1amf_A_1-83_191-233126 Molybdate transport protein MODA; periplasmic, bin 97.52
1hsj_A_1-112_253-309169 Fusion protein consisting of staphylococcus access 96.58
3iot_A_1-112_253-313173 Maltose-binding protein, huntingtin fusion protein 96.04
1r6z_P_1-113_254-314174 Chimera of maltose-binding periplasmic protein and 96.01
1mh3_A_1-112_258-313168 Maltose binding-A1 homeodomain protein chimera; MA 95.16
3cfx_A_1-85_255-296127 UPF0100 protein MA_0280; ABC transporter, binding 98.54
3cij_A_1-85_254-295127 UPF0100 protein AF_0094; archaeal periplasmic bind 98.42
3cg1_A_1-90_255-296132 UPF0100 protein PF0080; ABC transporter, binding p 98.4
1atg_A_1-80_186-231126 MODA, periplasmic molybdate-binding protein; tungs 97.95
1j1n_A_1-134_304-397228 ALGQ2; alginate, suger binding protein; HET: BEM M 97.25
3cfz_A_1-86_253-292126 UPF0100 protein MJ1186; ABC transporter, binding p 95.16
3dm0_A_1-112_257-309165 Maltose-binding periplasmic protein fused with RAC 94.6
1sbp_A_1-85_220-275141 Sulfate-binding protein; 1.70A {Salmonella typhimu 94.03
>2qry_A (A:1-128,A:240-318) Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Back     alignment and structure
Probab=99.56  E-value=6.5e-15  Score=100.90  Aligned_cols=78  Identities=22%  Similarity=0.245  Sum_probs=75.4

Q ss_pred             CCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHCC
Q ss_conf             851068654121631699889999999998399999999740021001068767421012554472565865786307
Q gi|254780564|r   28 DIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIKTAQNP  105 (107)
Q Consensus        28 D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~~~~~~~~~~~d~~~l~~~a~n~  105 (107)
                      +-|+++.+.+++|+|+|||+++|++||+|++|+++|..+++.++++|+++++..++.+++...++...+|...+++|+
T Consensus       129 ~eG~~~~~~~~~i~k~a~~~e~A~~fi~~~ls~e~Q~~~a~~~~~~p~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~  206 (207)
T 2qry_A          129 SEGHYLQVEVAARTAASKQPELAQKFLQFXVSPAFQNAIPTGNWXYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQR  206 (207)
T ss_dssp             TTCEEEEEEEEEEBTTCSCHHHHHHHHHHHTSHHHHTTHHHHTCSEESSCCCCCTTGGGSCCCSSEECCCHHHHHHHH
T ss_pred             CCCEEEEEEHHHHHCCCCCHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCHHHHHCCCCCCCCCCCHHHHHHHH
T ss_conf             476488620213433898779999999997599999999984760126887688656642474234669999999999



>1y9u_A (A:) Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} Back     alignment and structure
>2voz_A (A:) FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A* Back     alignment and structure
>1eu8_A (A:1-174,A:231-358) Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} Back     alignment and structure
>1q35_A (A:) Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} Back     alignment and structure
>2pt1_A (A:) Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, periplasmic binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Back     alignment and structure
>3e13_X (X:) Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} PDB: 1y4t_A Back     alignment and structure
>1xvx_A (A:) YFUA; periplasmic iron binding protein; 1.53A {Yersinia enterocolitica} Back     alignment and structure
>1nnf_A (A:) Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} Back     alignment and structure
>3cvg_A (A:) Putative metal binding protein; PSI-II, NYSGXRC, periplasmic, structural genomics, protein structure initiative; 1.97A {Coccidioides immitis RS} Back     alignment and structure
>2b3f_A (A:1-121,A:269-349) Glucose-binding protein; protein-carbohydrate complex, periplasmic binding protein, galactose, GBP, sugar binding protein; HET: GAL; 1.56A {Thermus thermophilus HB27} PDB: 2b3b_A* Back     alignment and structure
>3k6v_A (A:1-123,A:293-354) Solute-binding protein MA_0280; MODA, molybdate, periplasmic binding protein, ABC transporter, transport protein, ligand; HET: CIT; 1.69A {Methanosarcina acetivorans} PDB: 3k6u_A* 3k6w_A 3k6x_A Back     alignment and structure
>3thi_A (A:) Protein (thiaminase I); thiamin degradation; 2.00A {Bacillus subtilis} Back     alignment and structure
>2zyo_A (A:1-129,A:272-355) Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A* Back     alignment and structure
>3c9h_A (A:) ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1urs_A (A:1-143,A:279-355) Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1twy_A (A:) ABC transporter, periplasmic substrate-binding protein; nysgxrc target, structural genomics, protein structure initiative; 1.65A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>1pot_A (A:) POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} Back     alignment and structure
>3k01_A (A:1-142,A:290-369) Acarbose/maltose binding protein GACH; ABC transporter, acarbose-binding protein, transport protein; 1.35A {Streptomyces glaucescens} PDB: 3jzj_A* 3k00_A* 3k02_A* Back     alignment and structure
>2hxw_A (A:) Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A* Back     alignment and structure
>1a99_A (A:) POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} Back     alignment and structure
>2gh9_A (A:) Maltose/maltodextrin-binding protein; MBP, maltose binding protein, thermophilic protein, periplasmic binding protein; HET: MLR; 1.95A {Thermus thermophilus HB27} Back     alignment and structure
>2heu_A (A:) Sugar ABC transporter, sugar-binding protein; periplasmic binding protein, transport protein; 1.04A {Streptococcus pneumoniae} PDB: 2hq0_A 2i58_A* 2hfb_A Back     alignment and structure
>2v84_A (A:1-131,A:251-327) Spermidine/putrescine ABC transporter, periplasmic binding protein; polyamine binding, syphilis, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum} Back     alignment and structure
>2gha_A (A:1-111,A:253-336) Maltose ABC transporter, periplasmic maltose- binding protein; periplasmic binding protein, MBP, maltotriose, sugar binding protein; HET: MLR; 1.60A {Thermotoga maritima MSB8} PDB: 2ghb_A 2fnc_A* Back     alignment and structure
>2zxt_A (A:1-112,A:252-333) Maltose-binding periplasmic protein, linker, mitochondrial intermembrane space import...; disulfide bond, alpha helix, fusion, sugar transport; HET: MAL; 3.00A {Escherichia coli} Back     alignment and structure
>3f5f_A (A:1-112,A:252-333) Maltose-binding periplasmic protein, heparan sulfate 2-O-sulfotransferase 1; maltose binding protein, fusion, heparan sulfate biosynthesis; HET: GLC A3P; 2.65A {Escherichia coli k-12} Back     alignment and structure
>3h3g_A (A:1-114,A:254-335) Fusion protein of maltose-binding periplasmic domain and human parathyroid hormone...; GPCR, extracellular domain, PTHRP, PTH, PThr1, periplasm, sugar transport, transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* 3ehs_A* 3ehu_A* 3eht_A* Back     alignment and structure
>3kjt_A (A:1-114,A:254-335) Maltose-binding periplasmic protein; alternate conformation, sugar transport, transport, transport protein; 1.50A {Escherichia coli k-12} PDB: 3hpi_A 1anf_A* 1dmb_A* 1ez9_A* 1jw4_A 1jw5_A* 1lls_A 1omp_A 2d21_A 2r6g_E* 3mbp_A* 4mbp_A* 1fqa_A* 1fqb_A* 1fqc_A* 1fqd_A* 1ezo_A 1ezp_A 2h25_A 2klf_A ... Back     alignment and structure
>2vgq_A (A:1-127,A:263-348) Maltose-binding periplasmic protein, mitochondrial antiviral-signaling protein; immune system/transport, IPS1/MAVS/VISA/cardif; HET: MTT; 2.1A {Escherichia coli} Back     alignment and structure
>2nvu_B (B:1-117,B:252-337) Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} Back     alignment and structure