254780591

254780591

aminomethyltransferase protein (glycine cleavage)

GeneID in NCBI database:8209588Locus tag:CLIBASIA_02390
Protein GI in NCBI database:254780591Protein Accession:YP_003065004.1
Gene range:-(692688, 693509)Protein Length:273aa
Gene description:aminomethyltransferase protein (glycine cleavage)
COG prediction:[R] Predicted aminomethyltransferase related to GcvT
KEGG prediction:aminomethyltransferase protein (glycine cleavage); K06980
SEED prediction:Folate-dependent protein for Fe/S cluster synthesis/repair in oxidative stress
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMIITGTDDLPPSGSPILTDDIEIGTLGVVVGKKALAIARIDKVDHAIKKGMALTVHGVRVKASFPHWYK
cccccccccEEEEEEcHHHHHHHHHHccccccccccccEEEEEEEcccccEEEEEEEEEEcccEEEEEEcHHHHHHHHHHHHHccHHccEEEEEccccEEEEEEccccccccccccccccccccHHHHHHHcccccccccHHHHHHHHHHccccccccccccccccHHHHccHHHccccccccccccHHHHHHHHHcccccEEEEEEEccccccccccEEEEccEEEEEEEEccccEEEEEEEHHHHcccccccccEEEccEEEEEEcccccc
ccEEEccccEEEEEEcccHHHHHHHHHcccHHHccccccEEEEEEcccccEEEEEEEEEcccccEEEEccHHHHHHHHHHHHHHEHEEEEEEccccccEEEEEEcccccccccccccccccHccccHHHHHcccccccccHHHHHHHHHHcccccccccccccccccHHHcHHHcccEEccccccccHEHHEEHHHcccccEEEEEEEccccccccccEEEcccccccEEEEcccccEEEEEEHHHHHHHHHccccEEcccEEEEcccccHcc
MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTlpykiargsailtpQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWnqehtfsnssfidERFSIADVLLHRtwghnekiaSDIKTYHELRinhgivdpntdflpstifphDALMDLLNGISLTKGCYIGQEVVSRIQHrniirkrpmiitgtddlppsgspiltddieigtLGVVVGKKALAIARIDKVDHAIKKGMALTvhgvrvkasfphwyk
MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIArgsailtpqGKILLYFLISKIEEDTFIleidrskrdsLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVsriqhrniirkrpmiitgtddlppsgSPILTDDIEIGTLGVVVGKKALAIARIDKVDHAIKKGmaltvhgvrvkasfphwyk
MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMIITGTDDLPPSGSPILTDDIEIGTLGVVVGKKALAIARIDKVDHAIKKGMALTVHGVRVKASFPHWYK
*SSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMIITGTDDLPPSGSPILTDDIEIGTLGVVVGKKALAIARIDKVDHAIKKGMALTVHGVRVKASFPHWYK
MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMIITGTDDLPPSGSPILTDDIEIGTLGVVVGKKALAIARIDKVDHAIKKGMALTVHGVRVKASFPHWYK
MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMIITGTDDLPPSGSPILTDDIEIGTLGVVVGKKALAIARIDKVDHAIKKGMALTVHGVRVKASFPHWYK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMIITGTDDLPPSGSPILTDDIEIGTLGVVVGKKALAIARIDKVDHAIKKGMALTVHGVRVKASFPHWYK
MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMIITGTDDLPPSGSPILTDDIEIGTLGVVVGKKALAIARIDKVDHAIKKGMALTVHGVRVKASFPHWYK
MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMIITGTDDLPPSGSPILTDDIEIGTLGVVVGKKALAIARIDKVDHAIKKGMALTVHGVRVKASFPHWYK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target273 aminomethyltransferase protein (glycine cleavage) [Cand
315121784271 aminomethyltransferase protein (glycine cleavage) [Cand 1 1e-110
222085402279 aminomethyltransferase protein (glycine cleavage) [Agro 1 3e-53
86357042281 putative aminomethyltransferase protein (glycine cleava 1 2e-52
325292432282 glycine cleavage system T protein, aminomethyltransfera 1 2e-51
190891087290 aminomethyltransferase (glycine cleavage) protein [Rhiz 1 2e-51
241203903284 folate-binding protein YgfZ [Rhizobium leguminosarum bv 1 1e-49
15888395282 glycine cleavage system T protein, aminomethyltransfera 1 2e-49
209548616284 folate-binding protein YgfZ [Rhizobium leguminosarum bv 1 3e-49
163760578272 glycine cleavage system T protein, aminomethyltransfera 1 2e-48
116251291287 aminomethyltransferase [Rhizobium leguminosarum bv. vic 1 2e-47
>gi|315121784|ref|YP_004062273.1| aminomethyltransferase protein (glycine cleavage) [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 271 Back     alignment and organism information
 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/271 (69%), Positives = 229/271 (84%)

Query: 1   MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKI 60
           M SVYLS+QSFIKV GKSA  FLQ IITAD+ +LP+ +ARGSA+LTPQGKIL YFLISKI
Sbjct: 1   MPSVYLSSQSFIKVRGKSASTFLQGIITADITSLPFDVARGSALLTPQGKILFYFLISKI 60

Query: 61  EEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERF 120
           EED F+LEI++ +RDS I+KLLFYKLRS+V +E+QPING+ LSWNQE   ++ SFIDERF
Sbjct: 61  EEDVFVLEINKLQRDSFIEKLLFYKLRSDVALEVQPINGITLSWNQEQAPTSPSFIDERF 120

Query: 121 SIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISL 180
           SIA +LLHRTWG+NE+  SD K YHELRIN+GIV+P  DF PSTIFPHDALMDL+ GIS 
Sbjct: 121 SIAGILLHRTWGYNEESTSDPKEYHELRINYGIVEPIPDFPPSTIFPHDALMDLVKGISF 180

Query: 181 TKGCYIGQEVVSRIQHRNIIRKRPMIITGTDDLPPSGSPILTDDIEIGTLGVVVGKKALA 240
           TKGCY+GQEVVSR+QHRNI+RKRP+IITG + LP +GS +  D+ +IGTLG++VG+KALA
Sbjct: 181 TKGCYVGQEVVSRMQHRNIVRKRPIIITGYNALPANGSSLFVDNTKIGTLGIIVGEKALA 240

Query: 241 IARIDKVDHAIKKGMALTVHGVRVKASFPHW 271
           IARIDKV +AI+K MALT  G++V  + P W
Sbjct: 241 IARIDKVSNAIEKNMALTADGIKVTITLPPW 271


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085402|ref|YP_002543932.1| aminomethyltransferase protein (glycine cleavage) [Agrobacterium radiobacter K84] Length = 279 Back     alignment and organism information
>gi|86357042|ref|YP_468934.1| putative aminomethyltransferase protein (glycine cleavage) [Rhizobium etli CFN 42] Length = 281 Back     alignment and organism information
>gi|325292432|ref|YP_004278296.1| glycine cleavage system T protein, aminomethyltransferase [Agrobacterium sp. H13-3] Length = 282 Back     alignment and organism information
>gi|190891087|ref|YP_001977629.1| aminomethyltransferase (glycine cleavage) protein [Rhizobium etli CIAT 652] Length = 290 Back     alignment and organism information
>gi|241203903|ref|YP_002974999.1| folate-binding protein YgfZ [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 284 Back     alignment and organism information
>gi|15888395|ref|NP_354076.1| glycine cleavage system T protein, aminomethyltransferase [Agrobacterium tumefaciens str. C58] Length = 282 Back     alignment and organism information
>gi|209548616|ref|YP_002280533.1| folate-binding protein YgfZ [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 284 Back     alignment and organism information
>gi|163760578|ref|ZP_02167659.1| glycine cleavage system T protein, aminomethyltransferase [Hoeflea phototrophica DFL-43] Length = 272 Back     alignment and organism information
>gi|116251291|ref|YP_767129.1| aminomethyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 287 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target273 aminomethyltransferase protein (glycine cleavage) [Cand
KOG2929348 KOG2929, KOG2929, KOG2929, Transcription factor, compon 3e-32
COG0404379 COG0404, GcvT, Glycine cleavage system T protein (amino 3e-07
KOG2770401 KOG2770, KOG2770, KOG2770, Aminomethyl transferase [Ami 0.001
COG0354305 COG0354, COG0354, Predicted aminomethyltransferase rela 5e-44
TIGR0331767 TIGR03317, ygfZ_signature, folate-binding protein YgfZ 8e-16
pfam01571212 pfam01571, GCV_T, Aminomethyltransferase folate-binding 2e-09
pfam0866995 pfam08669, GCV_T_C, Glycine cleavage T-protein C-termin 1e-07
PRK09559327 PRK09559, PRK09559, putative global regulator; Reviewed 6e-05
>gnl|CDD|38140 KOG2929, KOG2929, KOG2929, Transcription factor, component of CCR4 transcriptional complex [Transcription] Back     alignment and domain information
>gnl|CDD|30753 COG0404, GcvT, Glycine cleavage system T protein (aminomethyltransferase) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|37981 KOG2770, KOG2770, KOG2770, Aminomethyl transferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30703 COG0354, COG0354, Predicted aminomethyltransferase related to GcvT [General function prediction only] Back     alignment and domain information
>gnl|CDD|163214 TIGR03317, ygfZ_signature, folate-binding protein YgfZ Back     alignment and domain information
>gnl|CDD|144970 pfam01571, GCV_T, Aminomethyltransferase folate-binding domain Back     alignment and domain information
>gnl|CDD|149654 pfam08669, GCV_T_C, Glycine cleavage T-protein C-terminal barrel domain Back     alignment and domain information
>gnl|CDD|181953 PRK09559, PRK09559, putative global regulator; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 273 aminomethyltransferase protein (glycine cleavage) [Cand
PRK00389362 gcvT glycine cleavage system aminomethyltransferase T; 100.0
COG0404379 GcvT Glycine cleavage system T protein (aminomethyltran 100.0
PRK12486367 dmdA putative dimethyl sulfoniopropionate demethylase; 100.0
PRK13579371 gcvT glycine cleavage system aminomethyltransferase T; 100.0
TIGR00528394 gcvT glycine cleavage system T protein; InterPro: IPR00 100.0
COG0354305 Predicted aminomethyltransferase related to GcvT [Gener 100.0
PRK09559327 putative global regulator; Reviewed 100.0
TIGR013721026 soxA sarcosine oxidase, alpha subunit family; InterPro: 100.0
KOG2929348 consensus 100.0
KOG2770401 consensus 99.97
KOG2844856 consensus 99.97
pfam01571212 GCV_T Aminomethyltransferase folate-binding domain. Thi 99.89
pfam0866995 GCV_T_C Glycine cleavage T-protein C-terminal barrel do 99.28
TIGR0331767 ygfZ_signature folate-binding protein YgfZ. YgfZ is a p 98.22
pfam04268148 SoxG Sarcosine oxidase, gamma subunit family. Sarcosine 96.97
COG0486 454 ThdF Predicted GTPase [General function prediction only 96.92
pfam10396114 TrmE_N GTP-binding protein TrmE N-terminus. This family 96.67
COG4583189 Sarcosine oxidase gamma subunit [Amino acid transport a 96.67
PRK05291 445 trmE tRNA modification GTPase TrmE; Reviewed 96.39
TIGR01375154 soxG sarcosine oxidase, gamma subunit family; InterPro: 96.34
TIGR00450 473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 90.68
>PRK00389 gcvT glycine cleavage system aminomethyltransferase T; Reviewed Back     alignment and domain information
>COG0404 GcvT Glycine cleavage system T protein (aminomethyltransferase) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12486 dmdA putative dimethyl sulfoniopropionate demethylase; Reviewed Back     alignment and domain information
>PRK13579 gcvT glycine cleavage system aminomethyltransferase T; Provisional Back     alignment and domain information
>TIGR00528 gcvT glycine cleavage system T protein; InterPro: IPR006223 This is a subfamily of glycine cleavage T proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>COG0354 Predicted aminomethyltransferase related to GcvT [General function prediction only] Back     alignment and domain information
>PRK09559 putative global regulator; Reviewed Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family; InterPro: IPR006277 This set of sequences describe the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases Back     alignment and domain information
>KOG2929 consensus Back     alignment and domain information
>KOG2770 consensus Back     alignment and domain information
>KOG2844 consensus Back     alignment and domain information
>pfam01571 GCV_T Aminomethyltransferase folate-binding domain Back     alignment and domain information
>pfam08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain Back     alignment and domain information
>TIGR03317 ygfZ_signature folate-binding protein YgfZ Back     alignment and domain information
>pfam04268 SoxG Sarcosine oxidase, gamma subunit family Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>pfam10396 TrmE_N GTP-binding protein TrmE N-terminus Back     alignment and domain information
>COG4583 Sarcosine oxidase gamma subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>TIGR01375 soxG sarcosine oxidase, gamma subunit family; InterPro: IPR006280 These sequences represent the gamma subunit of a family of known and putative heterotetrameric sarcosine oxidases Back     alignment and domain information
>TIGR00450 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 The GTP-binding domain of all TrmE/ThdF orthologues is found in the C-terminal portion of the molecule Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target273 aminomethyltransferase protein (glycine cleavage) [Cand
1yx2_A365 Crystal Structure Of The Probable Aminomethyltransf 8e-28
1woo_A364 Crystal Structure Of T-Protein Of The Glycine Cleav 3e-27
1v5v_A401 Crystal Structure Of A Component Of Glycine Cleavag 3e-19
3gir_A393 Crystal Structure Of Glycine Cleavage System Aminom 1e-18
3a8i_A364 Crystal Structure Of Et-Ehred-5-Ch3-Thf Complex Len 5e-18
3a8k_A364 Crystal Structure Of Etd97n-Ehred Complex Length = 3e-17
1vlo_A381 Crystal Structure Of Aminomethyltransferase (T Prot 5e-16
1pj5_A830 Crystal Structure Of Dimethylglycine Oxidase Of Art 1e-13
1wsr_A375 Crystal Structure Of Human T-Protein Of Glycine Cle 1e-13
3gsi_A827 Crystal Structure Of D552a Dimethylglycine Oxidase 1e-12
2gag_A965 Heteroteterameric Sarcosine: Structure Of A Diflavi 2e-10
2gah_A965 Heterotetrameric Sarcosine: Structure Of A Diflavin 5e-09
1vrq_A964 Crystal Structure Of Heterotetrameric Sarcosine Oxi 4e-10
1nrk_A328 Ygfz Protein Length = 328 6e-09
1vly_A338 Crystal Structure Of A Putative Aminomethyltransfer 6e-09
>gi|62738815|pdb|1YX2|A Chain A, Crystal Structure Of The Probable Aminomethyltransferase From Bacillus Subtilis Length = 365 Back     alignment and structure
 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 42/313 (13%), Positives = 82/313 (26%), Gaps = 47/313 (15%)

Query: 7   SNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFI 66
           S+   ++V G  ++ FLQ + T DV  L    A+ +A   P G  +   LI +  E+ ++
Sbjct: 53  SHXGEVEVSGNDSLSFLQRLXTNDVSALTPGRAQYTAXCYPDGGTVDDLLIYQKGENRYL 112

Query: 67  LEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNS------------S 114
           L I+ S  D  +     +      I   Q     +L+       +               
Sbjct: 113 LVINASNIDKDLAWXKEHAAGDVQID-NQSDQIALLAVQGPKAEAILKNLTDADVSALKP 171

Query: 115 FIDERFSIADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHD----- 169
           F     +                    + Y        I     D   +           
Sbjct: 172 FAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAXHIWKKIIDAGDAYGLIPCGLGAR 231

Query: 170 -----------------------ALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMI 206
                                              +  + G+ V+S  +     RK   +
Sbjct: 232 DTLRFEANIPLYGQELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGL 291

Query: 207 ITGTDDLPPSGSPILTDDIEIGTLGVVVG------KKALAIARIDKVDHAIKKGMALTVH 260
                 +P  G  +  +   +G +              LA+   +  +      + +   
Sbjct: 292 EXIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTVVDVEIRKK 351

Query: 261 GVRVKASFPHWYK 273
            V+ K     +YK
Sbjct: 352 LVKAKVVKTPFYK 364


gi|55670726|pdb|1WOO|A Chain A, Crystal Structure Of T-Protein Of The Glycine Cleavage System Length = 364 Back     alignment and structure
gi|56554253|pdb|1V5V|A Chain A, Crystal Structure Of A Component Of Glycine Cleavage System: T-Protein From Pyrococcus Horikoshii Ot3 At 1.5 A Resolution Length = 401 Back     alignment and structure
>gi|225698148|pdb|3GIR|A Chain A, Crystal Structure Of Glycine Cleavage System Aminomethyltransferase T From Bartonella Henselae Length = 393 Back     alignment and structure
gi|293651790|pdb|3A8I|A Chain A, Crystal Structure Of Et-Ehred-5-Ch3-Thf Complex Length = 364 Back     alignment and structure
>gi|293651802|pdb|3A8K|A Chain A, Crystal Structure Of Etd97n-Ehred Complex Length = 364 Back     alignment and structure
>gi|55670453|pdb|1VLO|A Chain A, Crystal Structure Of Aminomethyltransferase (T Protein; Tetrahydrofolate-Dependent) Of Glycine Cleavage System (Np417381) From Escherichia Coli K12 At 1.70 A Resolution Length = 381 Back     alignment and structure
>gi|37927479|pdb|1PJ5|A Chain A, Crystal Structure Of Dimethylglycine Oxidase Of Arthrobacter Globiformis In Complex With Acetate Length = 830 Back     alignment and structure
>gi|75765383|pdb|1WSR|A Chain A, Crystal Structure Of Human T-Protein Of Glycine Cleavage System Length = 375 Back     alignment and structure
>gi|226887919|pdb|3GSI|A Chain A, Crystal Structure Of D552a Dimethylglycine Oxidase Mutant Of Arthrobacter Globiformis In Complex With Tetrahydrofolate Length = 827 Back     alignment and structure
>gi|114794036|pdb|2GAG|A Chain A, Heteroteterameric Sarcosine: Structure Of A Diflavin Metaloenzyme At 1.85 A Resolution Length = 965 Back     alignment and structure
>gi|114794040|pdb|2GAH|A Chain A, Heterotetrameric Sarcosine: Structure Of A Diflavin Metaloenzyme At 1.85 A Resolution Length = 965 Back     alignment and structure
>gi|71041783|pdb|1VRQ|A Chain A, Crystal Structure Of Heterotetrameric Sarcosine Oxidase From Corynebacterium Sp. U-96 In Complex With Folinic Acid Length = 964 Back     alignment and structure
>gi|47168424|pdb|1NRK|A Chain A, Ygfz Protein Length = 328 Back     alignment and structure
>gi|52696236|pdb|1VLY|A Chain A, Crystal Structure Of A Putative Aminomethyltransferase (Ygfz) From Escherichia Coli At 1.30 A Resolution Length = 338 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target273 aminomethyltransferase protein (glycine cleavage) [Cand
1vly_A338 SPOT PR51, unknown protein from 2D-PAGE; 1789265, B2898 1e-16
1yx2_A365 Aminomethyltransferase; glycine cleavage system T prote 4e-05
1pj5_A830 N,N-dimethylglycine oxidase; channelling, FAD binding, 5e-09
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; flavo 2e-06
1v5v_A401 Aminomethyltransferase; glycine-cleavage sytem, structu 2e-04
>1vly_A SPOT PR51, unknown protein from 2D-PAGE; 1789265, B2898, unknown protein from 2D-PAGE (SPOT PR51), structural genomics, JCSG; HET: MSE; 1.30A {Escherichia coli} SCOP: b.44.2.1 d.250.1.1 PDB: 1nrk_A Length = 338 Back     alignment and structure
 Score = 82.0 bits (201), Expect = 1e-16
 Identities = 43/294 (14%), Positives = 91/294 (30%), Gaps = 35/294 (11%)

Query: 6   LSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTF 65
           L + +   + G  +  ++Q  +TADV  +       +A    +GK+     + +  +   
Sbjct: 36  LDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFA 95

Query: 66  ILEIDRSKRDSLIDKLLFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSI--- 122
            +E    +   L +   +       I        + ++  Q      + F +        
Sbjct: 96  WIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQV 155

Query: 123 ------------------------ADVLLHRTWGHNEKIASDIKTYHELRINHGIVDPNT 158
                                   A   +       E   ++ + +  L I  G    + 
Sbjct: 156 VKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGFPVID- 214

Query: 159 DFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIRKRPMIITGTDD-LPPSG 217
                   P    +  L GIS  KGCY GQE+V+R + R   ++   ++ G+   LP +G
Sbjct: 215 AANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGANKRALWLLAGSASRLPEAG 274

Query: 218 SPILT----DDIEIGTL--GVVVGKKALAIARIDKVDHAIKKGMALTVHGVRVK 265
             +      +    GT+   V +    + +  +   D        +      + 
Sbjct: 275 EDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDMEPDSIFRVRDDANTLH 328


>1yx2_A Aminomethyltransferase; glycine cleavage system T protein, alpha-beta, beta-barrel, structural genomics, PSI, protein structure initiative; 2.08A {Bacillus subtilis} Length = 365 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Length = 830 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* Length = 965 Back     alignment and structure
>1v5v_A Aminomethyltransferase; glycine-cleavage sytem, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.50A {Pyrococcus horikoshii} SCOP: b.44.2.1 d.250.1.1 Length = 401 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target273 aminomethyltransferase protein (glycine cleavage) [Cand
1yx2_A365 Aminomethyltransferase; glycine cleavage system T prote 100.0
1v5v_A401 Aminomethyltransferase; glycine-cleavage sytem, structu 100.0
1vly_A338 SPOT PR51, unknown protein from 2D-PAGE; 1789265, B2898 100.0
1pj5_A830 N,N-dimethylglycine oxidase; channelling, FAD binding, 100.0
3gir_A393 Aminomethyltransferase; glycine cleavage system, aminot 100.0
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; flavo 100.0
1wos_A364 Aminomethyltransferase; T-protein; 1.84A {Thermotoga ma 100.0
1wsr_A375 Aminomethyltransferase; glycine-cleavage sytem; 2.00A { 100.0
1vlo_A381 Aminomethyltransferase; NP417381, tetrahydrofolate-depe 100.0
1x31_C206 Sarcosine oxidase gamma subunit; heterotetrameric sarco 98.66
2gag_C210 Heterotetrameric sarcosine oxidase gamma-subunit; flavo 98.34
1x31_C206 Sarcosine oxidase gamma subunit; heterotetrameric sarco 96.66
2gag_C210 Heterotetrameric sarcosine oxidase gamma-subunit; flavo 96.31
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cytopla 95.57
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U34, cy 95.27
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-binding, TH 94.16
>1yx2_A Aminomethyltransferase; glycine cleavage system T protein, alpha-beta, beta-barrel, structural genomics, PSI, protein structure initiative; 2.08A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=2.2e-42  Score=265.25  Aligned_cols=264  Identities=17%  Similarity=0.163  Sum_probs=193.9

Q ss_pred             EECCCCEEEEEECCCHHHHHHCCCCCCHHHCCCCCEEEEEEECCCCCEEEEEEEEEECCCCCCEEHHHHHHHHHHHHHHH
Q ss_conf             76179407999875878786321326731089982689999979998899899997045552000033333456777643
Q gi|254780591|r    4 VYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLF   83 (273)
Q Consensus         4 ~~L~~~~~i~i~G~DA~~fL~~l~t~di~~l~~g~~~yt~~ln~~G~i~~D~~i~r~~~~~~~~~~~~~~~~~~~~~~~~   83 (273)
                      +=+|+++.|+|+|+||.+|||+++||||++|++|++.||+|||++|+|++|++|+|++++.|+++.+.........++..
T Consensus        50 ~D~S~~~~i~I~G~Da~~fL~~l~t~di~~l~~g~~~yt~~l~~~G~ii~D~~v~~~~e~~~~l~~~~~~~~~~~~~l~~  129 (365)
T 1yx2_A           50 FDVSHMGEVEVSGNDSLSFLQRLMTNDVSALTPGRAQYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKE  129 (365)
T ss_dssp             EECTTSEEEEEESTTHHHHHHHHBSSCGGGCCTTBEEEEEEECTTSCEEEEEEEEEEETTEEEEEECGGGHHHHHHHHHH
T ss_pred             EECCCCEEEEEECCCHHHHHHHHHHHCCEECCCCCEEEEEEECCCCCEEEEEEEEEECCCCEEEEECHHHHHHHHHHHHH
T ss_conf             97897189999879999999876141442137984898887658897765379998047860676145667767788763


Q ss_pred             HHHCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCC-------------------------CCCCHHHHHH-------
Q ss_conf             21000122356884369999718543222111234566-------------------------4441012221-------
Q gi|254780591|r   84 YKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFS-------------------------IADVLLHRTW-------  131 (273)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~-------------------------~~~~~~~~~~-------  131 (273)
                      .... .+.+.+.++.+..++++||+++...........                         ..++..+.++       
T Consensus       130 ~~~~-~~~~~~~~~~~~~~~l~GP~s~~~l~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~R~g~tGe~G~el~~~~~~~~  208 (365)
T 1yx2_A          130 HAAG-DVQIDNQSDQIALLAVQGPKAEAILKNLTDADVSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAM  208 (365)
T ss_dssp             TCCS-SCEEEECTTTEEEEEEESTTHHHHHHTTBSSCGGGCCTTBEEEEEEETTEEEEEESCCSSSSSEEEEEEEGGGHH
T ss_pred             CCCC-CCEEEECCCCEEEEEEECCCHHHHHHCCCCCCCCCCCCCCCEEEEEECCEEEEEEECCCCCCCEEEECCCHHHHH
T ss_conf             3378-609998768788898787660332012467410123541202578988918999946767887347416789999


Q ss_pred             ----------CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             ----------013555579678888887520133456543221233100111220133147-521331013210012444
Q gi|254780591|r  132 ----------GHNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTK-GCYIGQEVVSRIQHRNII  200 (273)
Q Consensus       132 ----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k-~~f~G~e~~~~~~~~~~~  200 (273)
                                ........+...++..+.+.+.+.+..+...   ...+....+.+.++..| +||+|||++.+++..+..
T Consensus       209 ~l~~~l~~aG~~~g~~p~G~~a~~~lRiE~g~~~~g~D~~~---~~~P~EagL~~~i~~~k~~~fiG~eal~~~~~~g~~  285 (365)
T 1yx2_A          209 HIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYGQELTR---DITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAK  285 (365)
T ss_dssp             HHHHHHHHHHGGGTEEEECHHHHHHHHHHTTCCCBTTTBST---TCCTTTTTCGGGCCTTCSSCCTTHHHHHHHHHHCCS
T ss_pred             HHHHHHHHCCHHHCCEECCHHHHHHHHHHCCCCCCCCCCCC---CCCHHHCCCCCEEECCCCCCCHHHHHHHHHHHCCCC
T ss_conf             99999996127519988668787577886488766865778---899678788735765786552208999999864997


Q ss_pred             CEEEEEEECCCCCCCCCCEEEECCEEEEEEEEEECC------EEEEEEEHHHCCCCCCCCCEEEECC--EEEEEECCCCC
Q ss_conf             347887401345667898872467796799983478------3368998131036656786488688--89999748876
Q gi|254780591|r  201 RKRPMIITGTDDLPPSGSPILTDDIEIGTLGVVVGK------KALAIARIDKVDHAIKKGMALTVHG--VRVKASFPHWY  272 (273)
Q Consensus       201 ~~~~~~~~~~~~~~~~g~~i~~~g~~VG~vtS~~~~------~gla~i~~~~~~~~~~~~~~l~~~~--~~~~i~~P~w~  272 (273)
                      ++++++....+..+..|++|+.+|+.||.|||+++|      +||||++.++...+..  +++.+.+  ++++|+++|||
T Consensus       286 rrlvgl~~~~~~~p~~g~~v~~~g~~VG~vTS~~~sp~lg~~Iala~v~~~~a~~g~~--l~v~~~g~~~~a~V~~~Pfy  363 (365)
T 1yx2_A          286 RKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTV--VDVEIRKKLVKAKVVKTPFY  363 (365)
T ss_dssp             EEEEEEEESSSCCCCTTCEEEETTEEEEEEEEEEEETTTTEEEEEEEEEGGGCSTTCE--EEEEETTEEEEEEEECCCC-
T ss_pred             EEEEEEEECCCCCCCCCCEEEECCEEEEEEEEEEECHHCCEEEEEEEECHHHCCCCCE--EEEEECCEEEEEEEECCCCC
T ss_conf             5999999568878899997988990899941588973059289999998021589988--99999999999999888886


Q ss_pred             C
Q ss_conf             9
Q gi|254780591|r  273 K  273 (273)
Q Consensus       273 ~  273 (273)
                      |
T Consensus       364 ~  364 (365)
T 1yx2_A          364 K  364 (365)
T ss_dssp             -
T ss_pred             C
T ss_conf             7



>1v5v_A Aminomethyltransferase; glycine-cleavage sytem, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.50A {Pyrococcus horikoshii} SCOP: b.44.2.1 d.250.1.1 Back     alignment and structure
>1vly_A SPOT PR51, unknown protein from 2D-PAGE; 1789265, B2898, unknown protein from 2D-PAGE (SPOT PR51), structural genomics, JCSG; HET: MSE; 1.30A {Escherichia coli} SCOP: b.44.2.1 d.250.1.1 PDB: 1nrk_A Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3gir_A Aminomethyltransferase; glycine cleavage system, aminotransferase, structural genomics; 1.60A {Bartonella henselae} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1wos_A Aminomethyltransferase; T-protein; 1.84A {Thermotoga maritima} SCOP: b.44.2.1 d.250.1.1 PDB: 1woo_A* 1wop_A* 1wor_A Back     alignment and structure
>1wsr_A Aminomethyltransferase; glycine-cleavage sytem; 2.00A {Homo sapiens} PDB: 1wsv_A* Back     alignment and structure
>1vlo_A Aminomethyltransferase; NP417381, tetrahydrofolate-dependent) of glycine cleavage system, structural genomics, JCSG; HET: MSE; 1.70A {Escherichia coli K12} SCOP: b.44.2.1 d.250.1.1 PDB: 3a8j_A* 3a8i_A* 3a8k_A* Back     alignment and structure
>1x31_C Sarcosine oxidase gamma subunit; heterotetrameric sarcosine oxidase, flavoenzyme, oxidoreductase; HET: FAD NAD FMN; 2.15A {Corynebacterium SP} PDB: 1vrq_C* Back     alignment and structure
>2gag_C Heterotetrameric sarcosine oxidase gamma-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_C* Back     alignment and structure
>1x31_C Sarcosine oxidase gamma subunit; heterotetrameric sarcosine oxidase, flavoenzyme, oxidoreductase; HET: FAD NAD FMN; 2.15A {Corynebacterium SP} PDB: 1vrq_C* Back     alignment and structure
>2gag_C Heterotetrameric sarcosine oxidase gamma-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_C* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 273 aminomethyltransferase protein (glycine cleavage) [Cand
d1vlya2241 d.250.1.1 (A:3-243) Hypothetical protein YgfZ, N-termin 3e-21
d1pj5a4315 d.250.1.1 (A:428-742) N,N-dimethylglycine oxidase domai 7e-04
>d1vlya2 d.250.1.1 (A:3-243) Hypothetical protein YgfZ, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Folate-binding domain
superfamily: Folate-binding domain
family: Aminomethyltransferase folate-binding domain
domain: Hypothetical protein YgfZ, N-terminal domain
species: Escherichia coli [TaxId: 562]
 Score = 95.8 bits (237), Expect = 3e-21
 Identities = 33/224 (14%), Positives = 68/224 (30%), Gaps = 28/224 (12%)

Query: 1   MSSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKI 60
           ++ + L + +   + G  +  ++Q  +TADV  +       +A    +GK+     + + 
Sbjct: 17  LTLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRD 76

Query: 61  EEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIEIQ---------PINGVVLSWNQEHTFS 111
            +    +E    +   L +   +       I                   L+       S
Sbjct: 77  GDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPS 136

Query: 112 NSSFIDERFSIADVLLHRTWGHNEKIAS------------------DIKTYHELRINHGI 153
               + +  +   +           +                    + + +  L I  G 
Sbjct: 137 KEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGEAELNNSQQWLALNIEAGF 196

Query: 154 VDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHR 197
              +         P    +  L GIS  KGCY GQE+V+R + R
Sbjct: 197 PVIDAA-NSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKFR 239


>d1pj5a4 d.250.1.1 (A:428-742) N,N-dimethylglycine oxidase domain 3 {Arthrobacter globiformis [TaxId: 1665]} Length = 315 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target273 aminomethyltransferase protein (glycine cleavage) [Cand
d1vlya2241 Hypothetical protein YgfZ, N-terminal domain {Escherich 99.97
d1pj5a4315 N,N-dimethylglycine oxidase domain 3 {Arthrobacter glob 99.95
d1wosa2278 Glycine cleavage system T protein, GcvT {Thermotoga mar 99.94
d1v5va2310 Glycine cleavage system T protein, GcvT {Pyrococcus hor 99.94
d1vloa2274 Glycine cleavage system T protein, GcvT {Escherichia co 99.94
d1v5va189 Glycine cleavage system T protein, GcvT {Pyrococcus hor 99.07
d1wosa183 Glycine cleavage system T protein, GcvT {Thermotoga mar 99.04
d1vloa190 Glycine cleavage system T protein, GcvT {Escherichia co 98.79
d1pj5a188 N,N-dimethylglycine oxidase, C-terminal domain {Arthrob 98.73
d1xzpa3117 TrmE formyl-THF-binding domain {Thermotoga maritima [Ta 94.73
>d1vlya2 d.250.1.1 (A:3-243) Hypothetical protein YgfZ, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Folate-binding domain
superfamily: Folate-binding domain
family: Aminomethyltransferase folate-binding domain
domain: Hypothetical protein YgfZ, N-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=99.97  E-value=2.8e-31  Score=199.01  Aligned_cols=195  Identities=19%  Similarity=0.229  Sum_probs=133.4

Q ss_pred             CEEECCCCEEEEEECCCHHHHHHCCCCCCHHHCCCCCEEEEEEECCCCCEEEEEEEEEECCCCCCEEHHHHHHHHHHHHH
Q ss_conf             41761794079998758787863213267310899826899999799988998999970455520000333334567776
Q gi|254780591|r    2 SSVYLSNQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKL   81 (273)
Q Consensus         2 ~~~~L~~~~~i~i~G~DA~~fL~~l~t~di~~l~~g~~~yt~~ln~~G~i~~D~~i~r~~~~~~~~~~~~~~~~~~~~~~   81 (273)
                      ..+-|++|++|+|+|+||.+|||+|+||||++|++|+++||+|||++|||++|++|+|.+++.++++..+... ....++
T Consensus        18 ~l~~L~~~~~i~v~G~Da~~fLq~l~T~di~~l~~g~~~~t~~ln~kGri~~d~~i~~~~~~~~l~~~~~~~~-~~~~~l   96 (241)
T d1vlya2          18 TLMTLDDWALATITGADSEKYMQGQVTADVSQMAEDQHLLAAHCDAKGKMWSNLRLFRDGDGFAWIERRSVRE-PQLTEL   96 (241)
T ss_dssp             EEEECTTEEEEEEESTTHHHHHHTTBSSCGGGCCTTCEEEEEEECTTSCEEEEEEEEEETTEEEEEEEHHHHH-HHHHHH
T ss_pred             EEEECCCCEEEEEECCCHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCEEEEEEEEEECCCCCEEEHHHHHHH-HHHHHH
T ss_conf             6997798569999888999997377642610169997873310156675999877752233202111134568-888877


Q ss_pred             HHHHHCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHH-----------------HH------------HHC
Q ss_conf             4321000122356884369999718543222111234566444101-----------------22------------210
Q gi|254780591|r   82 LFYKLRSNVIIEIQPINGVVLSWNQEHTFSNSSFIDERFSIADVLL-----------------HR------------TWG  132 (273)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~-----------------~~------------~~~  132 (273)
                      .......++.+.+ ++.+..+.++||.++.................                 ..            ...
T Consensus        97 ~~~~~~~~v~i~~-~~~~~~~~l~gp~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  175 (241)
T d1vlya2          97 KKYAVFSKVTIAP-DDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKL  175 (241)
T ss_dssp             HTTCSSSSCEEEE-ECSSEEEEEESTTHHHHHHTTSSCCCBTTBCEEEETTEEEEEECSSSCEEEEEECHHHHHHHHHHH
T ss_pred             HHHCCCCEEEEEC-CHHHEEEEECCCCHHHHHHHCCCCCCCCCCCEEEEEEEEEEECCCCCCCEEEECCHHHHHHHHHHH
T ss_conf             6530252146511-300103431273079999861544344344212110146530367876345307788999999876


Q ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             1355557967888888752013345654322123310011122013314752133101321001244
Q gi|254780591|r  133 HNEKIASDIKTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNI  199 (273)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~f~G~e~~~~~~~~~~  199 (273)
                      .......+...|+..+.+.+.+....... ....+.........+++++||||+|||.++|++++|.
T Consensus       176 ~~~~~~~~~~~~~~lRie~g~p~~~~e~~-~~~~P~E~gLd~~~~Vsf~KGCY~GQE~vAR~~~rG~  241 (241)
T d1vlya2         176 RGEAELNNSQQWLALNIEAGFPVIDAANS-GQFIPQATNLQALGGISFKKGCYTGQEMVARAKFRGA  241 (241)
T ss_dssp             BTTBEEECHHHHHHHHHHHTCCCCCGGGT-TSCCGGGGTGGGTTCCCSSSCCCTTHHHHHHTTSTTS
T ss_pred             HHHCCCCCHHHHHHHHHHCCCCCCCCCCC-CCCCHHHCCCHHCCCCCCCCCCCCCHHHHHHHHHCCC
T ss_conf             42112466668999999809862385577-8774888296002699989999675999999985299



>d1pj5a4 d.250.1.1 (A:428-742) N,N-dimethylglycine oxidase domain 3 {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1wosa2 d.250.1.1 (A:1-278) Glycine cleavage system T protein, GcvT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v5va2 d.250.1.1 (A:3-312) Glycine cleavage system T protein, GcvT {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vloa2 d.250.1.1 (A:4-277) Glycine cleavage system T protein, GcvT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5va1 b.44.2.1 (A:313-401) Glycine cleavage system T protein, GcvT {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wosa1 b.44.2.1 (A:279-361) Glycine cleavage system T protein, GcvT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vloa1 b.44.2.1 (A:278-367) Glycine cleavage system T protein, GcvT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a1 b.44.2.1 (A:743-830) N,N-dimethylglycine oxidase, C-terminal domain {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1xzpa3 d.250.1.2 (A:1-117) TrmE formyl-THF-binding domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 273 aminomethyltransferase protein (glycine cleavage)
1vly_A_199-338140 (A:199-338) SPOT PR51, unknown protein from 2D-PAG 6e-12
1pj5_A_687-830144 (A:687-830) N,N-dimethylglycine oxidase; channelli 8e-10
1wos_A_221-364144 (A:221-364) Aminomethyltransferase; T-protein; 1.8 8e-08
1wos_A_50-13990 (A:50-139) Aminomethyltransferase; T-protein; 1.84 7e-12
1wsr_A_55-14894 (A:55-148) Aminomethyltransferase; glycine-cleavag 7e-12
3gir_A_83-17189 (A:83-171) Aminomethyltransferase; glycine cleavag 1e-11
1v5v_A_55-14995 (A:55-149) Aminomethyltransferase; glycine-cleavag 1e-11
1vlo_A_63-15290 (A:63-152) Aminomethyltransferase; NP417381, tetra 2e-10
1pj5_A_508-60093 (A:508-600) N,N-dimethylglycine oxidase; channelli 8e-10
1yx2_A_55-14288 (A:55-142) Aminomethyltransferase; glycine cleavag 2e-09
2gag_A_632-72493 (A:632-724) Heterotetrameric sarcosine oxidase alp 2e-09
1vly_A_38-12588 (A:38-125) SPOT PR51, unknown protein from 2D-PAGE 7e-08
1vlo_A_1-62_153-289_367-381214 (A:1-62,A:153-289,A:367-381) Aminomethyltransferas 1e-07
2gag_A_847-965119 (A:847-965) Heterotetrameric sarcosine oxidase alp 2e-04
>1vly_A (A:199-338) SPOT PR51, unknown protein from 2D-PAGE; 1789265, B2898, unknown protein from 2D-PAGE (SPOT PR51), structural genomics, JCSG; HET: MSE; 1.30A {Escherichia coli}Length = 140 Back     alignment and structure
 Score = 65.8 bits (160), Expect = 6e-12
 Identities = 27/132 (20%), Positives = 44/132 (33%), Gaps = 10/132 (7%)

Query: 142 KTYHELRINHGIVDPNTDFLPSTIFPHDALMDLLNGISLTKGCYIGQEVVSRIQHRNIIR 201
           + +  L I  G    +       I P    +  L GIS  KGCY GQE V+R + R   +
Sbjct: 1   QQWLALNIEAGFPVIDAANSGQFI-PQATNLQALGGISFKKGCYTGQEXVARAKFRGANK 59

Query: 202 KRPMIITGTDD-LPPSGSPILTDDIEIG------TLGVVVGKKALAIARIDKVDHAIKKG 254
           +   ++ G+   LP +G  +     E           V +    + +  +   D      
Sbjct: 60  RALWLLAGSASRLPEAGEDLELKXGENWRRTGTVLAAVKLEDGQVVVQVVXNNDXEP--D 117

Query: 255 MALTVHGVRVKA 266
               V       
Sbjct: 118 SIFRVRDDANTL 129


>1pj5_A (A:687-830) N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis}Length = 144 Back     alignment and structure
>1wos_A (A:221-364) Aminomethyltransferase; T-protein; 1.84A {Thermotoga maritima}Length = 144 Back     alignment and structure
>1wos_A (A:50-139) Aminomethyltransferase; T-protein; 1.84A {Thermotoga maritima}Length = 90 Back     alignment and structure
>1wsr_A (A:55-148) Aminomethyltransferase; glycine-cleavage sytem; 2.00A {Homo sapiens} PDB: 1wsv_A*Length = 94 Back     alignment and structure
>3gir_A (A:83-171) Aminomethyltransferase; glycine cleavage system, aminotransferase, structural genomics; 1.60A {Bartonella henselae}Length = 89 Back     alignment and structure
>1v5v_A (A:55-149) Aminomethyltransferase; glycine-cleavage sytem, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.50A {Pyrococcus horikoshii}Length = 95 Back     alignment and structure
>1vlo_A (A:63-152) Aminomethyltransferase; NP417381, tetrahydrofolate-dependent) of glycine cleavage system, structural genomics, JCSG; HET: MSE; 1.70A {Escherichia coli K12}Length = 90 Back     alignment and structure
>1pj5_A (A:508-600) N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis}Length = 93 Back     alignment and structure
>1yx2_A (A:55-142) Aminomethyltransferase; glycine cleavage system T protein, alpha-beta, beta-barrel, structural genomics, PSI, protein structure initiative; 2.08A {Bacillus subtilis}Length = 88 Back     alignment and structure
>2gag_A (A:632-724) Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A*Length = 93 Back     alignment and structure
>1vly_A (A:38-125) SPOT PR51, unknown protein from 2D-PAGE; 1789265, B2898, unknown protein from 2D-PAGE (SPOT PR51), structural genomics, JCSG; HET: MSE; 1.30A {Escherichia coli}Length = 88 Back     alignment and structure
>1vlo_A (A:1-62,A:153-289,A:367-381) Aminomethyltransferase; NP417381, tetrahydrofolate-dependent) of glycine cleavage system, structural genomics, JCSG; HET: MSE; 1.70A {Escherichia coli K12}Length = 214 Back     alignment and structure
>2gag_A (A:847-965) Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A*Length = 119 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target273 aminomethyltransferase protein (glycine cleavage) [Cand
1wsr_A_55-14894 Aminomethyltransferase; glycine-cleavage sytem; 2. 99.86
1wos_A_50-13990 Aminomethyltransferase; T-protein; 1.84A {Thermoto 99.84
3gir_A_83-17189 Aminomethyltransferase; glycine cleavage system, a 99.84
1vlo_A_63-15290 Aminomethyltransferase; NP417381, tetrahydrofolate 99.82
2gag_A_632-72493 Heterotetrameric sarcosine oxidase alpha-subunit; 99.81
1yx2_A_55-14288 Aminomethyltransferase; glycine cleavage system T 99.81
1pj5_A_508-60093 N,N-dimethylglycine oxidase; channelling, FAD bind 99.8
1vly_A_38-12588 SPOT PR51, unknown protein from 2D-PAGE; 1789265, 99.79
1v5v_A_55-14995 Aminomethyltransferase; glycine-cleavage sytem, st 99.78
1x31_C_1-36_118-206125 Sarcosine oxidase gamma subunit; heterotetrameric 96.14
2gag_C_1-38_120-210129 Heterotetrameric sarcosine oxidase gamma-subunit; 95.94
1pj5_A_425-507_601-686169 N,N-dimethylglycine oxidase; channelling, FAD bind 94.85
1wos_A_30-49_140-220101 Aminomethyltransferase; T-protein; 1.84A {Thermoto 94.27
1yx2_A_1-54_143-255167 Aminomethyltransferase; glycine cleavage system T 91.5
2gag_A_559-631_725-846195 Heterotetrameric sarcosine oxidase alpha-subunit; 90.68
1vly_A_199-338140 SPOT PR51, unknown protein from 2D-PAGE; 1789265, 99.62
1pj5_A_687-830144 N,N-dimethylglycine oxidase; channelling, FAD bind 99.61
1wos_A_221-364144 Aminomethyltransferase; T-protein; 1.84A {Thermoto 99.6
2gag_A_847-965119 Heterotetrameric sarcosine oxidase alpha-subunit; 99.4
1yx2_A_284-36582 Aminomethyltransferase; glycine cleavage system T 99.05
1v5v_A_312-40190 Aminomethyltransferase; glycine-cleavage sytem, st 99.02
1wsr_A_288-37588 Aminomethyltransferase; glycine-cleavage sytem; 2. 99.0
3gir_A_307-39387 Aminomethyltransferase; glycine cleavage system, a 98.78
1vlo_A_290-36677 Aminomethyltransferase; NP417381, tetrahydrofolate 98.27
1vlo_A_1-62_153-289_367-381214 Aminomethyltransferase; NP417381, tetrahydrofolate 98.22
3geh_A_1-114114 MNME, tRNA modification GTPase MNME; G protein, U3 95.9
1xzp_A_1-134134 Probable tRNA modification GTPase TRME; GTP-bindin 95.42
3gee_A_1-122122 MNME, tRNA modification GTPase MNME; G protein, cy 94.77
1v5v_A_1-54_150-279184 Aminomethyltransferase; glycine-cleavage sytem, st 91.25
>1wsr_A (A:55-148) Aminomethyltransferase; glycine-cleavage sytem; 2.00A {Homo sapiens} PDB: 1wsv_A* Back     alignment and structure
Probab=99.86  E-value=1.8e-21  Score=144.03  Aligned_cols=93  Identities=10%  Similarity=0.065  Sum_probs=88.5

Q ss_pred             CCEEEEEECCCHHHHHHCCCCCCHHHCCCCCEEEEEEECCCCCEEEEEEEEEECCCCCCEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             94079998758787863213267310899826899999799988998999970455520000333334567776432100
Q gi|254780591|r    8 NQSFIKVCGKSAIPFLQAIITADVLTLPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLR   87 (273)
Q Consensus         8 ~~~~i~i~G~DA~~fL~~l~t~di~~l~~g~~~yt~~ln~~G~i~~D~~i~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~   87 (273)
                      |+++++|+||||.+|||+++|||++++++|+++||+|||++|+|++|++|+|++++.|+++.++........++......
T Consensus         1 H~g~i~v~G~da~~~L~~l~t~dv~~l~~g~~~yt~~l~~~G~i~~d~~v~r~~e~~~~l~~~~~~~~~~~~~l~~~~~~   80 (94)
T 1wsr_A            1 HMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRE   80 (94)
T ss_dssp             TSEEEEEESTTHHHHHHHHBSSCCTTCCTTEEEEEEEECTTCCEEEEEEEEECTTSSEEEEECGGGHHHHHHHHHHHHHH
T ss_pred             CCEEEEEECCCHHHHHHHHHCCCHHHHCCCCCCCCCCCCCCCCEEECCCCCCCCCEEEEEEEEHHHHHHHHHHHHHHHHH
T ss_conf             84899998689999998871457355332443212224788876760322012430235552012112223333333322


Q ss_pred             CCCCCCCCCCCEE
Q ss_conf             0122356884369
Q gi|254780591|r   88 SNVIIEIQPINGV  100 (273)
Q Consensus        88 ~~~~~~~~~~~~~  100 (273)
                      .++.+.+.++++.
T Consensus        81 ~~V~i~d~t~~~~   93 (94)
T 1wsr_A           81 LQNQGRDVGLEVL   93 (94)
T ss_dssp             HHHTTCCCEEEEC
T ss_pred             HCCCCCEEEEEEC
T ss_conf             1034623789865



>1wos_A (A:50-139) Aminomethyltransferase; T-protein; 1.84A {Thermotoga maritima} Back     alignment and structure
>3gir_A (A:83-171) Aminomethyltransferase; glycine cleavage system, aminotransferase, structural genomics; 1.60A {Bartonella henselae} Back     alignment and structure
>1vlo_A (A:63-152) Aminomethyltransferase; NP417381, tetrahydrofolate-dependent) of glycine cleavage system, structural genomics, JCSG; HET: MSE; 1.70A {Escherichia coli K12} Back     alignment and structure
>2gag_A (A:632-724) Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* Back     alignment and structure
>1yx2_A (A:55-142) Aminomethyltransferase; glycine cleavage system T protein, alpha-beta, beta-barrel, structural genomics, PSI, protein structure initiative; 2.08A {Bacillus subtilis} Back     alignment and structure
>1pj5_A (A:508-600) N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} Back     alignment and structure
>1vly_A (A:38-125) SPOT PR51, unknown protein from 2D-PAGE; 1789265, B2898, unknown protein from 2D-PAGE (SPOT PR51), structural genomics, JCSG; HET: MSE; 1.30A {Escherichia coli} Back     alignment and structure
>1v5v_A (A:55-149) Aminomethyltransferase; glycine-cleavage sytem, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.50A {Pyrococcus horikoshii} Back     alignment and structure
>1x31_C (C:1-36,C:118-206) Sarcosine oxidase gamma subunit; heterotetrameric sarcosine oxidase, flavoenzyme, oxidoreductase; HET: FAD NAD FMN; 2.15A {Corynebacterium SP} PDB: 1vrq_C* Back     alignment and structure
>2gag_C (C:1-38,C:120-210) Heterotetrameric sarcosine oxidase gamma-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_C* Back     alignment and structure
>1pj5_A (A:425-507,A:601-686) N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} Back     alignment and structure
>1wos_A (A:30-49,A:140-220) Aminomethyltransferase; T-protein; 1.84A {Thermotoga maritima} Back     alignment and structure
>1yx2_A (A:1-54,A:143-255) Aminomethyltransferase; glycine cleavage system T protein, alpha-beta, beta-barrel, structural genomics, PSI, protein structure initiative; 2.08A {Bacillus subtilis} Back     alignment and structure
>2gag_A (A:559-631,A:725-846) Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* Back     alignment and structure
>1vly_A (A:199-338) SPOT PR51, unknown protein from 2D-PAGE; 1789265, B2898, unknown protein from 2D-PAGE (SPOT PR51), structural genomics, JCSG; HET: MSE; 1.30A {Escherichia coli} Back     alignment and structure
>1pj5_A (A:687-830) N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} Back     alignment and structure
>1wos_A (A:221-364) Aminomethyltransferase; T-protein; 1.84A {Thermotoga maritima} Back     alignment and structure
>2gag_A (A:847-965) Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* Back     alignment and structure
>1yx2_A (A:284-365) Aminomethyltransferase; glycine cleavage system T protein, alpha-beta, beta-barrel, structural genomics, PSI, protein structure initiative; 2.08A {Bacillus subtilis} Back     alignment and structure
>1v5v_A (A:312-401) Aminomethyltransferase; glycine-cleavage sytem, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.50A {Pyrococcus horikoshii} Back     alignment and structure
>1wsr_A (A:288-375) Aminomethyltransferase; glycine-cleavage sytem; 2.00A {Homo sapiens} PDB: 1wsv_A* Back     alignment and structure
>3gir_A (A:307-393) Aminomethyltransferase; glycine cleavage system, aminotransferase, structural genomics; 1.60A {Bartonella henselae} Back     alignment and structure
>1vlo_A (A:290-366) Aminomethyltransferase; NP417381, tetrahydrofolate-dependent) of glycine cleavage system, structural genomics, JCSG; HET: MSE; 1.70A {Escherichia coli K12} Back     alignment and structure
>1vlo_A (A:1-62,A:153-289,A:367-381) Aminomethyltransferase; NP417381, tetrahydrofolate-dependent) of glycine cleavage system, structural genomics, JCSG; HET: MSE; 1.70A {Escherichia coli K12} Back     alignment and structure
>3geh_A (A:1-114) MNME, tRNA modification GTPase MNME; G protein, U34, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1xzp_A (A:1-134) Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} Back     alignment and structure
>3gee_A (A:1-122) MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1v5v_A (A:1-54,A:150-279) Aminomethyltransferase; glycine-cleavage sytem, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.50A {Pyrococcus horikoshii} Back     alignment and structure