254780593

254780593

undecaprenyl pyrophosphate phosphatase

GeneID in NCBI database:8209590Locus tag:CLIBASIA_02400
Protein GI in NCBI database:254780593Protein Accession:YP_003065006.1
Gene range:+(690508, 691308)Protein Length:266aa
Gene description:undecaprenyl pyrophosphate phosphatase
COG prediction:[V] Uncharacterized bacitracin resistance protein
KEGG prediction:bacA; undecaprenyl pyrophosphate phosphatase (EC:3.6.1.27); K06153 undecaprenyl-diphosphatase [EC:3.6.1.27]
SEED prediction:Undecaprenyl-diphosphatase (EC 3.6.1.27)
Pathway involved in KEGG:Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM7 TM-Helix
TOPPRED8 TM-Helix
HMMTOP8 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM8 TM-Helix
PHOBIUS7 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYVYFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMIIIHITLIIGGFILLLVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGTSRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP
ccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHcHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcc
MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYVYFGRILSIFvsfpfsaaaRHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMIIIHITLIIGGFILLLVDRLKfeskyfhienypipLAIKIGLFQciamipgtsrsgatITGALILGADkrsaaefsffiAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP
MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYVYFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMIIIHITLIIGGFILLLVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGTSRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP
MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYVYFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMiiihitliiggfilllVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGTSRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP
MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYVYFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMIIIHITLIIGGFILLLVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGTSRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP
MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYVYFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMIIIHITLIIGGFILLLVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGTSRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP
MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYVYFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMIIIHITLIIGGFILLLVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGTSRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxx
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoo
ooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHooo
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYVYFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMIIIHITLIIGGFILLLVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGTSRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP
MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYVYFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMIIIHITLIIGGFILLLVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGTSRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP
MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYVYFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMIIIHITLIIGGFILLLVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGTSRSGATITGALILGADKRSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVIAKRGYTPFALWRILIGFVGLFLEIFP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target266 undecaprenyl pyrophosphate phosphatase [Candidatus Libe
315121793266 undecaprenyl pyrophosphate phosphatase [Candidatus Libe 1 1e-101
15887643268 undecaprenyl pyrophosphate phosphatase [Agrobacterium t 1 4e-76
222084593266 undecaprenol kinase [Agrobacterium radiobacter K84] Len 1 1e-75
222147275268 undecaprenyl pyrophosphate phosphatase [Agrobacterium v 1 2e-75
325291728268 undecaprenyl pyrophosphate phosphatase [Agrobacterium s 1 2e-73
227824167268 undecaprenyl pyrophosphate phosphatase [Sinorhizobium f 1 6e-72
254470772269 undecaprenol kinase, putative [Pseudovibrio sp. JE062] 1 7e-69
150398720268 undecaprenyl pyrophosphate phosphatase [Sinorhizobium m 1 2e-68
118589446268 undecaprenyl pyrophosphate phosphatase [Stappia aggrega 1 2e-67
295691426266 undecaprenol kinase [Caulobacter segnis ATCC 21756] Len 1 2e-67
>gi|315121793|ref|YP_004062282.1| undecaprenyl pyrophosphate phosphatase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 266 Back     alignment and organism information
 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/263 (71%), Positives = 219/263 (83%)

Query: 1   MLRYSIIIALILGVVEGVTEFIPVSSTAHLLLVSRLLGADLGSSFIVLVQLGAVSALLYV 60
           M   SII ALILG VEG+TEFIPVSSTAHLLL SR LG DLGSSF +LVQLGAV ALLYV
Sbjct: 1   MFESSIIFALILGFVEGITEFIPVSSTAHLLLASRFLGVDLGSSFTILVQLGAVLALLYV 60

Query: 61  YFGRILSIFVSFPFSAAARHFTITLFLGFFPTVVCGFFAYNFIKSILFKEMIIIHITLII 120
           YF RI+ IF SFP+ +++RHF I LF GF P  + GFFA+ FIKSILFKE I+I+I+LI+
Sbjct: 61  YFHRIIYIFFSFPYDSSSRHFAIILFFGFLPAGILGFFAHYFIKSILFKETIVIYISLIV 120

Query: 121 GGFILLLVDRLKFESKYFHIENYPIPLAIKIGLFQCIAMIPGTSRSGATITGALILGADK 180
           GGFILL VDR+ F+SKYF I+NYP+ LAIKIG FQC+AMIPGTSRSGATI GA++LGADK
Sbjct: 121 GGFILLAVDRIHFQSKYFDIKNYPLLLAIKIGFFQCLAMIPGTSRSGATIVGAIVLGADK 180

Query: 181 RSAAEFSFFIAIPTIIGACVLDFYKNYNVIVNNIGKEIIIGFMASFITSLLVIRSLFQVI 240
           RSAAEFSFF+AIPT+IGAC LD YKNY  IVN +   IIIG +ASFITSL+V+R L  +I
Sbjct: 181 RSAAEFSFFLAIPTMIGACALDSYKNYTSIVNEMRSAIIIGCLASFITSLIVVRFLLNLI 240

Query: 241 AKRGYTPFALWRILIGFVGLFLE 263
           +KRGYTPFA+WRI+IG +GL  E
Sbjct: 241 SKRGYTPFAVWRIMIGLIGLISE 263


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15887643|ref|NP_353324.1| undecaprenyl pyrophosphate phosphatase [Agrobacterium tumefaciens str. C58] Length = 268 Back     alignment and organism information
>gi|222084593|ref|YP_002543122.1| undecaprenol kinase [Agrobacterium radiobacter K84] Length = 266 Back     alignment and organism information
>gi|222147275|ref|YP_002548232.1| undecaprenyl pyrophosphate phosphatase [Agrobacterium vitis S4] Length = 268 Back     alignment and organism information
>gi|325291728|ref|YP_004277592.1| undecaprenyl pyrophosphate phosphatase [Agrobacterium sp. H13-3] Length = 268 Back     alignment and organism information
>gi|227824167|ref|YP_002828140.1| undecaprenyl pyrophosphate phosphatase [Sinorhizobium fredii NGR234] Length = 268 Back     alignment and organism information
>gi|254470772|ref|ZP_05084175.1| undecaprenol kinase, putative [Pseudovibrio sp. JE062] Length = 269 Back     alignment and organism information
>gi|150398720|ref|YP_001329187.1| undecaprenyl pyrophosphate phosphatase [Sinorhizobium medicae WSM419] Length = 268 Back     alignment and organism information
>gi|118589446|ref|ZP_01546852.1| undecaprenyl pyrophosphate phosphatase [Stappia aggregata IAM 12614] Length = 268 Back     alignment and organism information
>gi|295691426|ref|YP_003595119.1| undecaprenol kinase [Caulobacter segnis ATCC 21756] Length = 266 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target266 undecaprenyl pyrophosphate phosphatase [Candidatus Libe
PRK00281268 PRK00281, PRK00281, undecaprenyl pyrophosphate phosphat 9e-63
COG1968270 COG1968, BacA, Uncharacterized bacitracin resistance pr 5e-49
PRK12554276 PRK12554, PRK12554, undecaprenyl pyrophosphate phosphat 7e-47
TIGR00753255 TIGR00753, undec_PP_bacA, undecaprenyl-diphosphatase Up 1e-40
pfam02673255 pfam02673, BacA, Bacitracin resistance protein BacA 4e-59
>gnl|CDD|178958 PRK00281, PRK00281, undecaprenyl pyrophosphate phosphatase; Reviewed Back     alignment and domain information
>gnl|CDD|32151 COG1968, BacA, Uncharacterized bacitracin resistance protein [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|183590 PRK12554, PRK12554, undecaprenyl pyrophosphate phosphatase; Reviewed Back     alignment and domain information
>gnl|CDD|129836 TIGR00753, undec_PP_bacA, undecaprenyl-diphosphatase UppP Back     alignment and domain information
>gnl|CDD|145692 pfam02673, BacA, Bacitracin resistance protein BacA Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 266 undecaprenyl pyrophosphate phosphatase [Candidatus Libe
PRK12554277 undecaprenyl pyrophosphate phosphatase; Reviewed 100.0
PRK00281268 undecaprenyl pyrophosphate phosphatase; Reviewed 100.0
COG1968270 BacA Undecaprenyl pyrophosphate phosphatase [Lipid tran 100.0
pfam02673255 BacA Bacitracin resistance protein BacA. Bacitracin res 100.0
TIGR00753269 undec_kin_bacA undecaprenol kinase, putative; InterPro: 100.0
pfam01925236 TauE Sulfite exporter TauE/SafE. This is a family of in 96.74
PRK12554277 undecaprenyl pyrophosphate phosphatase; Reviewed 94.58
COG1968270 BacA Undecaprenyl pyrophosphate phosphatase [Lipid tran 93.86
>PRK12554 undecaprenyl pyrophosphate phosphatase; Reviewed Back     alignment and domain information
>PRK00281 undecaprenyl pyrophosphate phosphatase; Reviewed Back     alignment and domain information
>COG1968 BacA Undecaprenyl pyrophosphate phosphatase [Lipid transport and metabolism] Back     alignment and domain information
>pfam02673 BacA Bacitracin resistance protein BacA Back     alignment and domain information
>TIGR00753 undec_kin_bacA undecaprenol kinase, putative; InterPro: IPR003824 Bacitracin resistance protein (BacA) may confer resistance to bacitracin by phosphorylation of undecaprenol Back     alignment and domain information
>pfam01925 TauE Sulfite exporter TauE/SafE Back     alignment and domain information
>PRK12554 undecaprenyl pyrophosphate phosphatase; Reviewed Back     alignment and domain information
>COG1968 BacA Undecaprenyl pyrophosphate phosphatase [Lipid transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00