254780602

254780602

aspartate aminotransferase

GeneID in NCBI database:8209599Locus tag:CLIBASIA_02445
Protein GI in NCBI database:254780602Protein Accession:YP_003065015.1
Gene range:+(677746, 678948)Protein Length:400aa
Gene description:aspartate aminotransferase
COG prediction:[E] Aspartate/tyrosine/aromatic aminotransferase
KEGG prediction:attA; aspartate aminotransferase (EC:2.6.1.1); K00812 aspartate aminotransferase [EC:2.6.1.1]
SEED prediction:Aspartate aminotransferase (EC 2.6.1.1)
Pathway involved in KEGG:Alanine, aspartate and glutamate metabolism [PATH:las00250]
Cysteine and methionine metabolism [PATH:las00270]
Arginine and proline metabolism [PATH:las00330]
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:las00400]
Novobiocin biosynthesis
Subsystem involved in SEED:Threonine and Homoserine Biosynthesis;
Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400
MVFISNILRRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDMPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFCHSLQ
cccHHHHHHHccccHHHHHHHHHHHHHHcccccEEcccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccHHHEEEEccHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHcccEEEEEEccccccccccHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHcccccccEEEEcccHHHcccccccEEEEEEcHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccEEEEEEcccccccHHHHHHHcccHHHHHHHHHHHccEEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHcc
cHHccHHHHcccccHHHHHHHHHHHHHHcccccEEcccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccHHHEEEEcHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHcccEEEEEEccHHHcccccHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHccEEEEEEccccccEccccccccHHHccHHHHHcEEEEEEcccccccHHHccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccEcccccEccEEccEHHHHHccccccccEEccHHHHHHHHHHHHcEEcEEHHHHccccEEEEEccccHHHHHHHHHHHHHHHcccc
MVFISNIlrrvqpsaTLVAAQRVRDLRSKGIDVlcltagepdfdmpeNVKYAVVRAMERGETKYTAVAGISPLREAIVEKFrrdndlhytsdqiiVGTGAKHVIFNALMATVnmgdevliprpywvsypdmvalcggipvfvdtqqddnfqvspekleqaitpktkwlflnspsnpsgvvysQNRLRALADVLVrnphvhiisddiYEHIVYRncqfsnivnvepslyerTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEalngpqdfvvnnRKIFEYRRDLCVAQlqgvpgirymipdgafylypscqdligkkspsgdvirtdLDFVNGLLEIEKVAVVqgssfghgpsiRISYAVSDAILEEACVRIKRFCHSLQ
mvfisnilrrvqpsatlvaAQRVRDLRSKGIDVLCLtagepdfdmpenVKYAVVRAMERGEtkytavagisplREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVvqgssfghgpSIRISYAVSDAILEEACVRIKRFCHSLQ
MVFISNILRRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDMPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFCHSLQ
****SNI*RRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDMPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFCHSLQ
MVFISNILRRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDMPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFCHSLQ
*VFISNILRRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDMPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFCHSLQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFISNILRRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDMPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFCHSLQ
MVFISNILRRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDMPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFCHSLQ
MVFISNILRRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDMPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFCHSLQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target400 aspartate aminotransferase [Candidatus Liberibacter asi
325293555400 aspartate aminotransferase A [Agrobacterium sp. H13-3] 1 1e-155
254708160400 aspartate aminotransferase [Brucella pinnipedialis M163 1 1e-154
239832373400 Aspartate aminotransferase [Ochrobactrum intermedium LM 1 1e-154
153009002400 aspartate aminotransferase [Ochrobactrum anthropi ATCC 1 1e-154
306843155400 aspartate aminotransferase [Brucella sp. BO2] Length = 1 1e-153
225627938421 Aspartate aminotransferase [Brucella ceti str. Cudo] Le 1 1e-153
15889474400 aspartate aminotransferase [Agrobacterium tumefaciens s 1 1e-153
62290384400 aspartate aminotransferase [Brucella abortus bv. 1 str. 1 1e-153
15966078400 aspartate aminotransferase [Sinorhizobium meliloti 1021 1 1e-153
23502364400 aspartate aminotransferase [Brucella suis 1330] Length 1 1e-153
>gi|325293555|ref|YP_004279419.1| aspartate aminotransferase A [Agrobacterium sp. H13-3] Length = 400 Back     alignment and organism information
 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 255/396 (64%), Positives = 316/396 (79%)

Query: 1   MVFISNILRRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDMPENVKYAVVRAMERG 60
           M F+++IL RV+PSAT+   Q+ R+L++KG DV+ L AGEPDFD PEN+K A + A++RG
Sbjct: 1   MAFLADILSRVKPSATIAVTQKARELKAKGRDVISLGAGEPDFDTPENIKEAAIDAIKRG 60

Query: 61  ETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLI 120
           ETKYT V+GI  LR+AI +KF+R+N L Y  +Q IVGTG K ++FNA MAT+N GDEV+I
Sbjct: 61  ETKYTPVSGIPELRKAIADKFKRENGLDYKPEQTIVGTGGKQILFNAFMATLNPGDEVVI 120

Query: 121 PRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVV 180
           P PYWVSYP+MVA+CGG PVFVDT  +DNF++ PE LE+AITPKTKW   NSPSNPSG  
Sbjct: 121 PAPYWVSYPEMVAICGGTPVFVDTTLEDNFKLKPEALEKAITPKTKWFVFNSPSNPSGAA 180

Query: 181 YSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKA 240
           YS + L+AL DVLV++PHV +++DD+YEH+ Y + +F   V VEPSLY+RTL +NGVSKA
Sbjct: 181 YSHDELKALTDVLVKHPHVWVLTDDMYEHLTYGDFKFVTPVEVEPSLYDRTLTMNGVSKA 240

Query: 241 YAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEY 300
           YAMTG RIGYAAG L LIK+M ++QGQQTSGA SIAQWAAVEALNG QDF+  N+KIFE 
Sbjct: 241 YAMTGWRIGYAAGPLPLIKAMDMIQGQQTSGASSIAQWAAVEALNGTQDFIPANKKIFEG 300

Query: 301 RRDLCVAQLQGVPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKV 360
           RRDL V+ L    GI    P+GAFY+YPSC  +IGK +PSG VI +D+DFV+ LLE E V
Sbjct: 301 RRDLVVSMLNQAKGINCPAPEGAFYVYPSCAGMIGKTAPSGKVIESDVDFVSELLEAEGV 360

Query: 361 AVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFC 396
           AVVQGS+FG GP+ RISYA S+A+LEEAC RI+RFC
Sbjct: 361 AVVQGSAFGLGPNFRISYATSEALLEEACKRIQRFC 396


Species: Agrobacterium sp. H13-3
Genus: Agrobacterium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254708160|ref|ZP_05169988.1| aspartate aminotransferase [Brucella pinnipedialis M163/99/10] Length = 400 Back     alignment and organism information
>gi|239832373|ref|ZP_04680702.1| Aspartate aminotransferase [Ochrobactrum intermedium LMG 3301] Length = 400 Back     alignment and organism information
>gi|153009002|ref|YP_001370217.1| aspartate aminotransferase [Ochrobactrum anthropi ATCC 49188] Length = 400 Back     alignment and organism information
>gi|306843155|ref|ZP_07475775.1| aspartate aminotransferase [Brucella sp. BO2] Length = 400 Back     alignment and organism information
>gi|225627938|ref|ZP_03785974.1| Aspartate aminotransferase [Brucella ceti str. Cudo] Length = 421 Back     alignment and organism information
>gi|15889474|ref|NP_355155.1| aspartate aminotransferase [Agrobacterium tumefaciens str. C58] Length = 400 Back     alignment and organism information
>gi|62290384|ref|YP_222177.1| aspartate aminotransferase [Brucella abortus bv. 1 str. 9-941] Length = 400 Back     alignment and organism information
>gi|15966078|ref|NP_386431.1| aspartate aminotransferase [Sinorhizobium meliloti 1021] Length = 400 Back     alignment and organism information
>gi|23502364|ref|NP_698491.1| aspartate aminotransferase [Brucella suis 1330] Length = 400 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target400 aspartate aminotransferase [Candidatus Liberibacter asi
PRK05764393 PRK05764, PRK05764, aspartate aminotransferase; Provisi 1e-168
PRK06107402 PRK06107, PRK06107, aspartate aminotransferase; Provisi 1e-151
PRK07682378 PRK07682, PRK07682, hypothetical protein; Validated 1e-75
PRK07683387 PRK07683, PRK07683, aminotransferase A; Validated 2e-71
PRK08361391 PRK08361, PRK08361, aspartate aminotransferase; Provisi 8e-63
KOG0257420 KOG0257, KOG0257, KOG0257, Kynurenine aminotransferase, 5e-62
pfam00155351 pfam00155, Aminotran_1_2, Aminotransferase class I and 7e-61
PRK08363398 PRK08363, PRK08363, alanine aminotransferase; Validated 1e-57
PRK06348384 PRK06348, PRK06348, aspartate aminotransferase; Provisi 2e-57
PRK06108382 PRK06108, PRK06108, aspartate aminotransferase; Provisi 4e-51
PRK07337388 PRK07337, PRK07337, aminotransferase; Validated 7e-46
PRK08960387 PRK08960, PRK08960, hypothetical protein; Provisional 8e-45
PRK07777387 PRK07777, PRK07777, aminotransferase; Validated 8e-44
TIGR03540383 TIGR03540, DapC_direct, LL-diaminopimelate aminotransfe 2e-43
PRK09265404 PRK09265, PRK09265, aminotransferase AlaT; Validated 1e-40
TIGR01265403 TIGR01265, tyr_nico_aTase, tyrosine/nicotianamine amino 1e-39
PRK09276385 PRK09276, PRK09276, LL-diaminopimelate aminotransferase 4e-39
KOG0259447 KOG0259, KOG0259, KOG0259, Tyrosine aminotransferase [A 1e-38
PRK13355517 PRK13355, PRK13355, bifunctional HTH-domain containing 3e-34
PRK07681399 PRK07681, PRK07681, aspartate aminotransferase; Provisi 4e-30
COG1167459 COG1167, ARO8, Transcriptional regulators containing a 1e-27
PRK08068389 PRK08068, PRK08068, transaminase; Reviewed 5e-27
PRK08175395 PRK08175, PRK08175, aminotransferase; Validated 3e-26
PRK09148405 PRK09148, PRK09148, aminotransferase; Validated 2e-24
PRK08636403 PRK08636, PRK08636, aspartate aminotransferase; Provisi 2e-23
TIGR03538393 TIGR03538, DapC_gpp, succinyldiaminopimelate transamina 4e-23
PLN00145430 PLN00145, PLN00145, tyrosine/nicotianamine aminotransfe 1e-19
PRK05942394 PRK05942, PRK05942, aspartate aminotransferase; Provisi 6e-18
PRK07366388 PRK07366, PRK07366, succinyldiaminopimelate transaminas 1e-16
PRK05839374 PRK05839, PRK05839, hypothetical protein; Provisional 3e-16
TIGR03542402 TIGR03542, DAPAT_plant, LL-diaminopimelate aminotransfe 2e-10
COG0436393 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotran 4e-99
cd00609350 cd00609, AAT_like, Aspartate aminotransferase family 7e-78
PRK07309391 PRK07309, PRK07309, aromatic amino acid aminotransferas 2e-64
PRK06836394 PRK06836, PRK06836, aspartate aminotransferase; Provisi 4e-51
PRK05957389 PRK05957, PRK05957, aspartate aminotransferase; Provisi 2e-46
PRK09082386 PRK09082, PRK09082, methionine aminotransferase; Valida 5e-42
PRK12414384 PRK12414, PRK12414, putative aminotransferase; Provisio 3e-41
TIGR01264401 TIGR01264, tyr_amTase_E, tyrosine aminotransferase, euk 4e-38
PLN00175413 PLN00175, PLN00175, aminotransferase family protein; Pr 5e-38
PRK08912387 PRK08912, PRK08912, hypothetical protein; Provisional 4e-36
COG1168388 COG1168, MalY, Bifunctional PLP-dependent enzyme with b 2e-29
PTZ00433412 PTZ00433, PTZ00433, tyrosine aminotransferase; Provisio 3e-29
TIGR03537350 TIGR03537, DapC, succinyldiaminopimelate transaminase 6e-26
PRK07550386 PRK07550, PRK07550, hypothetical protein; Provisional 2e-23
PRK06207405 PRK06207, PRK06207, aspartate aminotransferase; Provisi 1e-22
COG0079356 COG0079, HisC, Histidinol-phosphate/aromatic aminotrans 3e-22
PLN02187462 PLN02187, PLN02187, rooty/superroot1 2e-19
PRK09147396 PRK09147, PRK09147, succinyldiaminopimelate transaminas 2e-19
PRK07324373 PRK07324, PRK07324, transaminase; Validated 4e-19
PRK06225380 PRK06225, PRK06225, aspartate aminotransferase; Provisi 8e-18
PLN02656409 PLN02656, PLN02656, tyrosine transaminase 1e-17
PLN00143409 PLN00143, PLN00143, tyrosine/nicotianamine aminotransfe 2e-17
KOG0634472 KOG0634, KOG0634, KOG0634, Aromatic amino acid aminotra 8e-13
PTZ00377481 PTZ00377, PTZ00377, alanine aminotransferase; Provision 4e-09
KOG0258475 KOG0258, KOG0258, KOG0258, Alanine aminotransferase [Am 4e-08
COG3977417 COG3977, COG3977, Alanine-alpha-ketoisovalerate (or val 1e-07
PRK09440416 PRK09440, avtA, valine--pyruvate transaminase; Provisio 3e-07
PLN02231534 PLN02231, PLN02231, alanine transaminase 4e-07
PRK07568397 PRK07568, PRK07568, aspartate aminotransferase; Provisi 2e-46
TIGR01141346 TIGR01141, hisC, histidinol-phosphate aminotransferase 9e-20
PRK06290410 PRK06290, PRK06290, aspartate aminotransferase; Provisi 2e-14
PRK14807351 PRK14807, PRK14807, histidinol-phosphate aminotransfera 5e-13
PRK07865364 PRK07865, PRK07865, N-succinyldiaminopimelate aminotran 1e-11
TIGR03539357 TIGR03539, DapC_actino, succinyldiaminopimelate transam 1e-11
PRK02610374 PRK02610, PRK02610, histidinol-phosphate aminotransfera 3e-10
KOG0633375 KOG0633, KOG0633, KOG0633, Histidinol phosphate aminotr 2e-08
PRK06855433 PRK06855, PRK06855, aminotransferase; Validated 4e-06
KOG0256471 KOG0256, KOG0256, KOG0256, 1-aminocyclopropane-1-carbox 2e-18
PLN02607447 PLN02607, PLN02607, 1-aminocyclopropane-1-carboxylate s 2e-13
PRK00950361 PRK00950, PRK00950, histidinol-phosphate aminotransfera 9e-17
PRK02731367 PRK02731, PRK02731, histidinol-phosphate aminotransfera 5e-16
PRK03321352 PRK03321, PRK03321, putative aminotransferase; Provisio 8e-15
PRK06358354 PRK06358, PRK06358, threonine-phosphate decarboxylase; 2e-11
PLN02376496 PLN02376, PLN02376, 1-aminocyclopropane-1-carboxylate s 3e-10
PLN02450468 PLN02450, PLN02450, 1-aminocyclopropane-1-carboxylate s 1e-09
PRK05166371 PRK05166, PRK05166, histidinol-phosphate aminotransfera 2e-09
PRK03158359 PRK03158, PRK03158, histidinol-phosphate aminotransfera 4e-09
PRK08637388 PRK08637, PRK08637, hypothetical protein; Provisional 8e-09
PRK01533366 PRK01533, PRK01533, histidinol-phosphate aminotransfera 2e-08
PRK05387353 PRK05387, PRK05387, histidinol-phosphate aminotransfera 4e-04
PRK07392360 PRK07392, PRK07392, threonine-phosphate decarboxylase; 5e-04
PLN03026380 PLN03026, PLN03026, histidinol-phosphate aminotransfera 7e-12
TIGR01140330 TIGR01140, L_thr_O3P_dcar, L-threonine-O-3-phosphate de 1e-09
PRK04781364 PRK04781, PRK04781, histidinol-phosphate aminotransfera 1e-04
PRK03967337 PRK03967, PRK03967, histidinol-phosphate aminotransfera 8e-12
PRK11658379 PRK11658, PRK11658, UDP-4-amino-4-deoxy-L-arabinose--ox 3e-11
cd00616352 cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid syntha 7e-11
COG0399374 COG0399, WecE, Predicted pyridoxal phosphate-dependent 1e-10
pfam01041363 pfam01041, DegT_DnrJ_EryC1, DegT/DnrJ/EryC1/StrS aminot 1e-10
PRK11706375 PRK11706, PRK11706, TDP-4-oxo-6-deoxy-D-glucose transam 7e-08
TIGR02379376 TIGR02379, ECA_wecE, TDP-4-keto-6-deoxy-D-glucose trans 8e-07
pfam01053381 pfam01053, Cys_Met_Meta_PP, Cys/Met metabolism PLP-depe 8e-06
cd00614369 cd00614, CGS_like, CGS_like: Cystathionine gamma-syntha 2e-04
PRK15481431 PRK15481, PRK15481, transcriptional regulatory protein 2e-04
COG0626396 COG0626, MetC, Cystathionine beta-lyases/cystathionine 6e-04
cd00615294 cd00615, Orn_deC_like, Ornithine decarboxylase family 8e-04
PRK05994427 PRK05994, PRK05994, O-acetylhomoserine aminocarboxyprop 0.001
PRK09275527 PRK09275, PRK09275, aspartate aminotransferase; Provisi 2e-10
PRK14809357 PRK14809, PRK14809, histidinol-phosphate aminotransfera 3e-09
TIGR03801521 TIGR03801, asp_4_decarbox, aspartate 4-decarboxylase 2e-08
PRK08354311 PRK08354, PRK08354, putative aminotransferase; Provisio 5e-06
KOG0053409 KOG0053, KOG0053, KOG0053, Cystathionine beta-lyases/cy 0.003
PLN02368407 PLN02368, PLN02368, alanine transaminase 5e-05
COG0520405 COG0520, CsdB, Selenocysteine lyase [Amino acid transpo 0.002
PRK08056356 PRK08056, PRK08056, threonine-phosphate decarboxylase; 9e-05
PRK03317368 PRK03317, PRK03317, histidinol-phosphate aminotransfera 0.002
PRK08247366 PRK08247, PRK08247, cystathionine gamma-synthase; Revie 4e-04
PRK15407438 PRK15407, PRK15407, lipopolysaccharide biosynthesis pro 0.003
PRK08153369 PRK08153, PRK08153, histidinol-phosphate aminotransfera 7e-04
>gnl|CDD|180244 PRK05764, PRK05764, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180403 PRK06107, PRK06107, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181082 PRK07682, PRK07682, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|181083 PRK07683, PRK07683, aminotransferase A; Validated Back     alignment and domain information
>gnl|CDD|169403 PRK08361, PRK08361, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|35478 KOG0257, KOG0257, KOG0257, Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143923 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|181402 PRK08363, PRK08363, alanine aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180537 PRK06348, PRK06348, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180404 PRK06108, PRK06108, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180937 PRK07337, PRK07337, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181595 PRK08960, PRK08960, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181114 PRK07777, PRK07777, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|163315 TIGR03540, DapC_direct, LL-diaminopimelate aminotransferase Back     alignment and domain information
>gnl|CDD|181738 PRK09265, PRK09265, aminotransferase AlaT; Validated Back     alignment and domain information
>gnl|CDD|130332 TIGR01265, tyr_nico_aTase, tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>gnl|CDD|181749 PRK09276, PRK09276, LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|35480 KOG0259, KOG0259, KOG0259, Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183994 PRK13355, PRK13355, bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181081 PRK07681, PRK07681, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|31361 COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181219 PRK08068, PRK08068, transaminase; Reviewed Back     alignment and domain information
>gnl|CDD|181268 PRK08175, PRK08175, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181674 PRK09148, PRK09148, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181511 PRK08636, PRK08636, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|163314 TIGR03538, DapC_gpp, succinyldiaminopimelate transaminase Back     alignment and domain information
>gnl|CDD|177749 PLN00145, PLN00145, tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180317 PRK05942, PRK05942, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180947 PRK07366, PRK07366, succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>gnl|CDD|180281 PRK05839, PRK05839, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|163316 TIGR03542, DAPAT_plant, LL-diaminopimelate aminotransferase Back     alignment and domain information
>gnl|CDD|30785 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|180923 PRK07309, PRK07309, aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180720 PRK06836, PRK06836, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|168313 PRK05957, PRK05957, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181642 PRK09082, PRK09082, methionine aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|183514 PRK12414, PRK12414, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|130331 TIGR01264, tyr_amTase_E, tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>gnl|CDD|177770 PLN00175, PLN00175, aminotransferase family protein; Provisional Back     alignment and domain information
>gnl|CDD|181580 PRK08912, PRK08912, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|31362 COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185613 PTZ00433, PTZ00433, tyrosine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|163313 TIGR03537, DapC, succinyldiaminopimelate transaminase Back     alignment and domain information
>gnl|CDD|181026 PRK07550, PRK07550, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180469 PRK06207, PRK06207, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|30428 COG0079, HisC, Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|177839 PLN02187, PLN02187, rooty/superroot1 Back     alignment and domain information
>gnl|CDD|181673 PRK09147, PRK09147, succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|180929 PRK07324, PRK07324, transaminase; Validated Back     alignment and domain information
>gnl|CDD|180479 PRK06225, PRK06225, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|178262 PLN02656, PLN02656, tyrosine transaminase Back     alignment and domain information
>gnl|CDD|165711 PLN00143, PLN00143, tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|35853 KOG0634, KOG0634, KOG0634, Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185585 PTZ00377, PTZ00377, alanine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|35479 KOG0258, KOG0258, KOG0258, Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33757 COG3977, COG3977, Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181860 PRK09440, avtA, valine--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|177876 PLN02231, PLN02231, alanine transaminase Back     alignment and domain information
>gnl|CDD|181036 PRK07568, PRK07568, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|162223 TIGR01141, hisC, histidinol-phosphate aminotransferase Back     alignment and domain information
>gnl|CDD|180514 PRK06290, PRK06290, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184829 PRK14807, PRK14807, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181151 PRK07865, PRK07865, N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|132578 TIGR03539, DapC_actino, succinyldiaminopimelate transaminase Back     alignment and domain information
>gnl|CDD|179449 PRK02610, PRK02610, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|35852 KOG0633, KOG0633, KOG0633, Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180734 PRK06855, PRK06855, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|35477 KOG0256, KOG0256, KOG0256, 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|178217 PLN02607, PLN02607, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|179178 PRK00950, PRK00950, histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|179465 PRK02731, PRK02731, histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|179559 PRK03321, PRK03321, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180542 PRK06358, PRK06358, threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|178004 PLN02376, PLN02376, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|178069 PLN02450, PLN02450, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|179950 PRK05166, PRK05166, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179546 PRK03158, PRK03158, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181512 PRK08637, PRK08637, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|134568 PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180050 PRK05387, PRK05387, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180956 PRK07392, PRK07392, threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>gnl|CDD|178597 PLN03026, PLN03026, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|162222 TIGR01140, L_thr_O3P_dcar, L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>gnl|CDD|179878 PRK04781, PRK04781, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|167650 PRK03967, PRK03967, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183263 PRK11658, PRK11658, UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|99740 cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>gnl|CDD|30748 COG0399, WecE, Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144581 pfam01041, DegT_DnrJ_EryC1, DegT/DnrJ/EryC1/StrS aminotransferase family Back     alignment and domain information
>gnl|CDD|183283 PRK11706, PRK11706, TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>gnl|CDD|131432 TIGR02379, ECA_wecE, TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>gnl|CDD|144590 pfam01053, Cys_Met_Meta_PP, Cys/Met metabolism PLP-dependent enzyme Back     alignment and domain information
>gnl|CDD|99738 cd00614, CGS_like, CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>gnl|CDD|185378 PRK15481, PRK15481, transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>gnl|CDD|30971 COG0626, MetC, Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99739 cd00615, Orn_deC_like, Ornithine decarboxylase family Back     alignment and domain information
>gnl|CDD|180344 PRK05994, PRK05994, O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181748 PRK09275, PRK09275, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|184830 PRK14809, PRK14809, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|163513 TIGR03801, asp_4_decarbox, aspartate 4-decarboxylase Back     alignment and domain information
>gnl|CDD|169399 PRK08354, PRK08354, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|35276 KOG0053, KOG0053, KOG0053, Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|177996 PLN02368, PLN02368, alanine transaminase Back     alignment and domain information
>gnl|CDD|30866 COG0520, CsdB, Selenocysteine lyase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181212 PRK08056, PRK08056, threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|179558 PRK03317, PRK03317, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181320 PRK08247, PRK08247, cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>gnl|CDD|185305 PRK15407, PRK15407, lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>gnl|CDD|181255 PRK08153, PRK08153, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 400 aspartate aminotransferase [Candidatus Liberibacter asi
PRK06507400 consensus 100.0
PRK07543400 consensus 100.0
PRK06107402 aspartate aminotransferase; Provisional 100.0
PRK05764389 aspartate aminotransferase; Provisional 100.0
PRK06575399 consensus 100.0
PRK05794397 consensus 100.0
PRK06056402 consensus 100.0
PRK08069390 consensus 100.0
PRK07310395 consensus 100.0
PRK07367385 consensus 100.0
PRK08443388 consensus 100.0
PRK09148406 aminotransferase; Validated 100.0
PRK05942394 aspartate aminotransferase; Provisional 100.0
PRK08068389 transaminase; Reviewed 100.0
PRK07212378 consensus 100.0
PRK09276385 aspartate aminotransferase; Provisional 100.0
PRK08960387 hypothetical protein; Provisional 100.0
PRK07366388 succinyldiaminopimelate transaminase; Validated 100.0
PRK07568396 aspartate aminotransferase; Provisional 100.0
PRK09265404 aminotransferase AlaT; Validated 100.0
PRK07681399 aspartate aminotransferase; Provisional 100.0
PRK08363398 alanine aminotransferase; Validated 100.0
PRK06290411 aspartate aminotransferase; Provisional 100.0
PRK08175395 aminotransferase; Validated 100.0
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. This c 100.0
PRK07337388 aminotransferase; Validated 100.0
PRK06375381 consensus 100.0
PRK08636403 aspartate aminotransferase; Provisional 100.0
PRK06220384 consensus 100.0
PRK08361390 aspartate aminotransferase; Provisional 100.0
PRK07778386 consensus 100.0
PRK07683387 aminotransferase A; Validated 100.0
PRK08912387 hypothetical protein; Provisional 100.0
PRK06108382 aspartate aminotransferase; Provisional 100.0
PRK06207406 aspartate aminotransferase; Provisional 100.0
PRK06836396 aspartate aminotransferase; Provisional 100.0
PRK06348383 aspartate aminotransferase; Provisional 100.0
PRK08362389 consensus 100.0
PRK05957389 aspartate aminotransferase; Provisional 100.0
PRK09082386 putative aminotransferase; Validated 100.0
PRK07777386 aminotransferase; Validated 100.0
PRK07550387 hypothetical protein; Provisional 100.0
PRK09147397 aminotransferase; Provisional 100.0
PRK07682378 hypothetical protein; Validated 100.0
TIGR03538394 DapC_gpp succinyldiaminopimelate transaminase. This fam 100.0
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amino aci 100.0
PRK12414384 putative aminotransferase; Provisional 100.0
PRK07309390 aromatic amino acid aminotransferase; Validated 100.0
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 100.0
PRK06855433 aminotransferase; Validated 100.0
PRK13355518 bifunctional HTH-domain containing protein/aminotransfe 100.0
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. This c 100.0
PRK05839376 hypothetical protein; Provisional 100.0
TIGR01265424 tyr_nico_aTase tyrosine/nicotianamine aminotransferases 100.0
PRK07865364 N-succinyldiaminopimelate aminotransferase; Reviewed 100.0
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. This 100.0
PRK06225375 aspartate aminotransferase; Provisional 100.0
KOG0257420 consensus 100.0
TIGR01264415 tyr_amTase_E tyrosine aminotransferase; InterPro: IPR00 100.0
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-cystat 100.0
PRK00950369 histidinol-phosphate aminotransferase; Validated 100.0
PRK03566365 consensus 100.0
PRK02731367 histidinol-phosphate aminotransferase; Validated 100.0
PRK03158359 histidinol-phosphate aminotransferase; Provisional 100.0
PRK05166374 histidinol-phosphate aminotransferase; Provisional 100.0
PRK03321352 putative aminotransferase; Provisional 100.0
PRK06358354 threonine-phosphate decarboxylase; Provisional 100.0
TIGR01141377 hisC histidinol-phosphate aminotransferase; InterPro: I 100.0
PRK05387353 histidinol-phosphate aminotransferase; Provisional 100.0
PRK04152364 consensus 100.0
PRK07392358 threonine-phosphate decarboxylase; Validated 100.0
PRK02610369 histidinol-phosphate aminotransferase; Provisional 100.0
PRK01533366 histidinol-phosphate aminotransferase; Validated 100.0
PRK04870356 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08153370 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08056356 threonine-phosphate decarboxylase; Provisional 100.0
PRK03967337 histidinol-phosphate aminotransferase; Provisional 100.0
PRK03262355 consensus 100.0
PRK04781362 histidinol-phosphate aminotransferase; Provisional 100.0
PRK01688355 histidinol-phosphate aminotransferase; Provisional 100.0
PRK04635346 histidinol-phosphate aminotransferase; Provisional 100.0
KOG0258475 consensus 100.0
PRK06959339 putative threonine-phosphate decarboxylase; Provisional 100.0
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) amin 100.0
PRK09257397 aromatic amino acid aminotransferase; Provisional 100.0
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amin 99.97
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 famil 99.77
TIGR00858378 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR0047 99.77
KOG1412410 consensus 99.73
KOG1411427 consensus 99.69
PRK13034422 serine hydroxymethyltransferase; Reviewed 99.61
PRK00011415 glyA serine hydroxymethyltransferase; Reviewed 99.58
PRK13520375 L-tyrosine decarboxylase; Provisional 99.57
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT). Th 99.52
PRK00451449 glycine dehydrogenase subunit 1; Validated 99.49
PTZ00094450 serine hydroxymethyltransferase; Provisional 99.44
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amino aci 99.41
pfam00464380 SHMT Serine hydroxymethyltransferase. 99.41
TIGR01821427 5aminolev_synth 5-aminolevulinic acid synthase; InterPr 99.29
cd00617431 Tnase_like Tryptophanase family (Tnase). This family be 99.24
PRK13237459 tyrosine phenol-lyase; Provisional 99.19
PRK13238461 tnaA tryptophanase; Provisional 99.09
PRK04366490 glycine dehydrogenase subunit 2; Validated 98.78
COG3033471 TnaA Tryptophanase [Amino acid transport and metabolism 98.74
) it is a pyridoxal 5'-phosphate (PLP)-dependent enzyme, which catalyses the irreversible alpha-decarboxylation of L-glutamate to gamma-aminobutyrate (GABA). This enzyme is widely distributed amongst eukaryotes and prokaryotes, but its function varies in different organisms . Gad has a crucial role in the vertebrate central nervous system where it is responsible for the synthesis of GABA, the major inhibitory neurotransmitter. In the majority of vertebrates Gad occurs in two isoforms, GAD65 and GAD67, both active at neutral pH . Gad isoforms (GadA and GadB) have also been reported in some bacterial species, including the Gram-negative bacterium and Gram-positive bacterium . A unique feature of plant and yeast Gad is the presence of a calmodulin (CaM)-binding domain in the C-terminal region. In Saccharomyces cerevisiae, Gad expression is required for normal oxidative stress tolerance . In plants, Gad is thought to be a stress-adapter chaperonin sensing Ca2+ signals.; GO: 0004351 glutamate decarboxylase activity, 0030170 pyridoxal phosphate binding, 0006536 glutamate metabolic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01788">TIGR01788493 Glu-decarb-GAD glutamate decarboxylase; InterPro: IPR01 98.46
KOG2467477 consensus 98.18
PRK12566 954 glycine dehydrogenase; Provisional 97.75
COG3844407 Kynureninase [Amino acid transport and metabolism] 97.74
PRK05367 955 glycine dehydrogenase; Provisional 97.21
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase; InterPro: IPR01344 93.91
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: the de 100.0
pfam00155351 Aminotran_1_2 Aminotransferase class I and II. 100.0
PRK07324373 transaminase; Validated 100.0
PRK09440416 avtA valine--pyruvate transaminase; Provisional 100.0
cd00609350 AAT_like Aspartate aminotransferase family. This family 100.0
KOG0259447 consensus 100.0
COG1167459 ARO8 Transcriptional regulators containing a DNA-bindin 100.0
PRK03317369 histidinol-phosphate aminotransferase; Provisional 100.0
PRK07908346 hypothetical protein; Provisional 100.0
PRK08637386 hypothetical protein; Provisional 100.0
PRK09105374 putative aminotransferase; Provisional 100.0
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferase and 100.0
PRK08354312 putative aminotransferase; Provisional 100.0
KOG0634472 consensus 100.0
PRK06425332 histidinol-phosphate aminotransferase; Validated 100.0
PRK05664330 threonine-phosphate decarboxylase; Reviewed 100.0
TIGR01140349 CobD L-threonine-O-3-phosphate decarboxylase, putative; 100.0
KOG0633375 consensus 100.0
TIGR01979409 sufS cysteine desulfurases, SufS subfamily; InterPro: I 99.94
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.93
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subunit Cs 99.93
PRK09295406 selenocysteine lyase; Validated 99.93
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This family 99.9
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, epsilon 99.9
pfam00266371 Aminotran_5 Aminotransferase class-V. This domain is fo 99.89
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of this pro 99.88
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Posttra 99.88
PRK02948381 cysteine desulfurase; Provisional 99.88
PRK05958387 8-amino-7-oxononanoate synthase; Reviewed 99.88
cd06454349 KBL_like KBL_like; this family belongs to the pyridoxal 99.86
TIGR01977384 am_tr_V_EF2568 cysteine desulfurase family protein; Int 99.84
PRK07179408 hypothetical protein; Provisional 99.84
PRK13392410 5-aminolevulinate synthase; Provisional 99.83
PRK10534333 L-threonine aldolase; Provisional 99.83
PRK13393404 5-aminolevulinate synthase; Provisional 99.83
PRK09064406 5-aminolevulinate synthase; Validated 99.82
PRK06939395 2-amino-3-ketobutyrate coenzyme A ligase; Provisional 99.81
cd06502338 TA_like Low-specificity threonine aldolase (TA). This f 99.79
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desulfuras 99.79
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family belongs 99.78
TIGR01825392 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransfe 99.78
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.77
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) fa 99.76
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and related e 99.75
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzyme app 99.74
PRK07505405 hypothetical protein; Provisional 99.73
KOG1368384 consensus 99.71
TIGR01976410 am_tr_V_VC1184 cysteine desulfurase family protein; Int 99.69
COG2008342 GLY1 Threonine aldolase [Amino acid transport and metab 99.68
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.66
PRK12381406 bifunctional succinylornithine transaminase/acetylornit 99.65
cd00610413 OAT_like Acetyl ornithine aminotransferase family. This 99.65
PRK09331386 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.65
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminotransf 99.64
PRK02627398 acetylornithine aminotransferase; Provisional 99.64
TIGR03246397 arg_catab_astC succinylornithine transaminase family. M 99.64
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Provisi 99.63
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.63
PRK01278389 argD bifunctional N-succinyldiaminopimelate-aminotransf 99.63
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartate ami 99.62
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase. Thi 99.6
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.58
PRK07480459 putative aminotransferase; Validated 99.57
PRK05964421 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.57
PRK06917447 hypothetical protein; Provisional 99.57
PRK12389429 glutamate-1-semialdehyde aminotransferase; Provisional 99.57
PRK00854404 rocD ornithine--oxo-acid transaminase; Reviewed 99.56
PRK00062429 glutamate-1-semialdehyde aminotransferase; Provisional 99.56
PRK04260375 acetylornithine aminotransferase; Provisional 99.56
PRK07678451 aminotransferase; Validated 99.55
PRK08593448 4-aminobutyrate aminotransferase; Provisional 99.55
PTZ00125415 ornithine aminotransferase; Provisional 99.54
PRK06942425 glutamate-1-semialdehyde 2,1-aminomutase; Validated 99.54
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [Amino 99.54
PRK09044418 consensus 99.53
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.53
TIGR01822395 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase; 99.53
PRK07323443 consensus 99.53
PRK06105460 aminotransferase; Provisional 99.52
PRK04612408 argD bifunctional N-succinyldiaminopimelate-aminotransf 99.52
PRK06916462 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.52
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.51
PRK07036466 hypothetical protein; Provisional 99.51
PRK13360441 omega amino acid--pyruvate transaminase; Provisional 99.51
PRK07483443 hypothetical protein; Provisional 99.5
PRK07046452 aminotransferase; Validated 99.5
PRK07482461 hypothetical protein; Provisional 99.49
PRK07481448 hypothetical protein; Provisional 99.49
PRK11522468 putrescine--2-oxoglutarate aminotransferase; Provisiona 99.49
PRK05965459 hypothetical protein; Provisional 99.49
PRK08088426 4-aminobutyrate aminotransferase; Validated 99.49
PRK09792421 PLP-dependent GABA aminotransferase; Provisional 99.49
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisional 99.48
PRK05630423 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.48
PRK08117429 4-aminobutyrate aminotransferase; Provisional 99.48
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.48
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.46
PRK06058446 4-aminobutyrate aminotransferase; Provisional 99.46
PRK06082460 4-aminobutyrate aminotransferase; Provisional 99.46
PRK07495422 4-aminobutyrate aminotransferase; Provisional 99.46
TIGR00713434 hemL glutamate-1-semialdehyde-2,1-aminomutase; InterPro 99.45
PRK03715395 argD bifunctional N-succinyldiaminopimelate-aminotransf 99.45
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.45
PRK06943452 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.45
PRK07030467 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.45
PRK08466430 consensus 99.44
PRK07894430 consensus 99.43
PRK06918454 4-aminobutyrate aminotransferase; Reviewed 99.41
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 99.41
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferase; Pr 99.4
PRK05769442 4-aminobutyrate aminotransferase; Provisional 99.39
PRK06062434 hypothetical protein; Provisional 99.39
cd06450345 DOPA_deC_like DOPA decarboxylase family. This family be 99.39
PRK06541460 hypothetical protein; Provisional 99.38
TIGR03372442 putres_am_tran putrescine aminotransferase. Members of 99.38
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.38
PRK12403460 putative aminotransferase; Provisional 99.38
TIGR00707402 argD acetylornithine and succinylornithine aminotransfe 99.35
PRK06931454 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 99.34
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Coenzym 99.34
PRK08555443 consensus 99.33
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.32
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisional 99.26
COG0160447 GabT 4-aminobutyrate aminotransferase and related amino 99.24
KOG1358467 consensus 99.23
PRK13580493 serine hydroxymethyltransferase; Provisional 99.17
PRK09264426 diaminobutyrate--2-oxoglutarate aminotransferase; Valid 99.17
PRK06149972 hypothetical protein; Provisional 99.06
COG1103382 Archaea-specific pyridoxal phosphate-dependent enzymes 99.01
PRK061481015 hypothetical protein; Provisional 98.99
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized members 98.98
KOG2862385 consensus 98.95
KOG1359417 consensus 98.91
KOG1357519 consensus 98.9
PRK04311465 selenocysteine synthase; Provisional 98.89
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.79
TIGR01885426 Orn_aminotrans ornithine--oxo-acid transaminase; InterP 98.72
TIGR02326366 transamin_PhnW 2-aminoethylphosphonate--pyruvate transa 98.69
TIGR00700427 GABAtrnsam 4-aminobutyrate transaminase; InterPro: IPR0 98.67
KOG1401433 consensus 98.5
KOG1404442 consensus 98.39
TIGR02006404 IscS cysteine desulfurase IscS; InterPro: IPR010240 Thi 98.15
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) family. 98.11
TIGR01437391 selA_rel pyridoxal phosphate-dependent enzyme, putative 98.11
TIGR02617468 tnaA_trp_ase tryptophanase; InterPro: IPR013440 Protein 97.97
PRK12462364 phosphoserine aminotransferase; Provisional 97.96
TIGR00709445 dat 2,4-diaminobutyrate 4-transaminase; InterPro: IPR00 97.78
PRK05355360 phosphoserine aminotransferase; Provisional 97.77
PRK03080381 phosphoserine aminotransferase; Provisional 97.55
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme metabolis 97.42
TIGR01364391 serC_1 phosphoserine aminotransferase; InterPro: IPR003 95.08
KOG3843432 consensus 95.03
KOG2790370 consensus 94.73
KOG0256471 consensus 100.0
PRK09275531 aspartate aminotransferase; Provisional 100.0
pfam04864363 Alliinase_C Allinase. Allicin is a thiosulphinate that 99.95
PRK08247366 cystathionine gamma-synthase; Reviewed 99.73
TIGR02539381 SepCysS Sep-tRNA:Cys-tRNA synthase; InterPro: IPR013375 99.25
PRK02769380 histidine decarboxylase; Provisional 98.98
pfam05889389 SLA_LP_auto_ag Soluble liver antigen/liver pancreas ant 96.83
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transfe 96.61
PRK08249398 cystathionine gamma-synthase; Provisional 99.8
PRK07503403 methionine gamma-lyase; Provisional 99.79
PRK06767386 methionine gamma-lyase; Provisional 99.78
PRK06234399 methionine gamma-lyase; Provisional 99.77
PRK07504397 O-succinylhomoserine sulfhydrylase; Reviewed 99.77
PRK08133391 O-succinylhomoserine sulfhydrylase; Validated 99.76
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is a PL 99.75
pfam01053381 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 99.74
PRK06460375 hypothetical protein; Provisional 99.74
PRK07810406 O-succinylhomoserine sulfhydrylase; Provisional 99.74
PRK06176379 cystathionine gamma-synthase/cystathionine beta-lyase; 99.73
PRK09028394 cystathionine beta-lyase; Provisional 99.72
PRK07050394 cystathionine beta-lyase; Provisional 99.72
PRK08064390 cystathionine beta-lyase; Provisional 99.72
PRK07811386 cystathionine gamma-synthase; Provisional 99.72
PRK05967392 cystathionine beta-lyase; Provisional 99.72
PRK05968389 hypothetical protein; Provisional 99.71
PRK08045386 cystathionine gamma-synthase; Provisional 99.71
PRK08861388 cystathionine gamma-synthase; Provisional 99.71
pfam01212288 Beta_elim_lyase Beta-eliminating lyase. 99.71
PRK08776405 cystathionine gamma-synthase; Provisional 99.7
PRK08114395 cystathionine beta-lyase; Provisional 99.69
PRK08574384 cystathionine gamma-synthase; Provisional 99.66
PRK07582370 cystathionine gamma-lyase; Validated 99.66
PRK07671377 cystathionine beta-lyase; Provisional 99.63
PRK07049427 methionine gamma-lyase; Validated 99.63
PRK07269364 cystathionine gamma-synthase; Reviewed 99.58
PRK06434384 cystathionine gamma-lyase; Validated 99.55
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma-synt 99.54
COG0076460 GadB Glutamate decarboxylase and related PLP-dependent 99.28
KOG1383491 consensus 98.21
TIGR03235354 DNA_S_dndA cysteine desulfurase DndA. This model descri 99.78
KOG1403452 consensus 90.79
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily (fol 99.76
pfam01041363 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase f 99.71
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family 99.7
PRK06084424 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.7
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.69
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.67
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.67
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.64
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.64
PRK05994426 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.63
cd00615294 Orn_deC_like Ornithine decarboxylase family. This famil 99.42
pfam01276417 OKR_DC_1 Orn/Lys/Arg decarboxylase, major domain. 99.41
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase; Int 99.35
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid tran 99.23
pfam06838405 Alum_res Aluminium resistance protein. This family repr 99.01
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Amino ac 99.01
PRK13578 720 ornithine decarboxylase; Provisional 98.71
TIGR01324389 cysta_beta_ly_B cystathionine beta-lyase; InterPro: IPR 98.66
COG4100416 Cystathionine beta-lyase family protein involved in alu 98.46
TIGR00461965 gcvP glycine dehydrogenase; InterPro: IPR003437 This fa 97.0
KOG20401001 consensus 94.03
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotran 99.74
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotran 99.73
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional 99.71
KOG1549428 consensus 99.71
PRK05939396 hypothetical protein; Provisional 99.69
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer selenium tr 98.74
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal-bindi 98.52
pfam00282370 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserv 98.46
PRK12566954 glycine dehydrogenase; Provisional 98.43
PRK05367955 glycine dehydrogenase; Provisional 98.33
KOG0053409 consensus 99.45
TIGR01329415 cysta_beta_ly_E cystathionine beta-lyase; InterPro: IPR 98.64
TIGR01325386 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase; Inter 99.44
TIGR01328392 met_gam_lyase methionine gamma-lyase; InterPro: IPR0062 99.4
TIGR01326434 OAH_OAS_sulfhy O-acetylhomoserine aminocarboxypropyltra 99.34
PRK08297449 L-lysine aminotransferase; Provisional 98.85
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- and bet 99.31
TIGR02080383 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase; Inte 99.18
pfam00202338 Aminotran_3 Aminotransferase class-III. 98.96
pfam03841367 SelA L-seryl-tRNA selenium transferase. 98.85
pfam02347429 GDC-P Glycine cleavage system P-protein. This family co 98.28
TIGR00474448 selA L-seryl-tRNA selenium transferase; InterPro: IPR00 97.79
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal-bindi 97.76
TIGR02407413 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotrans 99.09
KOG1360570 consensus 98.46
KOG1402427 consensus 98.15
KOG0628511 consensus 97.11
KOG0629510 consensus 95.39
TIGR02104 655 pulA_typeI pullulanase, type I; InterPro: IPR011840 Pul 93.51
TIGR02418553 acolac_catab acetolactate synthase, catabolic; InterPro 92.05
>PRK06507 consensus Back     alignment and domain information
>PRK07543 consensus Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06575 consensus Back     alignment and domain information
>PRK05794 consensus Back     alignment and domain information
>PRK06056 consensus Back     alignment and domain information
>PRK08069 consensus Back     alignment and domain information
>PRK07310 consensus Back     alignment and domain information
>PRK07367 consensus Back     alignment and domain information
>PRK08443 consensus Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK07212 consensus Back     alignment and domain information
>PRK09276 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK