254780592

254780592

TPR repeat-containing protein

GeneID in NCBI database:8209589Locus tag:CLIBASIA_02395
Protein GI in NCBI database:254780592Protein Accession:YP_003065005.1
Gene range:-(691544, 692359)Protein Length:271aa
Gene description:TPR repeat-containing protein
COG prediction:[R] FOG: TPR repeat
KEGG prediction:TPR repeat-containing protein
SEED prediction:Flp pilus assembly protein TadD, contains TPR repeat
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATRNIKYIKSILSQRDPWKKIAKARSNHNKKERA
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcc
ccccccccEEEEccccccHHHHcccHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccc
MIILFCPVILFLKKIKCIVFLIPLLlfsschlnprisipdpeslenmnheQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLanagyldegldainraqrpdipdwqliSAKGSVLAQMGKHSEALIEYERAlelspnessiVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIasqelspeeATRNIKYIKSILSQRDPWKKIAKARSNHNKKERA
MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASqmigadsrirQNLALVVGLQGRMKEAYSiasqelspeeaTRNIKYIKsilsqrdpwkkiakarsnhnkkera
MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATRNIKYIKSILSQRDPWKKIAKARSNHNKKERA
MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATRNIKYIKSILSQRDPWKKIAKARSNHN*****
MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATRNIKYIKSILSQRDPWKKIA************
MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATRNIKYIKSILSQRDPWKKIA************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATRNIKYIKSILSQRDPWKKIAKARSNHNKKERA
MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATRNIKYIKSILSQRDPWKKIAKARSNHNKKERA
MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATRNIKYIKSILSQRDPWKKIAKARSNHNKKERA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target271 TPR repeat-containing protein [Candidatus Liberibacter
254780436298 hypothetical protein CLIBASIA_01605 [Candidatus Li 0.004
>gi|254780436|ref|YP_003064849.1| hypothetical protein CLIBASIA_01605 [Candidatus Liberibacter asiaticus str. psy62] Length = 298 Back     alignment
 Score = 33.5 bits (75), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 122 EGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMS 181
           + L A+ RA   D   + +   +G V    G   +AL++++ AL+L+P    + +N A+ 
Sbjct: 56  DSLTAVIRAHPSDPEGYNV---RGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALI 112

Query: 182 YLLMGDLKTA 191
              MGD+  A
Sbjct: 113 RYKMGDVPMA 122

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target271 TPR repeat-containing protein [Candidatus Liberibacter
315121792265 TPR repeat-containing protein [Candidatus Liberibacter 1 1e-102
239833231287 TPR repeat-containing protein [Ochrobactrum intermedium 1 3e-63
163757633271 putative pilus assembly protein (contains TPR repeats) 1 3e-62
227823978264 conserved hypothetical protein, putative tetratricopept 1 4e-62
153008065268 TPR repeat-containing protein [Ochrobactrum anthropi AT 1 2e-61
15963901269 hypothetical protein SMc02824 [Sinorhizobium meliloti 1 1 9e-59
110636278260 tetratricopeptide TPR_2 [Mesorhizobium sp. BNC1] Length 1 1e-58
150398547271 tetratricopeptide TPR_4 [Sinorhizobium medicae WSM419] 1 3e-58
325291653274 hypothetical protein AGROH133_03262 [Agrobacterium sp. 1 4e-58
159184214274 hypothetical protein Atu0215 [Agrobacterium tumefaciens 1 6e-58
>gi|315121792|ref|YP_004062281.1| TPR repeat-containing protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 265 Back     alignment and organism information
 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/257 (69%), Positives = 219/257 (85%), Gaps = 1/257 (0%)

Query: 15  IKCIVFLIPLLLFSSC-HLNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIG 73
           I+  + L+PL L SSC     RIS+PD  SLENM+HEQLL V   IG +Y+SH KNK IG
Sbjct: 2   IRSAIILLPLFLVSSCGFFGSRISVPDLNSLENMSHEQLLNVAFEIGEKYRSHPKNKQIG 61

Query: 74  IVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRP 133
           I+YAD LRRVGRT QALAVMRQVAI+YP+DQEVLAAYGK+LANAGYL+E LDA++R+QRP
Sbjct: 62  IMYADALRRVGRTVQALAVMRQVAIVYPKDQEVLAAYGKALANAGYLEEALDAVDRSQRP 121

Query: 134 DIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEE 193
           D+PDW+LIS+K S+LAQMGK+SEAL+EY RALEL+PNE SI+SN+AMSYLL GDL+ AE+
Sbjct: 122 DMPDWRLISSKASILAQMGKYSEALVEYNRALELAPNEPSIISNMAMSYLLTGDLQMAEK 181

Query: 194 KLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATRNIKYIKSILSQRD 253
           +LR+A++M+GADSRIRQNLALV+GLQGR +EAY IAS ELSPEEA  NI YIKSIL+Q+D
Sbjct: 182 ELRYAAKMVGADSRIRQNLALVIGLQGRTEEAYDIASNELSPEEAKENINYIKSILAQKD 241

Query: 254 PWKKIAKARSNHNKKER 270
           PWKK+    ++ +KK++
Sbjct: 242 PWKKMVFKETHRDKKQK 258


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|239833231|ref|ZP_04681560.1| TPR repeat-containing protein [Ochrobactrum intermedium LMG 3301] Length = 287 Back     alignment and organism information
>gi|163757633|ref|ZP_02164722.1| putative pilus assembly protein (contains TPR repeats) [Hoeflea phototrophica DFL-43] Length = 271 Back     alignment and organism information
>gi|227823978|ref|YP_002827951.1| conserved hypothetical protein, putative tetratricopeptide repeat protein [Sinorhizobium fredii NGR234] Length = 264 Back     alignment and organism information
>gi|153008065|ref|YP_001369280.1| TPR repeat-containing protein [Ochrobactrum anthropi ATCC 49188] Length = 268 Back     alignment and organism information
>gi|15963901|ref|NP_384254.1| hypothetical protein SMc02824 [Sinorhizobium meliloti 1021] Length = 269 Back     alignment and organism information
>gi|110636278|ref|YP_676486.1| tetratricopeptide TPR_2 [Mesorhizobium sp. BNC1] Length = 260 Back     alignment and organism information
>gi|150398547|ref|YP_001329014.1| tetratricopeptide TPR_4 [Sinorhizobium medicae WSM419] Length = 271 Back     alignment and organism information
>gi|325291653|ref|YP_004277517.1| hypothetical protein AGROH133_03262 [Agrobacterium sp. H13-3] Length = 274 Back     alignment and organism information
>gi|159184214|ref|NP_353248.2| hypothetical protein Atu0215 [Agrobacterium tumefaciens str. C58] Length = 274 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target271 TPR repeat-containing protein [Candidatus Liberibacter
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 2e-09
KOG1125579 KOG1125, KOG1125, KOG1125, TPR repeat-containing protei 3e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typicall 4e-07
KOG4626 966 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine 3e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typicall 8e-05
PRK10049 765 PRK10049, pgaA, outer membrane protein PgaA; Provisiona 8e-05
KOG4162 799 KOG4162, KOG4162, KOG4162, Predicted calmodulin-binding 1e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 1e-04
KOG4626 966 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine 2e-04
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calcium re 2e-04
KOG2076 895 KOG2076, KOG2076, KOG2076, RNA polymerase III transcrip 9e-04
KOG1174564 KOG1174, KOG1174, KOG1174, Anaphase-promoting complex ( 0.004
PRK11447 1157 PRK11447, PRK11447, cellulose synthase subunit BcsC; Pr 0.004
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typicall 8e-07
KOG4626 966 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine 5e-04
KOG1126638 KOG1126, KOG1126, KOG1126, DNA-binding cell division cy 0.002
KOG1126638 KOG1126, KOG1126, KOG1126, DNA-binding cell division cy 9e-06
KOG1156 700 KOG1156, KOG1156, KOG1156, N-terminal acetyltransferase 6e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 0.002
KOG4626 966 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine 8e-05
KOG1173611 KOG1173, KOG1173, KOG1173, Anaphase-promoting complex ( 9e-05
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, contain 2e-36
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|36340 KOG1125, KOG1125, KOG1125, TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|29151 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|29151 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|182209 PRK10049, pgaA, outer membrane protein PgaA; Provisional Back     alignment and domain information
>gnl|CDD|39364 KOG4162, KOG4162, KOG4162, Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|162919 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>gnl|CDD|37287 KOG2076, KOG2076, KOG2076, RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>gnl|CDD|36389 KOG1174, KOG1174, KOG1174, Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183140 PRK11447, PRK11447, cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>gnl|CDD|29151 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|36341 KOG1126, KOG1126, KOG1126, DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|36341 KOG1126, KOG1126, KOG1126, DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|36371 KOG1156, KOG1156, KOG1156, N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|36388 KOG1173, KOG1173, KOG1173, Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|34615 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 271 TPR repeat-containing protein [Candidatus Liberibacter
KOG4626 966 consensus 99.95
KOG4626 966 consensus 99.94
TIGR02917 924 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipop 99.94
TIGR02917 924 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipop 99.93
KOG1126638 consensus 99.91
KOG1125579 consensus 99.89
PRK11447 1158 cellulose synthase subunit BcsC; Provisional 99.89
KOG1126638 consensus 99.89
KOG1155559 consensus 99.87
KOG0547606 consensus 99.86
KOG0547606 consensus 99.84
KOG1155559 consensus 99.83
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motility and 99.81
PRK11788 389 hypothetical protein; Provisional 99.8
TIGR00990649 3a0801s09 mitochondrial precursor proteins import recep 99.8
KOG1129478 consensus 99.79
KOG0624 504 consensus 99.79
KOG1173611 consensus 99.79
TIGR00990649 3a0801s09 mitochondrial precursor proteins import recep 99.78
KOG1125579 consensus 99.74
KOG2076 895 consensus 99.74
KOG2002 1018 consensus 99.72
KOG1129478 consensus 99.72
KOG1173611 consensus 99.72
KOG2003 840 consensus 99.7
KOG1840508 consensus 99.67
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carbohydrat 99.65
KOG1840508 consensus 99.65
KOG0495913 consensus 99.65
KOG2003 840 consensus 99.63
PRK11788389 hypothetical protein; Provisional 99.63
KOG0495 913 consensus 99.63
PRK10747398 putative protoheme IX biogenesis protein; Provisional 99.61
KOG4162799 consensus 99.61
PRK12370553 invasion protein regulator; Provisional 99.61
PRK11189297 lipoprotein NlpI; Provisional 99.61
KOG0550 486 consensus 99.61
KOG0548539 consensus 99.6
KOG1174 564 consensus 99.6
KOG2076 895 consensus 99.56
KOG0548539 consensus 99.55
KOG1127 1238 consensus 99.53
KOG1128 777 consensus 99.53
PRK12370553 invasion protein regulator; Provisional 99.5
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [Coenz 99.49
PRK10747398 putative protoheme IX biogenesis protein; Provisional 99.49
PRK10049 818 pgaA outer membrane protein PgaA; Provisional 99.49
KOG4162799 consensus 99.48
KOG1156 700 consensus 99.48
KOG1128 777 consensus 99.48
KOG1127 1238 consensus 99.47
KOG2376 652 consensus 99.45
KOG3060289 consensus 99.42
KOG0550486 consensus 99.42
KOG1156 700 consensus 99.42
COG4783484 Putative Zn-dependent protease, contains TPR repeats [G 99.41
COG2956389 Predicted N-acetylglucosaminyl transferase [Carbohydrat 99.38
pfam04733290 Coatomer_E Coatomer epsilon subunit. This family repres 99.33
KOG4340 459 consensus 99.26
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [Coenz 99.25
KOG2053 932 consensus 99.25
COG4105254 ComL DNA uptake lipoprotein [General function predictio 99.18
pfam04733290 Coatomer_E Coatomer epsilon subunit. This family repres 99.17
KOG4648 536 consensus 99.11
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [General fu 99.11
KOG1915 677 consensus 99.08
KOG10701710 consensus 99.06
KOG10701710 consensus 99.03
COG0457291 NrfG FOG: TPR repeat [General function prediction only] 99.0
KOG1915 677 consensus 98.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; Prov 98.93
KOG1130 639 consensus 98.91
cd05804 355 StaR_like StaR_like; a well-conserved protein found in 98.9
COG0457291 NrfG FOG: TPR repeat [General function prediction only] 98.83
KOG0543397 consensus 98.81
KOG3785 557 consensus 98.78
COG4700251 Uncharacterized protein conserved in bacteria containin 98.75
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. Membe 98.72
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; Prov 98.67
KOG2053 932 consensus 98.59
KOG2047 835 consensus 98.56
KOG3081299 consensus 98.51
KOG3081299 consensus 98.51
KOG1941 518 consensus 98.4
KOG1941 518 consensus 98.38
COG3118304 Thioredoxin domain-containing protein [Posttranslationa 98.36
PRK10866243 outer membrane protein assembly complex subunit YfiO; P 98.32
KOG2796366 consensus 98.25
KOG1914 656 consensus 97.99
KOG1585308 consensus 97.81
COG3898 531 Uncharacterized membrane-bound protein [Function unknow 97.8
PRK06330 906 transcript cleavage factor/unknown domain fusion protei 97.66
COG4105254 ComL DNA uptake lipoprotein [General function predictio 97.58
KOG0530318 consensus 97.58
KOG1585308 consensus 97.47
KOG1258577 consensus 97.4
KOG1550552 consensus 97.06
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 96.78
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function predi 96.68
KOG0985 1666 consensus 96.58
pfam04053435 Coatomer_WDAD Coatomer WD associated region. This regio 96.1
smart00299140 CLH Clathrin heavy chain repeat homology. 96.0
KOG2300629 consensus 95.98
KOG0985 1666 consensus 95.91
KOG1586288 consensus 95.82
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and polyaden 95.48
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR repe 99.93
TIGR02521247 type_IV_pilW type IV pilus biogenesis/stability protein 99.93
KOG2002 1018 consensus 99.81
TIGR02521247 type_IV_pilW type IV pilus biogenesis/stability protein 99.89
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motility and 99.88
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. Membe 99.68
PRK10866243 outer membrane protein assembly complex subunit YfiO; P 99.51
KOG0624 504 consensus 99.47
PRK11189297 lipoprotein NlpI; Provisional 99.16
PRK11447 1158 cellulose synthase subunit BcsC; Provisional 99.73
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.5
COG4783484 Putative Zn-dependent protease, contains TPR repeats [G 99.43
COG4235287 Cytochrome c biogenesis factor [Posttranslational modif 99.25
KOG1130 639 consensus 98.52
COG4700251 Uncharacterized protein conserved in bacteria containin 98.51
COG3118304 Thioredoxin domain-containing protein [Posttranslationa 98.23
PRK11906458 transcriptional regulator; Provisional 97.6
pfam10300446 IML2 Putative mitochondrial outer membrane protein. Thi 97.38
KOG0551 390 consensus 97.31
KOG4507 886 consensus 97.15
KOG1258 577 consensus 96.67
pfam02259351 FAT FAT domain. The FAT domain is named after FRAP, ATM 96.51
KOG1839 1236 consensus 96.44
KOG1174564 consensus 99.61
KOG3060289 consensus 99.46
KOG2610 491 consensus 98.21
KOG3617 1416 consensus 98.06
PRK11906458 transcriptional regulator; Provisional 97.76
KOG1914 656 consensus 97.19
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function predi 96.48
pfam04053435 Coatomer_WDAD Coatomer WD associated region. This regio 95.68
pfam04184 540 ST7 ST7 protein. The ST7 (for suppression of tumorigeni 93.55
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.56
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR repe 99.53
cd05804355 StaR_like StaR_like; a well-conserved protein found in 98.94
KOG2047 835 consensus 98.7
KOG4340 459 consensus 98.56
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [General fu 98.42
KOG3617 1416 consensus 98.41
KOG2610 491 consensus 98.35
COG3898 531 Uncharacterized membrane-bound protein [Function unknow 98.23
KOG0530318 consensus 97.46
KOG1586288 consensus 97.27
pfam04910343 DUF654 Protein of unknown function, DUF654. This family 96.89
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 96.78
pfam08424231 DUF1740 Protein of unknown function (DUF1740). This is 96.53
PRK10049 818 pgaA outer membrane protein PgaA; Provisional 99.55
KOG0553304 consensus 99.5
CHL00033165 ycf3 photosystem I assembly protein Ycf3 99.19
TIGR02552137 LcrH_SycD type III secretion low calcium response chape 98.9
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR 98.88
pfam09295395 ChAPs ChAPs (Chs5p-Arf1p-binding proteins). ChAPs (Chs5 98.64
KOG0376 476 consensus 98.33
KOG4555175 consensus 98.25
KOG0551390 consensus 98.09
KOG4642284 consensus 98.0
KOG1308377 consensus 97.98
PRK06330 906 transcript cleavage factor/unknown domain fusion protei 97.83
pfam08424231 DUF1740 Protein of unknown function (DUF1740). This is 97.74
PRK04841 903 transcriptional regulator MalT; Provisional 97.63
pfam06552186 TOM20_plant Plant specific mitochondrial import recepto 97.62
COG4649221 Uncharacterized protein conserved in bacteria [Function 97.21
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transferase, 97.06
pfam10300446 IML2 Putative mitochondrial outer membrane protein. Thi 97.03
pfam05843275 Suf Suppressor of forked protein (Suf). This family con 96.8
pfam05843275 Suf Suppressor of forked protein (Suf). This family con 96.75
KOG2396 568 consensus 96.14
KOG1310 758 consensus 95.85
KOG1550552 consensus 95.61
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and polyaden 95.08
pfam09613156 HrpB1_HrpK Bacterial type III secretion protein (HrpB1_ 94.88
COG5191 435 Uncharacterized conserved protein, contains HAT (Half-A 94.68
KOG3783546 consensus 92.17
PRK13184 933 pknD serine/threonine-protein kinase; Reviewed 91.2
pfam10255 402 Paf67 RNA polymerase I-associated factor PAF67. RNA pol 90.84
KOG0553304 consensus 99.45
PRK10370206 formate-dependent nitrite reductase complex subunit Nrf 99.42
cd00189100 TPR Tetratricopeptide repeat domain; typically contains 99.37
PRK10370206 formate-dependent nitrite reductase complex subunit Nrf 99.32
COG4235287 Cytochrome c biogenesis factor [Posttranslational modif 99.13
CHL00033165 ycf3 photosystem I assembly protein Ycf3 99.06
TIGR02552137 LcrH_SycD type III secretion low calcium response chape 98.97
pfam09295395 ChAPs ChAPs (Chs5p-Arf1p-binding proteins). ChAPs (Chs5 98.6
KOG0376 476 consensus 98.02
KOG4642284 consensus 97.71
KOG1308377 consensus 97.49
pfam03704146 BTAD Bacterial transcriptional activator domain. Found 97.14
pfam06552186 TOM20_plant Plant specific mitochondrial import recepto 97.1
KOG1310 758 consensus 95.78
KOG0529421 consensus 91.09
pfam10602174 RPN7 26S proteasome subunit RPN7. RPN7 (known as the no 90.09
cd00189100 TPR Tetratricopeptide repeat domain; typically contains 99.42
PRK10803262 hypothetical protein; Provisional 99.16
COG1729262 Uncharacterized protein conserved in bacteria [Function 98.99
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR 98.96
KOG0543397 consensus 98.89
KOG4648 536 consensus 98.65
KOG4234271 consensus 98.3
KOG4555175 consensus 98.06
KOG0545329 consensus 97.97
PRK10153512 DNA-binding transcriptional activator CadC; Provisional 97.59
PRK10941269 putative transcriptional regulator; Provisional 96.96
TIGR02561190 HrpB1_HrpK type III secretion protein HrpB1/HrpK; Inter 96.21
COG4649221 Uncharacterized protein conserved in bacteria [Function 95.04
pfam09613156 HrpB1_HrpK Bacterial type III secretion protein (HrpB1_ 94.73
pfam11207203 DUF2989 Protein of unknown function (DUF2989). Some mem 92.36
KOG2376 652 consensus 99.02
KOG3824 472 consensus 97.26
KOG2396 568 consensus 96.87
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 96.04
COG5191435 Uncharacterized conserved protein, contains HAT (Half-A 95.2
KOG1464 440 consensus 92.05
pfam09670379 Cas_Cas02710 CRISPR-associated protein (Cas_Cas02710). 90.57
COG3014 449 Uncharacterized protein conserved in bacteria [Function 90.48
KOG3785 557 consensus 99.01
COG2976207 Uncharacterized protein conserved in bacteria [Function 97.72
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transferase, 96.94
PRK10803262 hypothetical protein; Provisional 98.9
COG1729262 Uncharacterized protein conserved in bacteria [Function 98.57
KOG4234271 consensus 98.39
COG2976207 Uncharacterized protein conserved in bacteria [Function 97.97
KOG0545329 consensus 97.74
KOG2796366 consensus 98.24
KOG18391236 consensus 96.47
PRK04841 903 transcriptional regulator MalT; Provisional 98.01
PRK10153512 DNA-binding transcriptional activator CadC; Provisional 97.77
pfam02259351 FAT FAT domain. The FAT domain is named after FRAP, ATM 97.57
pfam03704146 BTAD Bacterial transcriptional activator domain. Found 97.45
PRK10941269 putative transcriptional regulator; Provisional 97.32
KOG2471 696 consensus 97.18
KOG3364149 consensus 95.12
pfam04781112 DUF627 Protein of unknown function (DUF627). This famil 94.92
COG2912269 Uncharacterized conserved protein [Function unknown] 94.0
COG3629280 DnrI DNA-binding transcriptional activator of the SARP 93.91
KOG0546372 consensus 93.32
pfam09797365 NatB_MDM20 N-acetyltransferase B complex (NatB) non cat 91.53
pfam09986214 DUF2225 Uncharacterized protein conserved in bacteria ( 90.21
KOG2471696 consensus 97.87
COG3107 604 LppC Putative lipoprotein [General function prediction 97.75
KOG3824 472 consensus 97.09
KOG4507 886 consensus 97.14
KOG0276794 consensus 93.29
KOG3616 1636 consensus 96.65
pfam0051534 TPR_1 Tetratricopeptide repeat. 96.12
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 4 or 95.28
pfam0771934 TPR_2 Tetratricopeptide repeat. This Pfam entry include 94.69
KOG3616 1636 consensus 94.45
pfam0051534 TPR_1 Tetratricopeptide repeat. 96.3
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 4 or 95.65
KOG2041 1189 consensus 95.47
pfam0771934 TPR_2 Tetratricopeptide repeat. This Pfam entry include 95.03
pfam04781112 DUF627 Protein of unknown function (DUF627). This famil 94.97
KOG1538 1081 consensus 91.81
pfam00637139 Clathrin Region in Clathrin and VPS. Each region is abo 91.07
pfam04348 535 LppC LppC putative lipoprotein. This family includes se 95.78
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 94.67
KOG4814 872 consensus 93.07
COG4259121 Uncharacterized protein conserved in bacteria [Function 95.42
TIGR00540409 hemY_coli hemY protein; InterPro: IPR005254 This is a f 92.69
>KOG4626 consensus Back     alignment and domain information
>KOG4626 consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria Back     alignment and domain information
>KOG1126 consensus Back     alignment and domain information
>KOG1125 consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1126 consensus Back     alignment and domain information
>KOG1155 consensus Back     alignment and domain information
>KOG0547 consensus Back     alignment and domain information
>KOG0547 consensus Back     alignment and domain information
>KOG1155 consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11788 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>KOG1129 consensus Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>KOG1173 consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>KOG1125 consensus Back     alignment and domain information
>KOG2076 consensus Back     alignment and domain information
>KOG2002 consensus Back     alignment and domain information
>KOG1129 consensus Back     alignment and domain information
>KOG1173 consensus Back     alignment and domain information
>KOG2003 consensus Back     alignment and domain information
>KOG1840 consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Back     alignment and domain information
>KOG0495 consensus Back     alignment and domain information
>KOG2003 consensus Back     alignment and domain information
>PRK11788 hypothetical protein; Provisional Back     alignment and domain information
>KOG0495 consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4162 consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>KOG0548 consensus Back     alignment and domain information
>KOG1174 consensus Back     alignment and domain information
>KOG2076 consensus Back     alignment and domain information
>KOG0548 consensus Back     alignment and domain information
>KOG1127 consensus Back     alignment and domain information
>KOG1128 consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4162 consensus Back     alignment and domain information
>KOG1156 consensus Back     alignment and domain information
>KOG1128 consensus Back     alignment and domain information
>KOG1127 consensus Back     alignment and domain information
>KOG2376 consensus Back     alignment and domain information
>KOG3060 consensus Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>KOG1156 consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam04733 Coatomer_E Coatomer epsilon subunit Back     alignment and domain information
>KOG4340 consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2053 consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>pfam04733 Coatomer_E Coatomer epsilon subunit Back     alignment and domain information
>KOG4648 consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Back     alignment and domain information
>KOG1070 consensus Back     alignment and domain information
>KOG1070 consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1130 consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus Back     alignment and domain information
>KOG3785 consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2053 consensus Back     alignment and domain information
>KOG2047 consensus Back     alignment and domain information
>KOG3081 consensus Back     alignment and domain information
>KOG3081 consensus Back     alignment and domain information
>KOG1941 consensus Back     alignment and domain information
>KOG1941 consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Back     alignment and domain information
>KOG2796 consensus Back     alignment and domain information
>KOG1914 consensus Back     alignment and domain information
>KOG1585 consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK06330 transcript cleavage factor/unknown domain fusion protein; Validated Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Back     alignment and domain information
>KOG1585 consensus Back     alignment and domain information
>KOG1258 consensus Back     alignment and domain information
>KOG1550 consensus Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Back     alignment and domain information
>pfam04053 Coatomer_WDAD Coatomer WD associated region Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2300 consensus Back     alignment and domain information
>KOG0985 consensus Back     alignment and domain information
>KOG1586 consensus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW Back     alignment and domain information
>KOG2002 consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>pfam10300 IML2 Putative mitochondrial outer membrane protein Back     alignment and domain information
>KOG0551 consensus Back     alignment and domain information
>KOG4507 consensus Back     alignment and domain information
>KOG1258 consensus Back     alignment and domain information
>pfam02259 FAT FAT domain Back     alignment and domain information
>KOG1839 consensus Back     alignment and domain information
>KOG1174 consensus Back     alignment and domain information
>KOG3060 consensus Back     alignment and domain information
>KOG2610 consensus Back     alignment and domain information
>KOG3617 consensus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1914 consensus Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>pfam04053 Coatomer_WDAD Coatomer WD associated region Back     alignment and domain information
>pfam04184 ST7 ST7 protein Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2047 consensus Back     alignment and domain information
>KOG4340 consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3617 consensus Back     alignment and domain information
>KOG2610 consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0530 consensus Back     alignment and domain information
>KOG1586 consensus Back     alignment and domain information
>pfam04910 DUF654 Protein of unknown function, DUF654 Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>pfam08424 DUF1740 Protein of unknown function (DUF1740) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0553 consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD; InterPro: IPR005415 The type III secretion system of Gram-negative bacteria is used to transport virulence factors from the pathogen directly into the host cell and is only triggered when the bacterium comes into close contact with the host Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR014162 Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane Back     alignment and domain information
>pfam09295 ChAPs ChAPs (Chs5p-Arf1p-binding proteins) Back     alignment and domain information
>KOG0376 consensus Back     alignment and domain information
>KOG4555 consensus Back     alignment and domain information
>KOG0551 consensus Back     alignment and domain information
>KOG4642 consensus Back     alignment and domain information
>KOG1308 consensus Back     alignment and domain information
>PRK06330 transcript cleavage factor/unknown domain fusion protein; Validated Back     alignment and domain information
>pfam08424 DUF1740 Protein of unknown function (DUF1740) Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>pfam06552 TOM20_plant Plant specific mitochondrial import receptor subunit TOM20 Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back