254780590

254780590

hypothetical protein CLIBASIA_02385

GeneID in NCBI database:8209587Locus tag:CLIBASIA_02385
Protein GI in NCBI database:254780590Protein Accession:YP_003065003.1
Gene range:-(693711, 693986)Protein Length:91aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVIQ
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHcc
ccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccHHHHcc
MESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGmaegiepeIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMlagefsperviq
mesirsvekkTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMsrmlagefsperviq
MESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVIQ
******************LHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSP*****
**********TQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVIQ
**SIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPE****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVIQ
MESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVIQ
MESIRSVEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVIQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target91 hypothetical protein CLIBASIA_02385 [Candidatus Liberib
31512178385 hypothetical protein CKC_00165 [Candidatus Liberibacter 1 3e-34
22214809385 hypothetical protein Avi_1464 [Agrobacterium vitis S4] 1 4e-22
1596485989 hypothetical protein SMc02556 [Sinorhizobium meliloti 1 1 6e-22
16376057689 hypothetical protein HPDFL43_11796 [Hoeflea phototrophi 1 3e-21
22782143289 hypothetical protein NGR_c08580 [Sinorhizobium fredii N 1 4e-21
22208540481 hypothetical protein Arad_1611 [Agrobacterium radiobact 1 5e-21
1588839785 hypothetical protein Atu1055 [Agrobacterium tumefaciens 1 8e-21
19089108985 hypothetical protein RHECIAT_CH0001474 [Rhizobium etli 1 8e-21
32529243485 hypothetical protein AGROH133_05102 [Agrobacterium sp. 1 1e-20
20954861885 hypothetical protein Rleg2_1015 [Rhizobium leguminosaru 1 1e-20
>gi|315121783|ref|YP_004062272.1| hypothetical protein CKC_00165 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 85 Back     alignment and organism information
 Score =  147 bits (372), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 71/85 (83%), Positives = 78/85 (91%)

Query: 7  VEKKTQEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEE 66
          +E KTQ+ D LLLHEKMQ AIEYQNEAWA GMA+GIEPEIIANAAITQAIRETVR+HGEE
Sbjct: 1  MENKTQDLDTLLLHEKMQAAIEYQNEAWAGGMADGIEPEIIANAAITQAIRETVRLHGEE 60

Query: 67 KMESLLKSLMSRMLAGEFSPERVIQ 91
          K+E L+ SL+SRMLAGEFSPERVIQ
Sbjct: 61 KVELLINSLISRMLAGEFSPERVIQ 85


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148093|ref|YP_002549050.1| hypothetical protein Avi_1464 [Agrobacterium vitis S4] Length = 85 Back     alignment and organism information
>gi|15964859|ref|NP_385212.1| hypothetical protein SMc02556 [Sinorhizobium meliloti 1021] Length = 89 Back     alignment and organism information
>gi|163760576|ref|ZP_02167657.1| hypothetical protein HPDFL43_11796 [Hoeflea phototrophica DFL-43] Length = 89 Back     alignment and organism information
>gi|227821432|ref|YP_002825402.1| hypothetical protein NGR_c08580 [Sinorhizobium fredii NGR234] Length = 89 Back     alignment and organism information
>gi|222085404|ref|YP_002543934.1| hypothetical protein Arad_1611 [Agrobacterium radiobacter K84] Length = 81 Back     alignment and organism information
>gi|15888397|ref|NP_354078.1| hypothetical protein Atu1055 [Agrobacterium tumefaciens str. C58] Length = 85 Back     alignment and organism information
>gi|190891089|ref|YP_001977631.1| hypothetical protein RHECIAT_CH0001474 [Rhizobium etli CIAT 652] Length = 85 Back     alignment and organism information
>gi|325292434|ref|YP_004278298.1| hypothetical protein AGROH133_05102 [Agrobacterium sp. H13-3] Length = 85 Back     alignment and organism information
>gi|209548618|ref|YP_002280535.1| hypothetical protein Rleg2_1015 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 85 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00