254780603

254780603

tRNA/rRNA methyltransferase protein

GeneID in NCBI database:8209602Locus tag:CLIBASIA_02450
Protein GI in NCBI database:254780603Protein Accession:YP_003065016.1
Gene range:-(676440, 677288)Protein Length:282aa
Gene description:tRNA/rRNA methyltransferase protein
COG prediction:[J] rRNA methylases
KEGG prediction:tRNA/rRNA methyltransferase protein; K03218 RNA methyltransferase, TrmH family [EC:2.1.1.-]
SEED prediction:rRNA methylases
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK
cccccccccccccccccccccccccccHHHHHHHHHcccccccccccEEEEEEHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHHccccEEEEcHHHHHHHHcccccccEEEEEEcccccccHHHHccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHccccEEEEEEEEccHHHHHHHHHHcccEEEEEEccccccHHHccccccEEEEEccccccccHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHcc
ccEEEEcccccccccccccccccccccccHHHcccccccccccccccccEEEcHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHcccEEEEccHHHHHHHcccccccEEEEEEEccccHHHHHHHHcccEEEEEccccccccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHcHHccccEEEEcHHHHHHHHHHHcccEEEEEccccccccEEEcccccEEEEEccccccHHHHHHHHccHEEEccccccccHHHHHHHHHHHHHHHHHHccc
MNLISKKKSEKIFSLKDSHYAKLRRNHRDykkmqsfnqksrhtsqpenlFLYGVHTVSAALNNPSRKIFQLLATKNALArldwdanlphpfpvktvppqtidkivgkeavhqglaletapllsptldaVRNSQLLMVLdhvndphnIGAILRSAVAFScdgiittkryspsesAVLAKSAsgalehipyirISNLTDALQKMHSWgfqtiglssdskkpleQEIKNDKIALILGaegkglrpktqeTATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK
mnliskkksekifslkdshyaklRRNHRDYKkmqsfnqksrhtsqPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITtkryspsesAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK
MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKalnvsnaaavalYITQNHFAK
**************************************************LYGVHTVSAALNNPSRKIFQLLATKNALA*********HPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF**
********SEKIFSLKDSHYAKLRRNHRDYKKM**********SQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK
*N*******EKIFSLKDSHYAKLRRNHRDYKKMQ**********QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK
MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK
MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target282 tRNA/rRNA methyltransferase protein [Candidatus Liberib
315121804300 tRNA/rRNA methyltransferase protein [Candidatus Liberib 1 1e-128
15889284295 tRNA/rRNA metyltransferase [Agrobacterium tumefaciens s 1 1e-78
325293360295 tRNA/rRNA metyltransferase [Agrobacterium sp. H13-3] Le 1 1e-78
222148346293 tRNA/rRNA metyltransferase [Agrobacterium vitis S4] Len 1 6e-77
150396189291 RNA methyltransferase [Sinorhizobium medicae WSM419] Le 1 5e-76
86357288296 tRNA/rRNA methyltransferase protein [Rhizobium etli CFN 1 6e-76
153009269286 RNA methyltransferase [Ochrobactrum anthropi ATCC 49188 1 8e-76
190891338296 23S rRNA (guanosine-2'-O-)-methyltransferase [Rhizobium 1 1e-75
239832139303 RNA methyltransferase, TrmH family, group 3 [Ochrobactr 1 2e-75
254719306286 RNA methyltransferase, TrmH family, group 3 [Brucella s 1 2e-75
>gi|315121804|ref|YP_004062293.1| tRNA/rRNA methyltransferase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 300 Back     alignment and organism information
 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 222/286 (77%), Positives = 251/286 (87%), Gaps = 4/286 (1%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQK----SRHTSQPENLFLYGVHT 56
           M L+   K+ KI S KDSHYAKLRRN+RD KK+Q  NQK    ++H +Q  NLFLYG+HT
Sbjct: 15  MKLMPPNKNNKISSPKDSHYAKLRRNYRDRKKIQLINQKDTLQNKHITQANNLFLYGIHT 74

Query: 57  VSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL 116
           V AALNNP RKIFQLLAT+N+L RL+WDAN PHPFPVK V P TID+IVGKEAVHQGLAL
Sbjct: 75  VGAALNNPQRKIFQLLATRNSLTRLNWDANRPHPFPVKIVSPSTIDQIVGKEAVHQGLAL 134

Query: 117 ETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVL 176
           ET PL SPTLD ++NSQL+++LDH+NDPHN+GAILRS+VAF C GIITT+RYSPSESAVL
Sbjct: 135 ETTPLSSPTLDTIQNSQLIIILDHINDPHNVGAILRSSVAFGCGGIITTRRYSPSESAVL 194

Query: 177 AKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAE 236
           AKSASGALEHIPYIRI NLTDAL K+H+W FQTIGLSS+S  PLE+EIK+DKIALILGAE
Sbjct: 195 AKSASGALEHIPYIRIGNLTDALHKIHAWQFQTIGLSSESNNPLEKEIKSDKIALILGAE 254

Query: 237 GKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           GKGLR KTQETATS+AHL+MPGIIK+LNVSNAAAVALYITQNHFAK
Sbjct: 255 GKGLRQKTQETATSIAHLNMPGIIKSLNVSNAAAVALYITQNHFAK 300


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15889284|ref|NP_354965.1| tRNA/rRNA metyltransferase [Agrobacterium tumefaciens str. C58] Length = 295 Back     alignment and organism information
>gi|325293360|ref|YP_004279224.1| tRNA/rRNA metyltransferase [Agrobacterium sp. H13-3] Length = 295 Back     alignment and organism information
>gi|222148346|ref|YP_002549303.1| tRNA/rRNA metyltransferase [Agrobacterium vitis S4] Length = 293 Back     alignment and organism information
>gi|150396189|ref|YP_001326656.1| RNA methyltransferase [Sinorhizobium medicae WSM419] Length = 291 Back     alignment and organism information
>gi|86357288|ref|YP_469180.1| tRNA/rRNA methyltransferase protein [Rhizobium etli CFN 42] Length = 296 Back     alignment and organism information
>gi|153009269|ref|YP_001370484.1| RNA methyltransferase [Ochrobactrum anthropi ATCC 49188] Length = 286 Back     alignment and organism information
>gi|190891338|ref|YP_001977880.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Rhizobium etli CIAT 652] Length = 296 Back     alignment and organism information
>gi|239832139|ref|ZP_04680468.1| RNA methyltransferase, TrmH family, group 3 [Ochrobactrum intermedium LMG 3301] Length = 303 Back     alignment and organism information
>gi|254719306|ref|ZP_05181117.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. 83/13] Length = 286 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target282 tRNA/rRNA methyltransferase protein [Candidatus Liberib
TIGR00186237 TIGR00186, rRNA_methyl_3, rRNA methylase, putative, gro 1e-38
PRK11181244 PRK11181, PRK11181, 23S rRNA (guanosine-2'-O-)-methyltr 6e-26
COG0566260 COG0566, SpoU, rRNA methylases [Translation, ribosomal 5e-45
pfam00588142 pfam00588, SpoU_methylase, SpoU rRNA Methylase family 2e-30
PRK10864346 PRK10864, PRK10864, putative methyltransferase; Provisi 3e-16
KOG2506371 KOG2506, KOG2506, KOG2506, SpoU rRNA Methylase family p 2e-09
PRK11081229 PRK11081, PRK11081, tRNA guanosine-2'-O-methyltransfera 7e-07
COG0565242 COG0565, LasT, rRNA methylase [Translation, ribosomal s 2e-05
COG0219155 COG0219, CspR, Predicted rRNA methylase (SpoU class) [T 3e-04
KOG0838271 KOG0838, KOG0838, KOG0838, RNA Methylase, SpoU family [ 2e-17
pfam0803275 pfam08032, SpoU_sub_bind, RNA 2'-O ribose methyltransfe 9e-06
>gnl|CDD|129290 TIGR00186, rRNA_methyl_3, rRNA methylase, putative, group 3 Back     alignment and domain information
>gnl|CDD|183021 PRK11181, PRK11181, 23S rRNA (guanosine-2'-O-)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30912 COG0566, SpoU, rRNA methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144253 pfam00588, SpoU_methylase, SpoU rRNA Methylase family Back     alignment and domain information
>gnl|CDD|182790 PRK10864, PRK10864, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|37717 KOG2506, KOG2506, KOG2506, SpoU rRNA Methylase family protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|182949 PRK11081, PRK11081, tRNA guanosine-2'-O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30911 COG0565, LasT, rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30568 COG0219, CspR, Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36056 KOG0838, KOG0838, KOG0838, RNA Methylase, SpoU family [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|149230 pfam08032, SpoU_sub_bind, RNA 2'-O ribose methyltransferase substrate binding Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 282 tRNA/rRNA methyltransferase protein [Candidatus Liberib
COG0566260 SpoU rRNA methylases [Translation, ribosomal structure 100.0
PRK11181244 23S rRNA (guanosine-2'-O-)-methyltransferase; Provision 100.0
PRK10864348 putative methyltransferase; Provisional 100.0
KOG2506371 consensus 100.0
KOG0838271 consensus 100.0
TIGR00186271 rRNA_methyl_3 RNA methyltransferase, TrmH family, group 99.97
PRK11081229 tRNA guanosine-2'-O-methyltransferase; Provisional 100.0
pfam00588142 SpoU_methylase SpoU rRNA Methylase family. This family 100.0
PRK10358157 putative tRNA/rRNA methyltransferase YibK; Provisional 100.0
COG0219155 CspR Predicted rRNA methylase (SpoU class) [Translation 99.97
TIGR00185161 rRNA_methyl_2 RNA methyltransferase, TrmH family, group 99.97
KOG08391477 consensus 99.91
PRK10433228 putative RNA methyltransferase; Provisional 99.9
TIGR00050253 rRNA_methyl_1 RNA methyltransferase, TrmH family, group 99.9
COG0565242 LasT rRNA methylase [Translation, ribosomal structure a 99.87
COG4080147 SpoU rRNA Methylase family enzyme [General function pre 97.93
pfam09936185 DUF2168 Uncharacterized protein conserved in bacteria ( 97.78
PRK03958175 tRNA 2'-O-methylase; Reviewed 97.24
COG1303179 Uncharacterized protein conserved in archaea [Function 96.56
PRK12703 339 tRNA 2'-O-methylase; Reviewed 95.96
COG1385246 Uncharacterized protein conserved in bacteria [Function 94.66
PRK11713243 16S rRNA m3U1498 methyltransferase; Provisional 94.46
pfam04452225 Methyltrans_RNA RNA methyltransferase. RNA methyltransf 93.79
PRK02135199 hypothetical protein; Provisional 93.75
pfam04407174 DUF531 Protein of unknown function (DUF531). Family of 91.52
pfam04013199 DUF358 Protein of unknown function (DUF358). The protei 90.34
pfam0803275 SpoU_sub_bind RNA 2'-O ribose methyltransferase substra 98.9
COG4752190 Uncharacterized protein conserved in bacteria [Function 95.45
KOG0838271 consensus 90.31
pfam09895105 DUF2122 RecB-family nuclease (DUF2122). This domain, fo 94.38
pfam01994121 Trm56 tRNA ribose 2'-O-methyltransferase, aTrm56. This 93.29
>COG0566 SpoU rRNA methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11181 23S rRNA (guanosine-2'-O-)-methyltransferase; Provisional Back     alignment and domain information
>PRK10864 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2506 consensus Back     alignment and domain information
>KOG0838 consensus Back     alignment and domain information
>TIGR00186 rRNA_methyl_3 RNA methyltransferase, TrmH family, group 3; InterPro: IPR004441 The RNA methyltransferase, TrmH family, group 3 are part of the trmH (spoU) family of rRNA methylases that are involved in tRNA and rRNA base modification Back     alignment and domain information
>PRK11081 tRNA guanosine-2'-O-methyltransferase; Provisional Back     alignment and domain information
>pfam00588 SpoU_methylase SpoU rRNA Methylase family Back     alignment and domain information
>PRK10358 putative tRNA/rRNA methyltransferase YibK; Provisional Back     alignment and domain information
>COG0219 CspR Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00185 rRNA_methyl_2 RNA methyltransferase, TrmH family, group 2; InterPro: IPR004440 The RNA methyltransferase, TrmH family, group 2 are part of the trmH (spoU) family of rRNA methylases that are involved in tRNA and rRNA base modification Back     alignment and domain information
>KOG0839 consensus Back     alignment and domain information
>PRK10433 putative RNA methyltransferase; Provisional Back     alignment and domain information
>TIGR00050 rRNA_methyl_1 RNA methyltransferase, TrmH family, group 1; InterPro: IPR004384 These proteins are part of the trmH (spoU) family of rRNA methylases Back     alignment and domain information
>COG0565 LasT rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4080 SpoU rRNA Methylase family enzyme [General function prediction only] Back     alignment and domain information
>pfam09936 DUF2168 Uncharacterized protein conserved in bacteria (DUF2168) Back     alignment and domain information
>PRK03958 tRNA 2'-O-methylase; Reviewed Back     alignment and domain information
>COG1303 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK12703 tRNA 2'-O-methylase; Reviewed Back     alignment and domain information
>COG1385 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11713 16S rRNA m3U1498 methyltransferase; Provisional Back     alignment and domain information
>pfam04452 Methyltrans_RNA RNA methyltransferase Back     alignment and domain information
>PRK02135 hypothetical protein; Provisional Back     alignment and domain information
>pfam04407 DUF531 Protein of unknown function (DUF531) Back     alignment and domain information
>pfam04013 DUF358 Protein of unknown function (DUF358) Back     alignment and domain information
>pfam08032 SpoU_sub_bind RNA 2'-O ribose methyltransferase substrate binding Back     alignment and domain information
>COG4752 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0838 consensus Back     alignment and domain information
>pfam09895 DUF2122 RecB-family nuclease (DUF2122) Back     alignment and domain information
>pfam01994 Trm56 tRNA ribose 2'-O-methyltransferase, aTrm56 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target282 tRNA/rRNA methyltransferase protein [Candidatus Liberib
1gz0_A253 23s Ribosomal Rna G2251 2'o-Methyltransferase Rlmb 1e-26
1ipa_A274 Crystal Structure Of Rna 2'-O Ribose Methyltransfer 7e-26
2i6d_A257 The Structure Of A Putative Rna Methyltransferase O 9e-18
1x7p_A287 Crystal Structure Of The Spou Methyltransferase Avi 3e-17
1x7o_A287 Crystal Structure Of The Spou Methyltransferase Avi 3e-15
3nk6_A277 Structure Of The Nosiheptide-Resistance Methyltrans 2e-12
3gyq_A272 Structure Of The Thiostrepton-Resistance Methyltran 3e-12
1zjr_A211 Crystal Structure Of A. Aeolicus TrmhSPOU TRNA MODI 1e-19
1v2x_A194 Trmh Length = 194 2e-19
3n4j_A165 Putative Rna Methyltransferase From Yersinia Pestis 5e-13
3e5y_A160 Crystal Structure Of Trmh Family Rna Methyltransfer 3e-12
1j85_A160 Structure Of Yibk From Haemophilus Influenzae (Hi07 6e-10
3l8u_A182 Crystal Structure Of Smu.1707c, A Putative Rrna Met 6e-07
2ha8_A184 Methyltransferase Domain Of Human Tar (Hiv-1) Rna B 2e-11
3ic6_A223 Crystal Structure Of Putative Methylase Family Prot 8e-09
3ilk_A244 The Structure Of A Probable Methylase Family Protei 6e-08
3kty_A173 Crystal Structure Of Probable Methyltransferase Fro 1e-06
3onp_A249 Crystal Structure Of TrnaRRNA METHYLTRANSFERASE SPO 2e-05
>gi|24987276|pdb|1GZ0|A Chain A, 23s Ribosomal Rna G2251 2'o-Methyltransferase Rlmb Length = 253 Back     alignment and structure
 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 100/247 (40%), Gaps = 8/247 (3%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQ 99
                +  +YG+H V A L     +  ++   K    +       A       ++    Q
Sbjct: 7   RGSHXSEXIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQ 66

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSA 154
            +D+          +A           D        +   L++LD V DPHN+GA LRSA
Sbjct: 67  YLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSA 126

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A     +I  K  S   +A   K A GA E +P IR++NL    + +       +G + 
Sbjct: 127 DAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTXRXLQEENIWIVGTAG 186

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++   L Q     ++AL+ GAEG+G R  T+E    +  +   G + +LNVS A  + L+
Sbjct: 187 EADHTLYQSKXTGRLALVXGAEGEGXRRLTREHCDELISIPXAGSVSSLNVSVATGICLF 246

Query: 275 ITQNHFA 281
                 +
Sbjct: 247 EAVRQRS 253


>gi|22218790|pdb|1IPA|A Chain A, Crystal Structure Of Rna 2'-O Ribose Methyltransferase Length = 274 Back     alignment and structure
>gi|118138229|pdb|2I6D|A Chain A, The Structure Of A Putative Rna Methyltransferase Of The Trmh Family From Porphyromonas Gingivalis Length = 257 Back     alignment and structure
>gi|60593968|pdb|1X7P|A Chain A, Crystal Structure Of The Spou Methyltransferase Avirb From Streptomyces Viridochromogenes In Complex With The Cofactor Adomet Length = 287 Back     alignment and structure
>gi|60593966|pdb|1X7O|A Chain A, Crystal Structure Of The Spou Methyltransferase Avirb From Streptomyces Viridochromogenes Length = 287 Back     alignment and structure
>gi|301016090|pdb|3NK6|A Chain A, Structure Of The Nosiheptide-Resistance Methyltransferase Length = 277 Back     alignment and structure
>gi|226887998|pdb|3GYQ|A Chain A, Structure Of The Thiostrepton-Resistance Methyltransferase S-Adenosyl-L-Methionine Complex Length = 272 Back     alignment and structure
gi|75765771|pdb|1ZJR|A Chain A, Crystal Structure Of A. Aeolicus TrmhSPOU TRNA MODIFYING Enzyme Length = 211 Back     alignment and structure
gi|48425869|pdb|1V2X|A Chain A, Trmh Length = 194 Back     alignment and structure
>gi|299689343|pdb|3N4J|A Chain A, Putative Rna Methyltransferase From Yersinia Pestis Length = 165 Back     alignment and structure
>gi|197305217|pdb|3E5Y|A Chain A, Crystal Structure Of Trmh Family Rna Methyltransferase From Burkholderia Pseudomallei Length = 160 Back     alignment and structure
gi|28948421|pdb|1J85|A Chain A, Structure Of Yibk From Haemophilus Influenzae (Hi0766), A Truncated Sequence Homolog Of Trna (Guanosine-2'-O-) Methyltransferase (Spou) Length = 160 Back     alignment and structure
>gi|316983221|pdb|3L8U|A Chain A, Crystal Structure Of Smu.1707c, A Putative Rrna Methyltransferase From Streptococcus Mutans Ua159 Length = 182 Back     alignment and structure
>gi|112491246|pdb|2HA8|A Chain A, Methyltransferase Domain Of Human Tar (Hiv-1) Rna Binding Protein 1 Length = 184 Back     alignment and structure
>gi|255311931|pdb|3IC6|A Chain A, Crystal Structure Of Putative Methylase Family Protein From Neisseria Gonorrhoeae Length = 223 Back     alignment and structure
>gi|257097728|pdb|3ILK|A Chain A, The Structure Of A Probable Methylase Family Protein From Haemophilus Influenzae Rd Kw20 Length = 244 Back     alignment and structure
>gi|270346815|pdb|3KTY|A Chain A, Crystal Structure Of Probable Methyltransferase From Bordetella Pertussis Tohama I Length = 173 Back     alignment and structure
>gi|306440754|pdb|3ONP|A Chain A, Crystal Structure Of TrnaRRNA METHYLTRANSFERASE SPOU FROM RHODOBACTER Sphaeroides Length = 249 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target282 tRNA/rRNA methyltransferase protein [Candidatus Liberib
1gz0_A253 Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-meth 4e-33
3nk6_A277 23S rRNA methyltransferase; nosiheptide, nosiheptide-re 1e-30
1x7o_A287 Avirb, rRNA methyltransferase; SPOU, C-terminal knot, s 3e-19
3gyq_A272 RRNA (adenosine-2'-O-)-methyltransferase; rRNA methyltr 1e-18
2i6d_A257 RNA methyltransferase, TRMH family; stuctural genomics, 4e-15
1ipa_A274 RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil k 2e-25
3n4j_A165 RNA methyltransferase; center for structural genomics o 2e-23
1mxi_A160 YIBK, hypothetical tRNA/RRNA methyltransferase HI0766; 8e-21
3kty_A173 Probable methyltransferase; alpha-beta-alpha sandwich, 2e-20
3onp_A249 TRNA/RRNA methyltransferase (SPOU); structural genomics 1e-19
3e5y_A160 TRMH family RNA methyltransferase; ssgcid, protein knot 4e-19
1zjr_A211 TRNA (guanosine-2'-O-)-methyltransferase; methylase, RN 4e-19
3ic6_A223 Putative methylase family protein; structural genomics, 5e-17
1v2x_A194 TRNA (GM18) methyltransferase; DEEP trefoil knot, riken 8e-16
2ha8_A184 TAR (HIV-1) RNA loop binding protein; methyltransferase 8e-16
3ilk_A244 Uncharacterized tRNA/RRNA methyltransferase HI0380; APC 1e-13
3dcm_X192 AdoMet, uncharacterized protein TM_1570; trefoil knot, 5e-11
>1gz0_A Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli} SCOP: c.116.1.1 d.79.3.3 Length = 253 Back     alignment and structure
 Score =  136 bits (344), Expect = 4e-33
 Identities = 65/234 (27%), Positives = 107/234 (45%), Gaps = 10/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L     +  ++   K    +       A       ++    Q +D+   
Sbjct: 14  MIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEKSD 73

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              VHQG+     P      + +       +   L++LD V DPHN+GA LRSA A    
Sbjct: 74  GA-VHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVH 132

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   L
Sbjct: 133 AVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTL 192

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 193 YQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 246


>3nk6_A 23S rRNA methyltransferase; nosiheptide, nosiheptide-resistance methyltransferase, 23S R methyltransferase; 2.00A {Streptomyces actuosus} PDB: 3nk7_A* 3gyq_A* Length = 277 Back     alignment and structure
>1x7o_A Avirb, rRNA methyltransferase; SPOU, C-terminal knot, seMet; 2.37A {Streptomyces viridochromogenes} PDB: 1x7p_A* Length = 287 Back     alignment and structure
>3gyq_A RRNA (adenosine-2'-O-)-methyltransferase; rRNA methyltransferase, spout mtases, SAM, trefoil knot, antibiotic resistance; HET: SAM; 2.45A {Streptomyces cyaneus} Length = 272 Back     alignment and structure
>2i6d_A RNA methyltransferase, TRMH family; stuctural genomics, knot, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.85A {Porphyromonas gingivalis W83} Length = 257 Back     alignment and structure
>1ipa_A RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil knot, rossmann fold, EL30-like fold, riken structural genomics/proteomics initiative; 2.40A {Thermus thermophilus} SCOP: c.116.1.1 d.79.3.3 Length = 274 Back     alignment and structure
>3n4j_A RNA methyltransferase; center for structural genomics of INF diseases, csgid; 1.47A {Yersinia pestis} PDB: 3n4k_A* 1mxi_A* 1j85_A* Length = 165 Back     alignment and structure
>1mxi_A YIBK, hypothetical tRNA/RRNA methyltransferase HI0766; S-adenosylhomocysteine, SPOU family, structure 2 function project; HET: SAH; 1.70A {Haemophilus influenzae} SCOP: c.116.1.1 PDB: 1j85_A* Length = 160 Back     alignment and structure
>3kty_A Probable methyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.30A {Bordetella pertussis} Length = 173 Back     alignment and structure
>3onp_A TRNA/RRNA methyltransferase (SPOU); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.90A {Rhodobacter sphaeroides} Length = 249 Back     alignment and structure
>3e5y_A TRMH family RNA methyltransferase; ssgcid, protein knot, decode, structural genomics; 2.40A {Burkholderia pseudomallei 305} Length = 160 Back     alignment and structure
>1zjr_A TRNA (guanosine-2'-O-)-methyltransferase; methylase, RNA modifying enzyme, topological knot; 1.85A {Aquifex aeolicus} Length = 211 Back     alignment and structure
>3ic6_A Putative methylase family protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.59A {Neisseria gonorrhoeae fa 1090} Length = 223 Back     alignment and structure
>1v2x_A TRNA (GM18) methyltransferase; DEEP trefoil knot, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: SAM; 1.50A {Thermus thermophilus} SCOP: c.116.1.1 Length = 194 Back     alignment and structure
>2ha8_A TAR (HIV-1) RNA loop binding protein; methyltransferase, structural genomics, structural genomics consortium, SGC, RNA binding protein; HET: SAH; 1.60A {Homo sapiens} Length = 184 Back     alignment and structure
>3ilk_A Uncharacterized tRNA/RRNA methyltransferase HI0380; APC63004, methylase family protein, haemophilus influenzae RD KW20; 2.01A {Haemophilus influenzae} Length = 244 Back     alignment and structure
>3dcm_X AdoMet, uncharacterized protein TM_1570; trefoil knot, spout mtase, adoMet binding, transferase; HET: SAM; 2.00A {Thermotoga maritima} Length = 192 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target282 tRNA/rRNA methyltransferase protein [Candidatus Liberib
1x7o_A287 Avirb, rRNA methyltransferase; SPOU, C-terminal knot, s 100.0
3nk6_A277 23S rRNA methyltransferase; nosiheptide, nosiheptide-re 100.0
1ipa_A274 RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil k 100.0
1gz0_A253 Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-meth 100.0
2i6d_A257 RNA methyltransferase, TRMH family; stuctural genomics, 100.0
2ha8_A184 TAR (HIV-1) RNA loop binding protein; methyltransferase 100.0
1v2x_A194 TRNA (GM18) methyltransferase; DEEP trefoil knot, riken 100.0
1zjr_A211 TRNA (guanosine-2'-O-)-methyltransferase; methylase, RN 100.0
3e5y_A160 TRMH family RNA methyltransferase; ssgcid, protein knot 100.0
3ic6_A223 Putative methylase family protein; structural genomics, 100.0
3n4j_A165 RNA methyltransferase; center for structural genomics o 100.0
3kty_A173 Probable methyltransferase; alpha-beta-alpha sandwich, 100.0
3onp_A249 TRNA/RRNA methyltransferase (SPOU); structural genomics 100.0
3ilk_A244 Uncharacterized tRNA/RRNA methyltransferase HI0380; APC 100.0
3dcm_X192 AdoMet, uncharacterized protein TM_1570; trefoil knot, 99.66
2yy8_A201 ATRM56, UPF0106 protein PH0461; DEEP trefoil knot, stru 96.88
2o3a_A178 UPF0106 protein AF_0751; structural genomics, unknown f 96.77
2qwv_A208 UPF0217 protein VC_A1059; unknown function, structural 96.02
1v6z_A228 Hypothetical protein TTHA0657; structural genomics, rik 94.37
2qmm_A197 UPF0217 protein AF_1056; alpha/beta knot, SAM, structur 93.99
1vhy_A257 Hypothetical protein HI0303; PSI, protein structure ini 93.19
1vhk_A268 Hypothetical protein YQEU; structural genomics, unknown 91.98
2egv_A229 UPF0088 protein AQ_165; RSME, methyltransferase, rRNA m 90.43
>1x7o_A Avirb, rRNA methyltransferase; SPOU, C-terminal knot, seMet; 2.37A {Streptomyces viridochromogenes} PDB: 1x7p_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=405.05  Aligned_cols=262  Identities=18%  Similarity=0.248  Sum_probs=220.6

Q ss_pred             HHHCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEEHHHHHHHHHCCCEEEEEEEECCCC-CCCCCHHHHHHCCCCEEEE
Q ss_conf             000002223765677765431122111288199985788999997898189999973784-3354345543269969997
Q gi|254780603|r   18 SHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTV   96 (282)
Q Consensus        18 ~~~~k~~~~n~~~k~~~~l~~k~k~R~~~~~~iIeG~~~V~eaL~~~~~~i~~i~~te~~-~~~~~~~~~l~~~~~I~~v   96 (282)
                      +...+++..|+.+|++.++.+++++|++++.|+|||.|+|.|||+++.. +..+|++++. ..+....+..........+
T Consensus        10 ~~~~~iss~N~~~k~~~~l~~~r~~R~~~g~fivEG~~~V~eal~~~~~-i~~l~~~~~~~~~~~~~~l~~~~~~~~i~v   88 (287)
T 1x7o_A           10 PAARRITSRNARFQQWQALLGNRNKRTRAGEFLVMGVRPISLAVEHGWP-VRTLLYDGQRELSKWARELLRTVRTEQIAM   88 (287)
T ss_dssp             --------CCHHHHHHHHTTSCHHHHHHHTEEEEESHHHHHHHHHTTCC-EEEEEEESSCCCCHHHHHHHHHSCSEEEEE
T ss_pred             CCCCEECCCCHHHHHHHHHHHCCCHHHHHCEEEEECHHHHHHHHHCCCC-EEEEEEECCCCCCHHHHHHHHHCCCCEEEE
T ss_conf             9877600699999999998548150106199999877999999868998-499999376222467898764346764997


Q ss_pred             CHHHHHHHHCCCCCCCCCCEEEECCCCCCHHHC--CCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHH
Q ss_conf             689987752477777744202411555540112--665068872343206889999999864200110013686320000
Q gi|254780603|r   97 PPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV--RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESA  174 (282)
Q Consensus        97 ~~~~l~~i~~~~~~hqGi~a~~~~~~~~~l~~~--~~~~~~i~ld~i~dp~NlG~I~Rta~a~g~~~vil~~~~~~~~~~  174 (282)
                      ..+.+.++.+...+|||+++.+.. +...++.+  ..++++|+||+||||+|+|+|+|||+|||+++|+++++++|||++
T Consensus        89 ~~~~~~~~~~~~~~~qgv~av~~~-p~~~l~~l~~~~~~~~lvLd~i~dPgNlGaIiRta~afG~~~vil~~~~~~~~~~  167 (287)
T 1x7o_A           89 APDLLMELGEKNEAPPEVVAVVEM-PADDLDRIPVREDFLGVLFDRPTSPGNIGSIIRSADALGAHGLIVAGHAADVYDP  167 (287)
T ss_dssp             CHHHHTTSSCSSSCCCSEEEEEEC-CCCCGGGSCCCTTCEEEEEESCSCHHHHHHHHHHHHHTTCCEEEEESSSSCTTSH
T ss_pred             CHHHHHHHHCCCCCCCEEEEEEEC-CCCCHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCC
T ss_conf             839999985589998739999976-8677657404589779999668776558999998885598769997303444443


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC-----CCHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCC
Q ss_conf             0134443333211012223221122222221-----00000001233322112236898899975867898779998589
Q gi|254780603|r  175 VLAKSASGALEHIPYIRISNLTDALQKMHSW-----GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT  249 (282)
Q Consensus       175 ~~~ras~Ga~~~l~~~~~~~~~~~l~~~~~~-----~~~i~~~~~~~~~~~~~~~~~~~~~lv~G~E~~Gl~~~~~~~~d  249 (282)
                      +++|+|+|++|++|++++.++.++++.+++.     ++++++++.++..++++++++++++||||||++|||+++++.||
T Consensus       168 ~~~ras~Ga~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lv~G~E~~Gls~~~~~~~d  247 (287)
T 1x7o_A          168 KSVRSSTGSLFSLPAVRVPSPGEVMDWVEARRAAGTPIVLVGTDEHGDCDVFDFDFTQPTLLLIGNETAGLSNAWRTLCD  247 (287)
T ss_dssp             HHHHHTTTGGGTSCEEEESSHHHHHHHHHHHHHHTCCCEEEEECTTCSEEGGGSCTTSCEEEEECBTTTBSCHHHHHHCS
T ss_pred             CCCEECCCHHHHCCEEEEEHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCHHHCCCCCEEEEECCCCCCCCHHHHHHCC
T ss_conf             00000102132110489810467777655554048756874120002432111203686299988888788999998589


Q ss_pred             CEEEECCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             39992789687437899999999999987614
Q gi|254780603|r  250 SMAHLHMPGIIKALNVSNAAAVALYITQNHFA  281 (282)
Q Consensus       250 ~~v~Ip~~~~~~SLNvs~a~ai~l~~~~~~~~  281 (282)
                      +.|+|||.|.+||||||+|+||+|||+.|||.
T Consensus       248 ~~v~IPm~g~~eSLNvsvA~~I~lyE~~RqR~  279 (287)
T 1x7o_A          248 YTVSIPMAGSASSLNAANAATAILYEAVRQRI  279 (287)
T ss_dssp             EEEECCCSSSSCCCCHHHHHHHHHHHHHHHHS
T ss_pred             EEEEECCCCCCCEEHHHHHHHHHHHHHHHHHH
T ss_conf             89998999999712299999999999998785



>3nk6_A 23S rRNA methyltransferase; nosiheptide, nosiheptide-resistance methyltransferase, 23S R methyltransferase; 2.00A {Streptomyces actuosus} PDB: 3nk7_A* 3gyq_A* Back     alignment and structure
>1ipa_A RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil knot, rossmann fold, EL30-like fold, riken structural genomics/proteomics initiative; 2.40A {Thermus thermophilus} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>1gz0_A Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>2i6d_A RNA methyltransferase, TRMH family; stuctural genomics, knot, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.85A {Porphyromonas gingivalis W83} Back     alignment and structure
>2ha8_A TAR (HIV-1) RNA loop binding protein; methyltransferase, structural genomics, structural genomics consortium, SGC, RNA binding protein; HET: SAH; 1.60A {Homo sapiens} Back     alignment and structure
>1v2x_A TRNA (GM18) methyltransferase; DEEP trefoil knot, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: SAM; 1.50A {Thermus thermophilus} SCOP: c.116.1.1 Back     alignment and structure
>1zjr_A TRNA (guanosine-2'-O-)-methyltransferase; methylase, RNA modifying enzyme, topological knot; 1.85A {Aquifex aeolicus} Back     alignment and structure
>3e5y_A TRMH family RNA methyltransferase; ssgcid, protein knot, decode, structural genomics; 2.40A {Burkholderia pseudomallei 305} Back     alignment and structure
>3ic6_A Putative methylase family protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.59A {Neisseria gonorrhoeae fa 1090} Back     alignment and structure
>3n4j_A RNA methyltransferase; center for structural genomics of INF diseases, csgid; 1.47A {Yersinia pestis} PDB: 3n4k_A* 1mxi_A* 1j85_A* Back     alignment and structure
>3kty_A Probable methyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.30A {Bordetella pertussis} Back     alignment and structure
>3onp_A TRNA/RRNA methyltransferase (SPOU); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.90A {Rhodobacter sphaeroides} Back     alignment and structure
>3ilk_A Uncharacterized tRNA/RRNA methyltransferase HI0380; APC63004, methylase family protein, haemophilus influenzae RD KW20; 2.01A {Haemophilus influenzae} Back     alignment and structure
>3dcm_X AdoMet, uncharacterized protein TM_1570; trefoil knot, spout mtase, adoMet binding, transferase; HET: SAM; 2.00A {Thermotoga maritima} Back     alignment and structure
>2yy8_A ATRM56, UPF0106 protein PH0461; DEEP trefoil knot, structural genomics, NPPSFA; HET: SAM MTA; 2.48A {Pyrococcus horikoshii} Back     alignment and structure
>2o3a_A UPF0106 protein AF_0751; structural genomics, unknown function, PSI-2, protein structure initiative; 2.20A {Archaeoglobus fulgidus} SCOP: c.116.1.8 Back     alignment and structure
>2qwv_A UPF0217 protein VC_A1059; unknown function, structural genomics, PSI- 2, protein structure initiative; 2.60A {Vibrio cholerae o1 biovar eltor str} SCOP: c.116.1.7 Back     alignment and structure
>1v6z_A Hypothetical protein TTHA0657; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferase; 2.00A {Thermus thermophilus HB8} SCOP: b.122.1.2 c.116.1.5 PDB: 2cx8_A* 2z0y_A* Back     alignment and structure
>2qmm_A UPF0217 protein AF_1056; alpha/beta knot, SAM, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.85A {Archaeoglobus fulgidus dsm 4304} SCOP: c.116.1.7 Back     alignment and structure
>1vhy_A Hypothetical protein HI0303; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Haemophilus influenzae} SCOP: b.122.1.2 c.116.1.5 PDB: 1nxz_A Back     alignment and structure
>1vhk_A Hypothetical protein YQEU; structural genomics, unknown function; 2.60A {Bacillus subtilis} SCOP: b.122.1.2 c.116.1.5 Back     alignment and structure
>2egv_A UPF0088 protein AQ_165; RSME, methyltransferase, rRNA modification, PUA domain, M3U, SAM, structural genomics, NPPSFA; HET: SAM; 1.45A {Aquifex aeolicus} PDB: 2egw_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 282 tRNA/rRNA methyltransferase protein [Candidatus Liberib
d1gz0a1166 c.116.1.1 (A:78-243) RlmB, C-terminal domain {Escherich 7e-24
d1ipaa1158 c.116.1.1 (A:106-263) RrmA (RrmH), C-terminal domain {T 2e-18
d1mxia_156 c.116.1.1 (A:) Hypothetical tRNA/rRNA methyltransfease 2e-17
d1v2xa_191 c.116.1.1 (A:) tRNA (Gm18) methyltransferase TrmH {Ther 4e-16
d1gz0a276 d.79.3.3 (A:2-77) RlmB, N-terminal domain {Escherichia 3e-09
>d1gz0a1 c.116.1.1 (A:78-243) RlmB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta knot
superfamily: alpha/beta knot
family: SpoU-like RNA 2'-O ribose methyltransferase
domain: RlmB, C-terminal domain
species: Escherichia coli [TaxId: 562]
 Score =  104 bits (261), Expect = 7e-24
 Identities = 53/151 (35%), Positives = 82/151 (54%)

Query: 124 PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGA 183
           P L A  +   L++LD V DPHN+GA LRSA A     +I  K  S   +A   K A GA
Sbjct: 9   PDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGA 68

Query: 184 LEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPK 243
            E +P IR++NL   ++ +       +G + ++   L Q     ++AL++GAEG+G+R  
Sbjct: 69  AESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRL 128

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           T+E    +  + M G + +LNVS A  + L+
Sbjct: 129 TREHCDELISIPMAGSVSSLNVSVATGICLF 159


>d1ipaa1 c.116.1.1 (A:106-263) RrmA (RrmH), C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 158 Back     information, alignment and structure
>d1mxia_ c.116.1.1 (A:) Hypothetical tRNA/rRNA methyltransfease HI0766 (YibK homologue) {Haemophilus influenzae [TaxId: 727]} Length = 156 Back     information, alignment and structure
>d1v2xa_ c.116.1.1 (A:) tRNA (Gm18) methyltransferase TrmH {Thermus thermophilus [TaxId: 274]} Length = 191 Back     information, alignment and structure
>d1gz0a2 d.79.3.3 (A:2-77) RlmB, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target282 tRNA/rRNA methyltransferase protein [Candidatus Liberib
d1gz0a1166 RlmB, C-terminal domain {Escherichia coli [TaxId: 562]} 100.0
d1ipaa1158 RrmA (RrmH), C-terminal domain {Thermus thermophilus [T 100.0
d1v2xa_191 tRNA (Gm18) methyltransferase TrmH {Thermus thermophilu 100.0
d1mxia_156 Hypothetical tRNA/rRNA methyltransfease HI0766 (YibK ho 100.0
d2o3aa1167 Uncharacterized protein AF0751 {Archaeoglobus fulgidus 96.92
d2qmma1194 Uncharacterized protein AF1056 {Archaeoglobus fulgidus 93.62
d1ipaa2105 RrmA (RrmH), N-terminal domain {Thermus thermophilus [T 99.25
d1gz0a276 RlmB, N-terminal domain {Escherichia coli [TaxId: 562]} 99.07
d2qwva1201 Uncharacterized protein VCA1059 {Vibrio cholerae [TaxId 95.6
>d1gz0a1 c.116.1.1 (A:78-243) RlmB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta knot
superfamily: alpha/beta knot
family: SpoU-like RNA 2'-O ribose methyltransferase
domain: RlmB, C-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=292.01  Aligned_cols=152  Identities=33%  Similarity=0.529  Sum_probs=147.1

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             66506887234320688999999986420011001368632000001344433332110122232211222222210000
Q gi|254780603|r  130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT  209 (282)
Q Consensus       130 ~~~~~~i~ld~i~dp~NlG~I~Rta~a~g~~~vil~~~~~~~~~~~~~ras~Ga~~~l~~~~~~~~~~~l~~~~~~~~~i  209 (282)
                      ...+++|+||+|+||+|+|+|+|||+|||+++|++...+++++++++.|+|+|+++++|+.++.++.++++.+++.++++
T Consensus        15 ~~~~~~vvLd~i~~p~N~GaiiRta~afG~~~v~~~~~~~~~~~~~~~r~s~g~~~~v~~~~~~~~~~~l~~~~~~~~~~   94 (166)
T d1gz0a1          15 LDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWI   94 (166)
T ss_dssp             CSSCEEEEEESCCCHHHHHHHHHHHHHHTCSEEEEESSSSCCCCHHHHHHHTTHHHHSCEEEESCHHHHHHHHHHTTCEE
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHEECCCCCEEECEEECCCHHHHHHHHCCCCCCC
T ss_conf             68987999957888655999999998528864654025431100123123137503765066399999998701243211


Q ss_pred             HHCCCCCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             000123332211223689889997586789877999858939992789687437899999999999987614
Q gi|254780603|r  210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA  281 (282)
Q Consensus       210 ~~~~~~~~~~~~~~~~~~~~~lv~G~E~~Gl~~~~~~~~d~~v~Ip~~~~~~SLNvs~a~ai~l~~~~~~~~  281 (282)
                      ++++.....++.+++++++.+||||+|++|||+++++.||+.|+|||.+.++|||||+|+||+|||+.|||+
T Consensus        95 ~~~~~~~~~~~~~~~~~~~~~lv~G~E~~Gls~~~l~~~d~~v~IPm~~~~~SLNvs~A~~I~lye~~rqr~  166 (166)
T d1gz0a1          95 VGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQRS  166 (166)
T ss_dssp             EEECTTCSEEGGGSCCCSSEEEEEEBTTTBSCHHHHHTCSEEEECCCSSSSCCCCHHHHHHHHHHHHHHHTC
T ss_pred             CCCCCCCCCCHHHHHCCCCEEEEECCCCCCCCHHHHHHCCEEEEECCCCCCCCEEHHHHHHHHHHHHHHCCC
T ss_conf             123454445478851468738996667678779999868989997096899754699999999999997559



>d1ipaa1 c.116.1.1 (A:106-263) RrmA (RrmH), C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v2xa_ c.116.1.1 (A:) tRNA (Gm18) methyltransferase TrmH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mxia_ c.116.1.1 (A:) Hypothetical tRNA/rRNA methyltransfease HI0766 (YibK homologue) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2o3aa1 c.116.1.8 (A:1-167) Uncharacterized protein AF0751 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qmma1 c.116.1.7 (A:95-288) Uncharacterized protein AF1056 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ipaa2 d.79.3.3 (A:1-105) RrmA (RrmH), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gz0a2 d.79.3.3 (A:2-77) RlmB, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qwva1 c.116.1.7 (A:5-205) Uncharacterized protein VCA1059 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 282 tRNA/rRNA methyltransferase protein [Candidatus Li
3gyq_A_113-272160 (A:113-272) RRNA (adenosine-2'-O-)-methyltransfera 9e-24
3e5y_A_160 (A:) TRMH family RNA methyltransferase; ssgcid, pr 2e-23
1v2x_A_21-176156 (A:21-176) TRNA (GM18) methyltransferase; DEEP tre 1e-22
2ha8_A_184 (A:) TAR (HIV-1) RNA loop binding protein; methylt 2e-22
3ilk_A_1-174174 (A:1-174) Uncharacterized tRNA/RRNA methyltransfer 3e-22
1mxi_A_160 (A:) YIBK, hypothetical tRNA/RRNA methyltransferas 4e-22
2i6d_A_99-257159 (A:99-257) RNA methyltransferase, TRMH family; stu 8e-22
1gz0_A_90-253164 (A:90-253) Hypothetical tRNA/RRNA methyltransferas 2e-21
1x7o_A_119-287169 (A:119-287) Avirb, rRNA methyltransferase; SPOU, C 3e-21
3ic6_A_1-201201 (A:1-201) Putative methylase family protein; struc 3e-21
3kty_A_173 (A:) Probable methyltransferase; alpha-beta-alpha 5e-21
1zjr_A_24-180157 (A:24-180) TRNA (guanosine-2'-O-)-methyltransferas 7e-20
3dcm_X_192 (X:) AdoMet, uncharacterized protein TM_1570; tref 2e-19
1ipa_A_109-274166 (A:109-274) RRMH, RNA 2'-O-ribose methyltransferas 6e-19
1gz0_A_1-8989 (A:1-89) Hypothetical tRNA/RRNA methyltransferase 1e-11
>3gyq_A (A:113-272) RRNA (adenosine-2'-O-)-methyltransferase; rRNA methyltransferase, spout mtases, SAM, trefoil knot, antibiotic resistance; HET: SAM; 2.45A {Streptomyces cyaneus}Length = 160 Back     alignment and structure
 Score =  105 bits (262), Expect = 9e-24
 Identities = 42/159 (26%), Positives = 72/159 (45%), Gaps = 3/159 (1%)

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
           D       ++VLD V    NIGAI+R+++A    GII       S +    + AS     
Sbjct: 1   DIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIADRRLQRASRGYVF 60

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSD-SKKPLEQEIKNDKIALILGAEGKGLRPKTQ 245
              + +S   +A+  +   G Q + L +D      E     D++AL+ G+E  G     +
Sbjct: 61  SLPVVLSGREEAIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKGGPSDLFE 120

Query: 246 ETATSMAHLHMPGIIKALNVSNAAAVALY--ITQNHFAK 282
           E +++   + M    ++LNVS +  +AL+  I +N  A 
Sbjct: 121 EASSASVSIPMMSQTESLNVSVSLGIALHERIDRNLAAN 159


>3e5y_A (A:) TRMH family RNA methyltransferase; ssgcid, protein knot, decode, structural genomics; 2.40A {Burkholderia pseudomallei 305}Length = 160 Back     alignment and structure
>1v2x_A (A:21-176) TRNA (GM18) methyltransferase; DEEP trefoil knot, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: SAM; 1.50A {Thermus thermophilus}Length = 156 Back     alignment and structure
>2ha8_A (A:) TAR (HIV-1) RNA loop binding protein; methyltransferase, structural genomics, structural genomics consortium, SGC, RNA binding protein; HET: SAH; 1.60A {Homo sapiens}Length = 184 Back     alignment and structure
>3ilk_A (A:1-174) Uncharacterized tRNA/RRNA methyltransferase HI0380; APC63004, methylase family protein, haemophilus influenzae RD KW20; 2.01A {Haemophilus influenzae}Length = 174 Back     alignment and structure
>1mxi_A (A:) YIBK, hypothetical tRNA/RRNA methyltransferase HI0766; S-adenosylhomocysteine, SPOU family, structure 2 function project; HET: SAH; 1.70A {Haemophilus influenzae}Length = 160 Back     alignment and structure
>2i6d_A (A:99-257) RNA methyltransferase, TRMH family; stuctural genomics, knot, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.85A {Porphyromonas gingivalis W83}Length = 159 Back     alignment and structure
>1gz0_A (A:90-253) Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli}Length = 164 Back     alignment and structure
>1x7o_A (A:119-287) Avirb, rRNA methyltransferase; SPOU, C-terminal knot, seMet; 2.37A {Streptomyces viridochromogenes} PDB: 1x7p_A*Length = 169 Back     alignment and structure
>3ic6_A (A:1-201) Putative methylase family protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.59A {Neisseria gonorrhoeae fa 1090}Length = 201 Back     alignment and structure
>3kty_A (A:) Probable methyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.30A {Bordetella pertussis}Length = 173 Back     alignment and structure
>1zjr_A (A:24-180) TRNA (guanosine-2'-O-)-methyltransferase; methylase, RNA modifying enzyme, topological knot; 1.85A {Aquifex aeolicus}Length = 157 Back     alignment and structure
>3dcm_X (X:) AdoMet, uncharacterized protein TM_1570; trefoil knot, spout mtase, adoMet binding, transferase; HET: SAM; 2.00A {Thermotoga maritima}Length = 192 Back     alignment and structure
>1ipa_A (A:109-274) RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil knot, rossmann fold, EL30-like fold, riken structural genomics/proteomics initiative; 2.40A {Thermus thermophilus}Length = 166 Back     alignment and structure
>1gz0_A (A:1-89) Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli}Length = 89 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target282 tRNA/rRNA methyltransferase protein [Candidatus Liberib
1gz0_A_90-253164 Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O 100.0
1ipa_A_109-274166 RRMH, RNA 2'-O-ribose methyltransferase; DEEP tref 100.0
3e5y_A_160 TRMH family RNA methyltransferase; ssgcid, protein 100.0
1x7o_A_119-287169 Avirb, rRNA methyltransferase; SPOU, C-terminal kn 100.0
2ha8_A_184 TAR (HIV-1) RNA loop binding protein; methyltransf 100.0
2i6d_A_99-257159 RNA methyltransferase, TRMH family; stuctural geno 100.0
1zjr_A_24-180157 TRNA (guanosine-2'-O-)-methyltransferase; methylas 100.0
3ic6_A_1-201201 Putative methylase family protein; structural geno 100.0
1mxi_A_160 YIBK, hypothetical tRNA/RRNA methyltransferase HI0 100.0
1v2x_A_21-176156 TRNA (GM18) methyltransferase; DEEP trefoil knot, 100.0
3kty_A_173 Probable methyltransferase; alpha-beta-alpha sandw 100.0
3gyq_A_113-272160 RRNA (adenosine-2'-O-)-methyltransferase; rRNA met 100.0
3ilk_A_1-174174 Uncharacterized tRNA/RRNA methyltransferase HI0380 100.0
3dcm_X_192 AdoMet, uncharacterized protein TM_1570; trefoil k 100.0
2yy8_A_201 ATRM56, UPF0106 protein PH0461; DEEP trefoil knot, 96.72
2egv_A_68-229162 UPF0088 protein AQ_165; RSME, methyltransferase, r 96.57
2o3a_A_178 UPF0106 protein AF_0751; structural genomics, unkn 96.18
1v6z_A_68-228161 Hypothetical protein TTHA0657; structural genomics 95.65
2qwv_A_208 UPF0217 protein VC_A1059; unknown function, struct 95.17
3kw2_A_75-257183 Probable R-RNA methyltransferase; structural genom 94.01
1vhy_A_78-257180 Hypothetical protein HI0303; PSI, protein structur 93.11
1vhk_A_78-268191 Hypothetical protein YQEU; structural genomics, un 92.94
1k3r_A_1-84_161-268192 Conserved protein MT0001; beta barrel, structural 90.64
2qmm_A_197 UPF0217 protein AF_1056; alpha/beta knot, SAM, str 90.03
3gyq_A_1-112112 RRNA (adenosine-2'-O-)-methyltransferase; rRNA met 99.39
1x7o_A_1-118118 Avirb, rRNA methyltransferase; SPOU, C-terminal kn 99.38
1ipa_A_1-108108 RRMH, RNA 2'-O-ribose methyltransferase; DEEP tref 99.38
1gz0_A_1-8989 Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O 99.21
2i6d_A_1-9898 RNA methyltransferase, TRMH family; stuctural geno 99.13
1z85_A_83-234152 Hypothetical protein TM1380; structural genomics, 96.1
>1gz0_A (A:90-253) Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=9.8e-45  Score=275.44  Aligned_cols=153  Identities=32%  Similarity=0.502  Sum_probs=148.7

Q ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             26650688723432068899999998642001100136863200000134443333211012223221122222221000
Q gi|254780603|r  129 VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ  208 (282)
Q Consensus       129 ~~~~~~~i~ld~i~dp~NlG~I~Rta~a~g~~~vil~~~~~~~~~~~~~ras~Ga~~~l~~~~~~~~~~~l~~~~~~~~~  208 (282)
                      .+..+++++||+|+||+|+|+|+|||++||+++|++...+++++++++.|+|+|+.+++++.+++++.++++.++..+++
T Consensus        12 ~~~~~~~vvl~~i~~p~NiG~i~Rt~~afG~~~i~~~~~~~~~~~~~~~r~s~g~~~~~~~~~~~~~~~~~~~~~~~~~~   91 (164)
T 1gz0_A           12 SLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTXRXLQEENIW   91 (164)
T ss_dssp             TCSSCEEEEEESCCCHHHHHHHHHHHHHHTCSEEEEESSSSCCCCHHHHHHHTTHHHHSCEEEESCHHHHHHHHHHTTCE
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHCCCCEEEEEEEECCHHHHHHHHHHHHHH
T ss_conf             56897799996688701898999999970887179836976620455666431631375249978999999985430000


Q ss_pred             HHHCCCCCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             0000123332211223689889997586789877999858939992789687437899999999999987614
Q gi|254780603|r  209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA  281 (282)
Q Consensus       209 i~~~~~~~~~~~~~~~~~~~~~lv~G~E~~Gl~~~~~~~~d~~v~Ip~~~~~~SLNvs~a~ai~l~~~~~~~~  281 (282)
                      +++++..+..++.+..++++.+||||+|+.|||+++++.||..|+|||.+.++|||||+|+||+|||+.||++
T Consensus        92 ~~~~~~~~~~~~~~~~~~~~~~lv~G~E~~Gls~e~l~~~d~~v~IP~~g~~~SLNva~A~~I~lye~~rq~~  164 (164)
T 1gz0_A           92 IVGTAGEADHTLYQSKXTGRLALVXGAEGEGXRRLTREHCDELISIPXAGSVSSLNVSVATGICLFEAVRQRS  164 (164)
T ss_dssp             EEEECTTCSEEGGGSCCCSSEEEEEEBTTTBSCHHHHHTCSEEEECCCSSSSCCCCHHHHHHHHHHHHHHHTC
T ss_pred             CCCCCCCCCCCHHHHHCCCCEEEEECCCCCCCCHHHHHHCCEEEEECCCCCCCEEEHHHHHHHHHHHHHHCCC
T ss_conf             0222334566513331367559998778788999999858989996899999736499999999999997639



>1ipa_A (A:109-274) RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil knot, rossmann fold, EL30-like fold, riken structural genomics/proteomics initiative; 2.40A {Thermus thermophilus} Back     alignment and structure
>3e5y_A (A:) TRMH family RNA methyltransferase; ssgcid, protein knot, decode, structural genomics; 2.40A {Burkholderia pseudomallei 305} Back     alignment and structure
>1x7o_A (A:119-287) Avirb, rRNA methyltransferase; SPOU, C-terminal knot, seMet; 2.37A {Streptomyces viridochromogenes} PDB: 1x7p_A* Back     alignment and structure
>2ha8_A (A:) TAR (HIV-1) RNA loop binding protein; methyltransferase, structural genomics, structural genomics consortium, SGC, RNA binding protein; HET: SAH; 1.60A {Homo sapiens} Back     alignment and structure
>2i6d_A (A:99-257) RNA methyltransferase, TRMH family; stuctural genomics, knot, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.85A {Porphyromonas gingivalis W83} Back     alignment and structure
>1zjr_A (A:24-180) TRNA (guanosine-2'-O-)-methyltransferase; methylase, RNA modifying enzyme, topological knot; 1.85A {Aquifex aeolicus} Back     alignment and structure
>3ic6_A (A:1-201) Putative methylase family protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.59A {Neisseria gonorrhoeae fa 1090} Back     alignment and structure
>1mxi_A (A:) YIBK, hypothetical tRNA/RRNA methyltransferase HI0766; S-adenosylhomocysteine, SPOU family, structure 2 function project; HET: SAH; 1.70A {Haemophilus influenzae} Back     alignment and structure
>1v2x_A (A:21-176) TRNA (GM18) methyltransferase; DEEP trefoil knot, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: SAM; 1.50A {Thermus thermophilus} Back     alignment and structure
>3kty_A (A:) Probable methyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.30A {Bordetella pertussis} Back     alignment and structure
>3gyq_A (A:113-272) RRNA (adenosine-2'-O-)-methyltransferase; rRNA methyltransferase, spout mtases, SAM, trefoil knot, antibiotic resistance; HET: SAM; 2.45A {Streptomyces cyaneus} Back     alignment and structure
>3ilk_A (A:1-174) Uncharacterized tRNA/RRNA methyltransferase HI0380; APC63004, methylase family protein, haemophilus influenzae RD KW20; 2.01A {Haemophilus influenzae} Back     alignment and structure
>3dcm_X (X:) AdoMet, uncharacterized protein TM_1570; trefoil knot, spout mtase, adoMet binding, transferase; HET: SAM; 2.00A {Thermotoga maritima} Back     alignment and structure
>2yy8_A (A:) ATRM56, UPF0106 protein PH0461; DEEP trefoil knot, structural genomics, NPPSFA; HET: SAM MTA; 2.48A {Pyrococcus horikoshii} Back     alignment and structure
>2egv_A (A:68-229) UPF0088 protein AQ_165; RSME, methyltransferase, rRNA modification, PUA domain, M3U, SAM, structural genomics, NPPSFA; HET: SAM; 1.45A {Aquifex aeolicus} PDB: 2egw_A* Back     alignment and structure
>2o3a_A (A:) UPF0106 protein AF_0751; structural genomics, unknown function, PSI-2, protein structure initiative; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>1v6z_A (A:68-228) Hypothetical protein TTHA0657; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferase; 2.00A {Thermus thermophilus HB8} Back     alignment and structure
>2qwv_A (A:) UPF0217 protein VC_A1059; unknown function, structural genomics, PSI- 2, protein structure initiative; 2.60A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>3kw2_A (A:75-257) Probable R-RNA methyltransferase; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE ADN; 2.00A {Porphyromonas gingivalis atcc 33277} Back     alignment and structure
>1vhy_A (A:78-257) Hypothetical protein HI0303; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Haemophilus influenzae} Back     alignment and structure
>1vhk_A (A:78-268) Hypothetical protein YQEU; structural genomics, unknown function; 2.60A {Bacillus subtilis} Back     alignment and structure
>1k3r_A (A:1-84,A:161-268) Conserved protein MT0001; beta barrel, structural genomics, PSI, protein structure initiative; 2.30A {Methanothermobacterthermautotrophicus} Back     alignment and structure
>2qmm_A (A:) UPF0217 protein AF_1056; alpha/beta knot, SAM, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.85A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3gyq_A (A:1-112) RRNA (adenosine-2'-O-)-methyltransferase; rRNA methyltransferase, spout mtases, SAM, trefoil knot, antibiotic resistance; HET: SAM; 2.45A {Streptomyces cyaneus} Back     alignment and structure
>1x7o_A (A:1-118) Avirb, rRNA methyltransferase; SPOU, C-terminal knot, seMet; 2.37A {Streptomyces viridochromogenes} PDB: 1x7p_A* Back     alignment and structure
>1ipa_A (A:1-108) RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil knot, rossmann fold, EL30-like fold, riken structural genomics/proteomics initiative; 2.40A {Thermus thermophilus} Back     alignment and structure
>1gz0_A (A:1-89) Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli} Back     alignment and structure
>2i6d_A (A:1-98) RNA methyltransferase, TRMH family; stuctural genomics, knot, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.85A {Porphyromonas gingivalis W83} Back     alignment and structure
>1z85_A (A:83-234) Hypothetical protein TM1380; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.12A {Thermotoga maritima MSB8} Back     alignment and structure