254780571

254780571

hypothetical protein CLIBASIA_02290

GeneID in NCBI database:8209568Locus tag:CLIBASIA_02290
Protein GI in NCBI database:254780571Protein Accession:YP_003064984.1
Gene range:+(711849, 712397)Protein Length:182aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCRDC
cHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccccEEEEEEccccccccccccccHHHcccccEEEEEEEccccccHHHHccccccccccEEEEEEEEEccccccccccccc
ccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEEEccccEEEEEEEEcccccccEEEcccccccccccEEEEEEEEEEccccEcccccccccccccccccEEEEccccccccccccc
MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENFLratmypyrtpnhsiivTGYWLDNKQIVRKMWNWsssnvkveredipasikdASTFIVRAEVSINYRTLVFSKIlpdslkgdivLRKVYYYRQRlgdqivcrdc
MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSssnvkveredipasikdastfiVRAEVSINYRTLvfskilpdslkgdiVLRKVYYYRqrlgdqivcrdc
MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCRDC
********LRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCRDC
MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCRDC
*KCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCRDC
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCRDC
MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCRDC
MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVEREDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCRDC

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target182 hypothetical protein CLIBASIA_02290 [Candidatus Liberib
315121765183 hypothetical protein CKC_00075 [Candidatus Liberibacter 1 2e-55
86355858193 hypothetical protein RHE_CH00199 [Rhizobium etli CFN 42 1 4e-28
190889875193 hypothetical protein RHECIAT_CH0000244 [Rhizobium etli 1 2e-26
116249975193 transmembrane protein [Rhizobium leguminosarum bv. vici 1 2e-26
241207151193 hypothetical protein Rleg_4470 [Rhizobium leguminosarum 1 3e-26
327191361193 hypothetical protein RHECNPAF_310002 [Rhizobium etli CN 1 6e-26
209551753193 hypothetical protein Rleg2_4182 [Rhizobium leguminosaru 1 8e-26
163757619190 putative transmembrane protein [Hoeflea phototrophica D 1 1e-22
222084462192 hypothetical protein Arad_0354 [Agrobacterium radiobact 1 4e-22
222147189194 hypothetical protein Avi_0228 [Agrobacterium vitis S4] 1 4e-20
>gi|315121765|ref|YP_004062254.1| hypothetical protein CKC_00075 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 183 Back     alignment and organism information
 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 103/182 (56%), Positives = 136/182 (74%), Gaps = 2/182 (1%)

Query: 1   MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDM 60
           M+  KNYI RF  R+NGV A+EMA+I P+LL+IY+AVYEIT++Y+ SKRLTR AS++GDM
Sbjct: 1   MRFYKNYIRRFFCRKNGVAAIEMALIFPVLLIIYIAVYEITLMYSFSKRLTRVASYVGDM 60

Query: 61  VAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVE 120
           +AQET IN ++L  F  FL ATM PYR  N +I +TGYW+D K  V++MW W + +  + 
Sbjct: 61  IAQETIINTKFLDSFNTFLDATMLPYRLQNKTIAITGYWIDEKNNVKRMWYWPADSGSI- 119

Query: 121 REDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCR 180
           ++DIP SI D STFIVRA VS  Y  ++ + +LP ++  DI + KVYYYRQRLGDQI C+
Sbjct: 120 KDDIPKSIMDPSTFIVRASVSTQYHMVLATPLLPFTM-SDINMNKVYYYRQRLGDQIECK 178

Query: 181 DC 182
           DC
Sbjct: 179 DC 180


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86355858|ref|YP_467750.1| hypothetical protein RHE_CH00199 [Rhizobium etli CFN 42] Length = 193 Back     alignment and organism information
>gi|190889875|ref|YP_001976417.1| hypothetical protein RHECIAT_CH0000244 [Rhizobium etli CIAT 652] Length = 193 Back     alignment and organism information
>gi|116249975|ref|YP_765813.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 193 Back     alignment and organism information
>gi|241207151|ref|YP_002978247.1| hypothetical protein Rleg_4470 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 193 Back     alignment and organism information
>gi|327191361|gb|EGE58388.1| hypothetical protein RHECNPAF_310002 [Rhizobium etli CNPAF512] Length = 193 Back     alignment and organism information
>gi|209551753|ref|YP_002283670.1| hypothetical protein Rleg2_4182 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 193 Back     alignment and organism information
>gi|163757619|ref|ZP_02164708.1| putative transmembrane protein [Hoeflea phototrophica DFL-43] Length = 190 Back     alignment and organism information
>gi|222084462|ref|YP_002542991.1| hypothetical protein Arad_0354 [Agrobacterium radiobacter K84] Length = 192 Back     alignment and organism information
>gi|222147189|ref|YP_002548146.1| hypothetical protein Avi_0228 [Agrobacterium vitis S4] Length = 194 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target182 hypothetical protein CLIBASIA_02290 [Candidatus Liberib
pfam0781143 pfam07811, TadE, TadE-like protein 5e-04
COG4961185 COG4961, TadG, Flp pilus assembly protein TadG [Intrace 6e-08
>gnl|CDD|149078 pfam07811, TadE, TadE-like protein Back     alignment and domain information
>gnl|CDD|34568 COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 182 hypothetical protein CLIBASIA_02290 [Candidatus Liberib
COG4961185 TadG Flp pilus assembly protein TadG [Intracellular tra 99.87
pfam0781143 TadE TadE-like protein. The members of this family are 98.86
COG384758 Flp Flp pilus assembly protein, pilin Flp [Intracellula 97.76
pfam0496447 Flp_Fap Flp/Fap pilin component. 95.87
COG4655 565 Predicted membrane protein [Function unknown] 95.56
pfam04917 356 Shufflon_N Bacterial shufflon protein, N-terminal const 94.58
PRK10506155 hypothetical protein; Provisional 93.4
COG4970181 FimT Tfp pilus assembly protein FimT [Cell motility and 90.82
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam07811 TadE TadE-like protein Back     alignment and domain information
>COG3847 Flp Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam04964 Flp_Fap Flp/Fap pilin component Back     alignment and domain information
>COG4655 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam04917 Shufflon_N Bacterial shufflon protein, N-terminal constant region Back     alignment and domain information
>PRK10506 hypothetical protein; Provisional Back     alignment and domain information
>COG4970 FimT Tfp pilus assembly protein FimT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00