254780604

254780604

5-aminolevulinate synthase

GeneID in NCBI database:8209603Locus tag:CLIBASIA_02455
Protein GI in NCBI database:254780604Protein Accession:YP_003065017.1
Gene range:-(675046, 676251)Protein Length:401aa
Gene description:5-aminolevulinate synthase
COG prediction:none
KEGG prediction:hemA; 5-aminolevulinate synthase (EC:2.3.1.37); K00643 5-aminolevulinate synthase [EC:2.3.1.37]
SEED prediction:5-aminolevulinate synthase (EC 2.3.1.37)
Pathway involved in KEGG:Glycine, serine and threonine metabolism [PATH:las00260]
Porphyrin and chlorophyll metabolism [PATH:las00860]
Subsystem involved in SEED:Heme and Siroheme Biosynthesis;
Threonine degradation
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-
MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAIHNSDEGSRKVTIWCSNDYLGMGKHPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHGKKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDLEDLEKNLAATDLSIPKIIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHGSCGAGISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPPAIASASVTSIQYIKQHYDERKKYLERVKQLRHSLENKAIPCIPNESHIIPIMVGDSHKCTQISNILLKEFGIYIQPINYPTVAKKKERLRVTLTPLHTDSDIEHLVSSLENVWQKMNRYA
ccHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHcccEEEEEcccccccccccccccHHHcccccccEEEEEccccccccccEEEEEcHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccHHHHHHHHHHHHHHccEEEEEcccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccc
ccHHHHHHHHHHHHHHccccEEHHHHHHHcccccccHHccccccEEEEEccccccccHHHcHHHHHHHHHHHHHHccccccEcccccccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHccccccEEEEEEEEEccccccccHHHHHHHHHHcccEEEEEccEEccccccccccccccccccccEEEEEccHHHHHcccccEEccHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccHHHHHHHHHHHHHHcccEEEEEcccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHccccc
MDFEKFFKDQINYLHHEKRYRFFTELAYeqyqfpyaihnsdegsrkvTIWCsndylgmgkhpkVIENAQRTFekcgigaggtrniagTNYYHVMLEKELATLHGKKAALIFNSGYIANWATIGTLCsqidniicfsdshnhaSIIEGINKARCKKVIWNHNDLEDLEKNlaatdlsipkiiifesiysmdgdiapiKEICDLADQYNAItyidevhavgihgscgagisereGIMNRITIISGTLakgfgtfggYIAASENLCDFIRSFasgfifstslppaiasaSVTSIQYIKQHYDERKKYLERVKQLRHSLenkaipcipneshiipimvgdshkctqISNILLKEfgiyiqpinyptvakkKERLRVtltplhtdsdIEHLVSSLENVWQKMNRYA
MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAihnsdegsrKVTIWCSNDYLGMGKHPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHGKKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDLEDLEKNlaatdlsipkiIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHGSCGAGISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPPAIASASVTSIQYIKQHYDERKKYLERVKQLRHSLenkaipcipnESHIIPIMVGDSHKCTQISNILLKEFGIYIQPINYPTVAKKKERLRVTLTplhtdsdiehlVSSLENVWQKMNRYA
MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAIHNSDEGSRKVTIWCSNDYLGMGKHPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHGKKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDLEDLEKNLAATDLSIPKIIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHGSCGAGISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPPAIASASVTSIQYIKQHYDERKKYLERVKQLRHSLENKAIPCIPNESHIIPIMVGDSHKCTQISNILLKEFGIYIQPINYPTVAKKKERLRVTLTPLHTDSDIEHLVSSLENVWQKMNRYA
MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAIHNSDEGSRKVTIWCSNDYLGMGKHPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHGKKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDLEDLEKNLAATDLSIPKIIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHGSCGAGISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPPAIASASVTSIQYIKQHYD*RKKYLERVKQLRHSLENKAIPCIPNESHIIPIMVGDSHKCTQISNILLKEFGIYIQPINYPTVAKKKERLRVTLTPLHTDSDIEHLVSSLENVWQKMNRYA
MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAIHNSDEGSRKVTIWCSNDYLGMGKHPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHGKKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDLEDLEKNLAATDLSIPKIIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHGSCGAGISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPPAIASASVTSIQYIKQHYDERKKYLERVKQLRHSLENKAIPCIPNESHIIPIMVGDSHKCTQISNILLKEFGIYIQPINYPTVAKKKERLRVTLTPLHTDSDIEHLVSSLENVWQKMNRYA
MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAIHNSDEGSRKVTIWCSNDYLGMGKHPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHGKKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDLEDLEKNLAATDLSIPKIIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHGSCGAGISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPPAIASASVTSIQYIKQHYDERKKYLERVKQLRHSLENKAIPCIPNESHIIPIMVGDSHKCTQISNILLKEFGIYIQPINYPTVAKKKERLRVTLTPLHTDSDIEHLVSSLENVWQKMNRYA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAIHNSDEGSRKVTIWCSNDYLGMGKHPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHGKKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDLEDLEKNLAATDLSIPKIIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHGSCGAGISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPPAIASASVTSIQYxxxxxxxxxxxxxxxxxxxxxLENKAIPCIPNESHIIPIMVGDSHKCTQISNILLKEFGIYIQPINYPTVAKKKERLRVTLTPLHTDSDIEHLVSSLENVWQKMNRYA
MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAIHNSDEGSRKVTIWCSNDYLGMGKHPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHGKKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDLEDLEKNLAATDLSIPKIIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHGSCGAGISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPPAIASASVTSIQYIKQHYDERKKYLERVKQLRHSLENKAIPCIPNESHIIPIMVGDSHKCTQISNILLKEFGIYIQPINYPTVAKKKERLRVTLTPLHTDSDIEHLVSSLENVWQKMNRYA
MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAIHNSDEGSRKVTIWCSNDYLGMGKHPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHGKKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDLEDLEKNLAATDLSIPKIIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHGSCGAGISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPPAIASASVTSIQYIKQHYDERKKYLERVKQLRHSLENKAIPCIPNESHIIPIMVGDSHKCTQISNILLKEFGIYIQPINYPTVAKKKERLRVTLTPLHTDSDIEHLVSSLENVWQKMNRYA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target401 5-aminolevulinate synthase [Candidatus Liberibacter asi
254780486381 8-amino-7-oxononanoate synthase [Candidatus Liberi 2e-41
254780163 798 ATP-dependent Clp protease ATP-binding subunit [Ca 0.018
>gi|254780486|ref|YP_003064899.1| 8-amino-7-oxononanoate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 381 Back     alignment
 Score =  161 bits (407), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 111/341 (32%), Positives = 178/341 (52%), Gaps = 20/341 (5%)

Query: 45  RKVTIW--CSNDYLGMGKHPKVIENAQRTFE-KCGIGAGGTRNIAGTNYYHVMLEKELAT 101
           R+  IW   S+DYL +     + E    + + K  IG+GG+R + G    H+ LE+E A 
Sbjct: 27  RRQDIWDFTSHDYLALSSSTLLREKILSSLDSKIPIGSGGSRLLCGNYNQHLELEEEAAD 86

Query: 102 LHGKKAALIFNSGYIANWATIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHN 161
             G +  L F SGY AN A + TL    D I+   D   HASI EGIN  + + +   HN
Sbjct: 87  FFGFEKMLYFGSGYAANMAILSTLPQATDLIVY--DKLVHASIREGINSGKAQAIAIPHN 144

Query: 162 DLEDLEKNLAATDLSIPK---IIIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAV 218
           ++    +N+     S  K    I+ ESIYSMDGD AP+ ++  +A+ Y+    +DE HA 
Sbjct: 145 NINSFAENINKWRKSGGKGFPWIVVESIYSMDGDKAPLDDLVKIANDYDGFIVVDEAHAT 204

Query: 219 GIHGSCGAG----ISEREGIMNRITIISGTLAKGFGTFGGYIAASENLCDFIRSFASGFI 274
           G+ G  G G    I ER  +     I+  + +K  G+ G  + +++ + D++ ++A  FI
Sbjct: 205 GVCGPLGKGLTHIIEERNNV-----IVMHSCSKALGSSGALVGSNKIIYDYLINYAKPFI 259

Query: 275 FSTSLPPAIASASVTSIQYIKQHYDERKKYLERVKQLRHSLENKAIPCIPNESHIIPIMV 334
           ++TS  P +A  +  +++ IK+     K  L+ +  +   + NK I    ++SHI  I++
Sbjct: 260 YTTSPSPILAVVACEALKLIKRKPALHKSLLQLI-NITDKIANKKI-GFSSQSHIQSIVI 317

Query: 335 GDSHKCTQISNILLKEFGIYIQPINYPTVAKKKERLRVTLT 375
           GD+  C  I+  L K+ G  I+ I  PTV     RLR+++T
Sbjct: 318 GDNKSCLNIAKNLQKK-GFDIRAIRPPTVPINTARLRISIT 357

>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Back     alignment
 Score = 32.0 bits (71), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 76/174 (43%), Gaps = 26/174 (14%)

Query: 173 TDLSIPKIIIFESIYSMD-----------GDIAP-IKEICDLADQY-NAITYIDEVHAVG 219
            D  +P I++   I+S+D           GD    IK+I    + Y NAI YIDE+H + 
Sbjct: 250 VDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLV 309

Query: 220 IHGSCGAGISEREGIMNRITIISGTL-AKGFGTFGGYIAASENLCDFIRSFASGFIFSTS 278
             GS  +GIS     + +  + SG +   G  T+  Y    E     +R F    +   S
Sbjct: 310 GAGSA-SGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPS 368

Query: 279 LPPAIASASVTSIQ-YIKQHYDER--KKYLERVKQL--RH----SLENKAIPCI 323
           +  AI    V  I+ Y ++H+  R  K+ +    QL  RH     L +KAI  I
Sbjct: 369 IEDAI--EIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI 420

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target401 5-aminolevulinate synthase [Candidatus Liberibacter asi
315121805402 5-aminolevulinate synthase [Candidatus Liberibacter sol 1 0.0
222087404409 8-amino-7-oxononanoate synthase protein [Agrobacterium 1 1e-151
325293983419 5-aminolevulinate synthase [Agrobacterium sp. H13-3] Le 1 1e-148
122818405 RecName: Full=5-aminolevulinate synthase; AltName: Full 1 1e-148
222150009404 5-aminolevulinate synthase [Agrobacterium vitis S4] Len 1 1e-148
229007178405 5-aminolevulinate synthase [Agrobacterium tumefaciens s 1 1e-147
88174325405 5-aminolevulinate synthase protein [Agrobacterium tumef 1 1e-147
86361219404 5-aminolevulinate synthase [Rhizobium etli CFN 42] Leng 1 1e-146
116254112404 5-aminolevulinate synthase [Rhizobium leguminosarum bv. 1 1e-146
86359428404 5-aminolevulinate synthase [Rhizobium etli CFN 42] Leng 1 1e-146
>gi|315121805|ref|YP_004062294.1| 5-aminolevulinate synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 402 Back     alignment and organism information
 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/398 (83%), Positives = 367/398 (92%)

Query: 1   MDFEKFFKDQINYLHHEKRYRFFTELAYEQYQFPYAIHNSDEGSRKVTIWCSNDYLGMGK 60
           MDFEKFFKDQINYLH EKRYR FTELAY+  +FPYA HNS EGS+KVTIWCSNDYLGMGK
Sbjct: 1   MDFEKFFKDQINYLHREKRYRVFTELAYDPCRFPYATHNSAEGSKKVTIWCSNDYLGMGK 60

Query: 61  HPKVIENAQRTFEKCGIGAGGTRNIAGTNYYHVMLEKELATLHGKKAALIFNSGYIANWA 120
           + KVIE+A++TFE CGIGAGGTRNIAGTNYYHVMLEKEL+ LHGK++ALIFNSGY ANWA
Sbjct: 61  NLKVIESAKKTFENCGIGAGGTRNIAGTNYYHVMLEKELSDLHGKESALIFNSGYTANWA 120

Query: 121 TIGTLCSQIDNIICFSDSHNHASIIEGINKARCKKVIWNHNDLEDLEKNLAATDLSIPKI 180
           TIGTLCS IDNI+CFSD+HNHASIIEGI KARCKKVIW HNDL+DLEK+LAAT LS PK+
Sbjct: 121 TIGTLCSHIDNIVCFSDAHNHASIIEGIQKARCKKVIWKHNDLDDLEKHLAATSLSTPKM 180

Query: 181 IIFESIYSMDGDIAPIKEICDLADQYNAITYIDEVHAVGIHGSCGAGISEREGIMNRITI 240
           IIFESIYSMDGDIAPIK+ICDLAD+Y+AITYIDEVHAVGIHG  GAGISEREGIM+RIT+
Sbjct: 181 IIFESIYSMDGDIAPIKKICDLADKYHAITYIDEVHAVGIHGERGAGISEREGIMDRITV 240

Query: 241 ISGTLAKGFGTFGGYIAASENLCDFIRSFASGFIFSTSLPPAIASASVTSIQYIKQHYDE 300
           ISGTLAKGFG FGGYIAAS +LCDFIRSFASGFIFSTSLPPAIA+A++TSIQY+K+H  E
Sbjct: 241 ISGTLAKGFGAFGGYIAASASLCDFIRSFASGFIFSTSLPPAIANAAITSIQYLKEHVCE 300

Query: 301 RKKYLERVKQLRHSLENKAIPCIPNESHIIPIMVGDSHKCTQISNILLKEFGIYIQPINY 360
           R  YL+RVK LR +LE KAIPCIPNESHIIPIMVGDS KC  IS++LLKEFGIYIQPINY
Sbjct: 301 RNVYLKRVKNLRETLEKKAIPCIPNESHIIPIMVGDSQKCKWISDVLLKEFGIYIQPINY 360

Query: 361 PTVAKKKERLRVTLTPLHTDSDIEHLVSSLENVWQKMN 398
           PTVA+KKERLRVTLTPLHTDSDIEHLVSSLEN+W  ++
Sbjct: 361 PTVARKKERLRVTLTPLHTDSDIEHLVSSLENIWHDID 398


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222087404|ref|YP_002545941.1| 8-amino-7-oxononanoate synthase protein [Agrobacterium radiobacter K84] Length = 409 Back     alignment and organism information
>gi|325293983|ref|YP_004279847.1| 5-aminolevulinate synthase [Agrobacterium sp. H13-3] Length = 419 Back     alignment and organism information
>gi|122818|sp|P26505|HEM1_RHIRD RecName: Full=5-aminolevulinate synthase; AltName: Full=5-aminolevulinic acid synthase; AltName: Full=Delta-ALA synthase; AltName: Full=Delta-aminolevulinate synthase Length = 405 Back     alignment and organism information
>gi|222150009|ref|YP_002550966.1| 5-aminolevulinate synthase [Agrobacterium vitis S4] Length = 404 Back     alignment and organism information
>gi|229007178|ref|NP_355550.3| 5-aminolevulinate synthase [Agrobacterium tumefaciens str. C58] Length = 405 Back     alignment and organism information
>gi|88174325|gb|ABD39319.1| 5-aminolevulinate synthase protein [Agrobacterium tumefaciens] Length = 405 Back     alignment and organism information
>gi|86361219|ref|YP_473106.1| 5-aminolevulinate synthase [Rhizobium etli CFN 42] Length = 404 Back     alignment and organism information
>gi|116254112|ref|YP_769950.1| 5-aminolevulinate synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 404 Back     alignment and organism information
>gi|86359428|ref|YP_471320.1| 5-aminolevulinate synthase [Rhizobium etli CFN 42] Length = 404 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target401 5-aminolevulinate synthase [Candidatus Liberibacter asi
PRK09064407 PRK09064, PRK09064, 5-aminolevulinate synthase; Validat 0.0
PRK13393406 PRK13393, PRK13393, 5-aminolevulinate synthase; Provisi 1e-176
TIGR01821402 TIGR01821, 5aminolev_synth, 5-aminolevulinic acid synth 1e-173
PRK13392410 PRK13392, PRK13392, 5-aminolevulinate synthase; Provisi 1e-160
COG0156388 COG0156, BioF, 7-keto-8-aminopelargonate synthetase and 1e-118
KOG1360570 KOG1360, KOG1360, KOG1360, 5-aminolevulinate synthase [ 1e-138
cd06454349 cd06454, KBL_like, KBL_like; this family belongs to the 1e-128
TIGR00858360 TIGR00858, bioF, 8-amino-7-oxononanoate synthase 1e-92
PRK05958385 PRK05958, PRK05958, 8-amino-7-oxononanoate synthase; Re 3e-90
PRK06939397 PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A l 7e-84
TIGR01825385 TIGR01825, gly_Cac_T_rel, pyridoxal phosphate-dependent 1e-73
TIGR01822393 TIGR01822, 2am3keto_CoA, 2-amino-3-ketobutyrate coenzym 2e-68
KOG1359417 KOG1359, KOG1359, KOG1359, Glycine C-acetyltransferase/ 4e-67
pfam00155351 pfam00155, Aminotran_1_2, Aminotransferase class I and 2e-57
PLN02955476 PLN02955, PLN02955, 8-amino-7-oxononanoate synthase 3e-52
PLN02483489 PLN02483, PLN02483, serine palmitoyltransferase 2e-43
PLN02822481 PLN02822, PLN02822, serine palmitoyltransferase 3e-43
KOG1357519 KOG1357, KOG1357, KOG1357, Serine palmitoyltransferase 3e-42
PRK07179407 PRK07179, PRK07179, hypothetical protein; Provisional 4e-41
PRK07505402 PRK07505, PRK07505, hypothetical protein; Provisional 9e-39
PLN03227392 PLN03227, PLN03227, serine palmitoyltransferase-like pr 3e-34
KOG1358467 KOG1358, KOG1358, KOG1358, Serine palmitoyltransferase 7e-34
PRK05937370 PRK05937, PRK05937, 8-amino-7-oxononanoate synthase; Pr 3e-26
cd00610413 cd00610, OAT_like, Acetyl ornithine aminotransferase fa 3e-04
cd00614369 cd00614, CGS_like, CGS_like: Cystathionine gamma-syntha 1e-07
COG0626396 COG0626, MetC, Cystathionine beta-lyases/cystathionine 5e-07
KOG0053409 KOG0053, KOG0053, KOG0053, Cystathionine beta-lyases/cy 3e-06
pfam01212288 pfam01212, Beta_elim_lyase, Beta-eliminating lyase 2e-05
pfam01053381 pfam01053, Cys_Met_Meta_PP, Cys/Met metabolism PLP-depe 3e-05
COG2873426 COG2873, MET17, O-acetylhomoserine sulfhydrylase [Amino 0.004
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) superf 3e-07
COG0520405 COG0520, CsdB, Selenocysteine lyase [Amino acid transpo 5e-05
cd00609350 cd00609, AAT_like, Aspartate aminotransferase family 5e-05
KOG1368384 KOG1368, KOG1368, KOG1368, Threonine aldolase [Amino ac 6e-04
COG1104386 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine 7e-04
COG0001432 COG0001, HemL, Glutamate-1-semialdehyde aminotransferas 1e-04
COG2008342 COG2008, GLY1, Threonine aldolase [Amino acid transport 1e-04
PRK07503403 PRK07503, PRK07503, methionine gamma-lyase; Provisional 5e-04
COG0160447 COG0160, GabT, 4-aminobutyrate aminotransferase and rel 7e-04
>gnl|CDD|181634 PRK09064, PRK09064, 5-aminolevulinate synthase; Validated Back     alignment and domain information
>gnl|CDD|184024 PRK13393, PRK13393, 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|162547 TIGR01821, 5aminolev_synth, 5-aminolevulinic acid synthase Back     alignment and domain information
>gnl|CDD|184023 PRK13392, PRK13392, 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|30505 COG0156, BioF, 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|36574 KOG1360, KOG1360, KOG1360, 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|99747 cd06454, KBL_like, KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>gnl|CDD|129937 TIGR00858, bioF, 8-amino-7-oxononanoate synthase Back     alignment and domain information
>gnl|CDD|180327 PRK05958, PRK05958, 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|180765 PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>gnl|CDD|130884 TIGR01825, gly_Cac_T_rel, pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>gnl|CDD|130881 TIGR01822, 2am3keto_CoA, 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>gnl|CDD|36573 KOG1359, KOG1359, KOG1359, Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143923 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|178541 PLN02955, PLN02955, 8-amino-7-oxononanoate synthase Back     alignment and domain information
>gnl|CDD|178101 PLN02483, PLN02483, serine palmitoyltransferase Back     alignment and domain information
>gnl|CDD|178417 PLN02822, PLN02822, serine palmitoyltransferase Back     alignment and domain information
>gnl|CDD|36571 KOG1357, KOG1357, KOG1357, Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|180866 PRK07179, PRK07179, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181006 PRK07505, PRK07505, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178766 PLN03227, PLN03227, serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|36572 KOG1358, KOG1358, KOG1358, Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|102071 PRK05937, PRK05937, 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>gnl|CDD|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family Back     alignment and domain information
>gnl|CDD|99738 cd00614, CGS_like, CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>gnl|CDD|30971 COG0626, MetC, Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|35276 KOG0053, KOG0053, KOG0053, Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|144709 pfam01212, Beta_elim_lyase, Beta-eliminating lyase Back     alignment and domain information
>gnl|CDD|144590 pfam01053, Cys_Met_Meta_PP, Cys/Met metabolism PLP-dependent enzyme Back     alignment and domain information
>gnl|CDD|32700 COG2873, MET17, O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|30866 COG0520, CsdB, Selenocysteine lyase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|36582 KOG1368, KOG1368, KOG1368, Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31301 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30350 COG0001, HemL, Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|32191 COG2008, GLY1, Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181005 PRK07503, PRK07503, methionine gamma-lyase; Provisional Back     alignment and domain information
>gnl|CDD|30509 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 401 5-aminolevulinate synthase [Candidatus Liberibacter asi
TIGR00858378 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR0047 100.0
TIGR01821427 5aminolev_synth 5-aminolevulinic acid synthase; InterPr 100.0
PRK09064406 5-aminolevulinate synthase; Validated 100.0
PRK13392410 5-aminolevulinate synthase; Provisional 100.0
PRK13393404 5-aminolevulinate synthase; Provisional 100.0
TIGR01825392 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransfe 100.0
PRK06939395 2-amino-3-ketobutyrate coenzyme A ligase; Provisional 100.0
PRK05958387 8-amino-7-oxononanoate synthase; Reviewed 100.0
TIGR01822395 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase; 100.0
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and related e 100.0
PRK07179408 hypothetical protein; Provisional 100.0
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 100.0
PRK07505405 hypothetical protein; Provisional 100.0
KOG1359417 consensus 100.0
KOG1360570 consensus 100.0
KOG1357519 consensus 100.0
KOG1358467 consensus 100.0
TIGR00707402 argD acetylornithine and succinylornithine aminotransfe 100.0
TIGR00713434 hemL glutamate-1-semialdehyde-2,1-aminomutase; InterPro 100.0
TIGR01885426 Orn_aminotrans ornithine--oxo-acid transaminase; InterP 100.0
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [Amino 100.0
PRK02627398 acetylornithine aminotransferase; Provisional 100.0
PRK00062429 glutamate-1-semialdehyde aminotransferase; Provisional 100.0
PTZ00125415 ornithine aminotransferase; Provisional 100.0
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisional 100.0
PRK12389429 glutamate-1-semialdehyde aminotransferase; Provisional 100.0
PRK06942425 glutamate-1-semialdehyde 2,1-aminomutase; Validated 100.0
cd00610413 OAT_like Acetyl ornithine aminotransferase family. This 100.0
PRK05965459 hypothetical protein; Provisional 100.0
PRK11522468 putrescine--2-oxoglutarate aminotransferase; Provisiona 100.0
PRK05964421 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK06149972 hypothetical protein; Provisional 100.0
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Coenzym 100.0
PRK06917447 hypothetical protein; Provisional 100.0
PRK07030467 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 100.0
TIGR03372442 putres_am_tran putrescine aminotransferase. Members of 100.0
PRK08593448 4-aminobutyrate aminotransferase; Provisional 100.0
PRK00854404 rocD ornithine--oxo-acid transaminase; Reviewed 100.0
TIGR03246397 arg_catab_astC succinylornithine transaminase family. M 100.0
PRK07894430 consensus 100.0
PRK09792421 PLP-dependent GABA aminotransferase; Provisional 100.0
PRK061481015 hypothetical protein; Provisional 100.0
PRK03244398 argD acetylornithine aminotransferase; Provisional 100.0
COG0160447 GabT 4-aminobutyrate aminotransferase and related amino 100.0
PRK06916462 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK08466430 consensus 100.0
PRK01278389 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
PRK07482461 hypothetical protein; Provisional 100.0
PRK07481448 hypothetical protein; Provisional 100.0
PRK06105460 aminotransferase; Provisional 100.0
PRK07678451 aminotransferase; Validated 100.0
PRK06058446 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06777421 4-aminobutyrate aminotransferase; Provisional 100.0
PRK07480459 putative aminotransferase; Validated 100.0
PRK09044418 consensus 100.0
PRK03715395 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
PRK08088426 4-aminobutyrate aminotransferase; Validated 100.0
PRK08117429 4-aminobutyrate aminotransferase; Provisional 100.0
PRK07483443 hypothetical protein; Provisional 100.0
PRK12381406 bifunctional succinylornithine transaminase/acetylornit 100.0
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK02936377 argD acetylornithine aminotransferase; Provisional 100.0
PRK12403460 putative aminotransferase; Provisional 100.0
PRK08360443 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06541460 hypothetical protein; Provisional 100.0
PRK07036466 hypothetical protein; Provisional 100.0
PRK06082460 4-aminobutyrate aminotransferase; Provisional 100.0
PRK07495422 4-aminobutyrate aminotransferase; Provisional 100.0
PRK09221445 beta alanine--pyruvate transaminase; Provisional 100.0
PRK13360441 omega amino acid--pyruvate transaminase; Provisional 100.0
PRK09264426 diaminobutyrate--2-oxoglutarate aminotransferase; Valid 100.0
PRK06918454 4-aminobutyrate aminotransferase; Reviewed 100.0
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisional 100.0
PRK07323443 consensus 100.0
PRK05630423 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK06943452 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK05639457 4-aminobutyrate aminotransferase; Provisional 100.0
PRK07046452 aminotransferase; Validated 100.0
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 100.0
PRK04612408 argD bifunctional N-succinyldiaminopimelate-aminotransf 100.0
PRK05769442 4-aminobutyrate aminotransferase; Provisional 100.0
PRK06062434 hypothetical protein; Provisional 100.0
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transaminase 100.0
PRK04260375 acetylornithine aminotransferase; Provisional 100.0
PRK08297449 L-lysine aminotransferase; Provisional 99.98
PRK06931454 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 99.97
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferase; Pr 99.97
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized members 99.97
PRK08555443 consensus 99.97
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.96
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.96
PRK00950369 histidinol-phosphate aminotransferase; Validated 99.96
KOG1402427 consensus 99.96
PRK05166374 histidinol-phosphate aminotransferase; Provisional 99.96
PRK03566365 consensus 99.95
KOG1401433 consensus 99.95
PRK06290411 aspartate aminotransferase; Provisional 99.95
PRK08175395 aminotransferase; Validated 99.95
PRK09148406 aminotransferase; Validated 99.95
PRK04152364 consensus 99.95
PRK07392358 threonine-phosphate decarboxylase; Validated 99.95
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.95
PRK09295406 selenocysteine lyase; Validated 99.95
PRK08636403 aspartate aminotransferase; Provisional 99.94
PRK05942394 aspartate aminotransferase; Provisional 99.94
PRK07212378 consensus 99.94
PRK07309390 aromatic amino acid aminotransferase; Validated 99.94
PRK09276385 aspartate aminotransferase; Provisional 99.94
PRK05957389 aspartate aminotransferase; Provisional 99.94
PRK08912387 hypothetical protein; Provisional 99.94
PRK08068389 transaminase; Reviewed 99.94
PRK07777386 aminotransferase; Validated 99.94
PRK05764389 aspartate aminotransferase; Provisional 99.94
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.94
PRK07681399 aspartate aminotransferase; Provisional 99.94
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.94
PRK07683387 aminotransferase A; Validated 99.94
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subunit Cs 99.94
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.94
PRK09082386 putative aminotransferase; Validated 99.94
PRK06375381 consensus 99.93
PRK12414384 putative aminotransferase; Provisional 99.93
PRK06108382 aspartate aminotransferase; Provisional 99.93
PRK06056402 consensus 99.93
PRK05794397 consensus 99.93
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. This c 99.93
PRK07778386 consensus 99.93
PRK07568396 aspartate aminotransferase; Provisional 99.93
PRK08443388 consensus 99.93
PRK08363398 alanine aminotransferase; Validated 99.93
PRK06107402 aspartate aminotransferase; Provisional 99.93
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.93
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.93
PRK08960387 hypothetical protein; Provisional 99.93
PRK07367385 consensus 99.93
PRK06507400 consensus 99.93
PRK08362389 consensus 99.92
PRK07682378 hypothetical protein; Validated 99.92
PRK08069390 consensus 99.92
KOG1404442 consensus 99.92
PRK07550387 hypothetical protein; Provisional 99.92
PRK07337388 aminotransferase; Validated 99.92
PRK07543400 consensus 99.92
TIGR01979409 sufS cysteine desulfurases, SufS subfamily; InterPro: I 99.92
TIGR03538394 DapC_gpp succinyldiaminopimelate transaminase. This fam 99.92
PRK07310395 consensus 99.92
PRK09265404 aminotransferase AlaT; Validated 99.91
PRK03262355 consensus 99.91
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.91
PRK06575399 consensus 99.91
PRK06220384 consensus 99.9
PRK06836396 aspartate aminotransferase; Provisional 99.9
PRK09147397 aminotransferase; Provisional 99.9
PRK01688355 histidinol-phosphate aminotransferase; Provisional 99.9
PRK07865364 N-succinyldiaminopimelate aminotransferase; Reviewed 99.89
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. This 99.89
TIGR02407413 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotrans 99.88
TIGR00700427 GABAtrnsam 4-aminobutyrate transaminase; InterPro: IPR0 99.88
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. This c 99.88
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.87
PRK05839376 hypothetical protein; Provisional 99.87
PRK04635346 histidinol-phosphate aminotransferase; Provisional 99.87
PRK06959339 putative threonine-phosphate decarboxylase; Provisional 99.87
PRK06855433 aminotransferase; Validated 99.83
PRK13355518 bifunctional HTH-domain containing protein/aminotransfe 99.83
KOG1403452 consensus 99.78
TIGR00709445 dat 2,4-diaminobutyrate 4-transaminase; InterPro: IPR00 99.71
KOG1549428 consensus 99.67
TIGR00699469 GABAtrns_euk 4-aminobutyrate aminotransferase; InterPro 99.66
TIGR01265424 tyr_nico_aTase tyrosine/nicotianamine aminotransferases 99.64
TIGR01976410 am_tr_V_VC1184 cysteine desulfurase family protein; Int 99.64
KOG1405484 consensus 99.6
TIGR01264415 tyr_amTase_E tyrosine aminotransferase; InterPro: IPR00 99.56
TIGR01140349 CobD L-threonine-O-3-phosphate decarboxylase, putative; 99.54
PRK04311465 selenocysteine synthase; Provisional 99.52
KOG0259447 consensus 99.42
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal-bindi 98.9
KOG3846465 consensus 98.55
TIGR00508466 bioA adenosylmethionine-8-amino-7-oxononanoate transami 98.26
TIGR01814444 kynureninase kynureninase; InterPro: IPR010111 This ent 97.82
cd06454349 KBL_like KBL_like; this family belongs to the pyridoxal 100.0
pfam00155351 Aminotran_1_2 Aminotransferase class I and II. 100.0
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family belongs 100.0
cd06502338 TA_like Low-specificity threonine aldolase (TA). This f 100.0
PRK10534333 L-threonine aldolase; Provisional 99.97
PRK08153370 histidinol-phosphate aminotransferase; Provisional 99.96
PRK09331386 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.95
PRK03321352 putative aminotransferase; Provisional 99.94
PRK06225375 aspartate aminotransferase; Provisional 99.94
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This family 99.93
PRK02948381 cysteine desulfurase; Provisional 99.93
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.93
PRK02610369 histidinol-phosphate aminotransferase; Provisional 99.93
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.93
PRK06348383 aspartate aminotransferase; Provisional 99.93
PRK03317369 histidinol-phosphate aminotransferase; Provisional 99.93
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferase and 99.93
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amino aci 99.92
TIGR01141377 hisC histidinol-phosphate aminotransferase; InterPro: I 99.92
PRK09105374 putative aminotransferase; Provisional 99.92
PRK08361390 aspartate aminotransferase; Provisional 99.92
pfam00266371 Aminotran_5 Aminotransferase class-V. This domain is fo 99.91
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amino aci 99.91
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: the de 99.91
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) fa 99.91
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of this pro 99.91
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, epsilon 99.91
COG2008342 GLY1 Threonine aldolase [Amino acid transport and metab 99.91
PRK13034422 serine hydroxymethyltransferase; Reviewed 99.91
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Posttra 99.91
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT). Th 99.91
TIGR01977384 am_tr_V_EF2568 cysteine desulfurase family protein; Int 99.9
PRK00011415 glyA serine hydroxymethyltransferase; Reviewed 99.9
PRK07324373 transaminase; Validated 99.9
KOG1368384 consensus 99.9
PRK07908346 hypothetical protein; Provisional 99.9
cd00609350 AAT_like Aspartate aminotransferase family. This family 99.9
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.9
PRK06207406 aspartate aminotransferase; Provisional 99.89
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.89
PTZ00094450 serine hydroxymethyltransferase; Provisional 99.89
pfam00464380 SHMT Serine hydroxymethyltransferase. 99.89
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Provisi 99.88
PRK13580493 serine hydroxymethyltransferase; Provisional 99.88
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional 99.87
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotran 99.87
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzyme app 99.86
TIGR02539381 SepCysS Sep-tRNA:Cys-tRNA synthase; InterPro: IPR013375 99.86
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotran 99.86
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desulfuras 99.86
COG1103382 Archaea-specific pyridoxal phosphate-dependent enzymes 99.86
pfam01041363 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase f 99.85
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartate ami 99.85
KOG0257420 consensus 99.83
PRK08354312 putative aminotransferase; Provisional 99.83
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase. Thi 99.83
PRK13520375 L-tyrosine decarboxylase; Provisional 99.82
COG1167459 ARO8 Transcriptional regulators containing a DNA-bindin 99.81
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.79
PRK08637386 hypothetical protein; Provisional 99.77
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 famil 99.71
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-cystat 99.66
PRK00451449 glycine dehydrogenase subunit 1; Validated 99.61
TIGR01325386 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase; Inter 99.61
PRK04366490 glycine dehydrogenase subunit 2; Validated 99.59
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid tran 99.57
KOG0256471 consensus 99.5
KOG2862385 consensus 99.49
KOG2467477 consensus 99.47
PRK09257397 aromatic amino acid aminotransferase; Provisional 99.29
TIGR00474448 selA L-seryl-tRNA selenium transferase; InterPro: IPR00 99.18
COG3033471 TnaA Tryptophanase [Amino acid transport and metabolism 99.13
TIGR02617468 tnaA_trp_ase tryptophanase; InterPro: IPR013440 Protein 99.06
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.02
pfam02347429 GDC-P Glycine cleavage system P-protein. This family co 98.9
PRK12462364 phosphoserine aminotransferase; Provisional 98.7
PRK05367 955 glycine dehydrogenase; Provisional 98.65
PRK05355360 phosphoserine aminotransferase; Provisional 98.64
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) family. 98.63
TIGR01437391 selA_rel pyridoxal phosphate-dependent enzyme, putative 98.61
KOG1383491 consensus 98.57
TIGR02006404 IscS cysteine desulfurase IscS; InterPro: IPR010240 Thi 98.54
PRK12566 954 glycine dehydrogenase; Provisional 98.5
KOG0258475 consensus 98.42
) it is a pyridoxal 5'-phosphate (PLP)-dependent enzyme, which catalyses the irreversible alpha-decarboxylation of L-glutamate to gamma-aminobutyrate (GABA). This enzyme is widely distributed amongst eukaryotes and prokaryotes, but its function varies in different organisms . Gad has a crucial role in the vertebrate central nervous system where it is responsible for the synthesis of GABA, the major inhibitory neurotransmitter. In the majority of vertebrates Gad occurs in two isoforms, GAD65 and GAD67, both active at neutral pH . Gad isoforms (GadA and GadB) have also been reported in some bacterial species, including the Gram-negative bacterium and Gram-positive bacterium . A unique feature of plant and yeast Gad is the presence of a calmodulin (CaM)-binding domain in the C-terminal region. In Saccharomyces cerevisiae, Gad expression is required for normal oxidative stress tolerance . In plants, Gad is thought to be a stress-adapter chaperonin sensing Ca2+ signals.; GO: 0004351 glutamate decarboxylase activity, 0030170 pyridoxal phosphate binding, 0006536 glutamate metabolic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01788">TIGR01788493 Glu-decarb-GAD glutamate decarboxylase; InterPro: IPR01 98.04
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme metabolis 98.02
KOG1412410 consensus 97.57
pfam00202338 Aminotran_3 Aminotransferase class-III. 99.93
pfam01212288 Beta_elim_lyase Beta-eliminating lyase. 99.85
pfam03841367 SelA L-seryl-tRNA selenium transferase. 99.41
pfam00282370 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserv 99.32
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer selenium tr 99.29
PRK04781362 histidinol-phosphate aminotransferase; Provisional 99.89
PRK08249398 cystathionine gamma-synthase; Provisional 99.86
PRK06234399 methionine gamma-lyase; Provisional 99.85
PRK09028394 cystathionine beta-lyase; Provisional 99.85
PRK07503403 methionine gamma-lyase; Provisional 99.84
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family 99.84
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is a PL 99.84
PRK05968389 hypothetical protein; Provisional 99.84
pfam01053381 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 99.83
PRK08045386 cystathionine gamma-synthase; Provisional 99.83
PRK07504397 O-succinylhomoserine sulfhydrylase; Reviewed 99.82
PRK06176379 cystathionine gamma-synthase/cystathionine beta-lyase; 99.82
PRK08247366 cystathionine gamma-synthase; Reviewed 99.82
PRK06460375 hypothetical protein; Provisional 99.82
PRK06767386 methionine gamma-lyase; Provisional 99.81
PRK05967392 cystathionine beta-lyase; Provisional 99.81
PRK07050394 cystathionine beta-lyase; Provisional 99.81
PRK08114395 cystathionine beta-lyase; Provisional 99.81
PRK08861388 cystathionine gamma-synthase; Provisional 99.81
PRK07810406 O-succinylhomoserine sulfhydrylase; Provisional 99.81
PRK07811386 cystathionine gamma-synthase; Provisional 99.81
PRK08133391 O-succinylhomoserine sulfhydrylase; Validated 99.8
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.8
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.8
PRK08064390 cystathionine beta-lyase; Provisional 99.8
PRK08776405 cystathionine gamma-synthase; Provisional 99.79
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.79
PRK07671377 cystathionine beta-lyase; Provisional 99.79
PRK08574384 cystathionine gamma-synthase; Provisional 99.78
PRK07582370 cystathionine gamma-lyase; Validated 99.78
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.78
PRK06084424 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.78
PRK05939396 hypothetical protein; Provisional 99.77
PRK05994426 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.76
PRK07049427 methionine gamma-lyase; Validated 99.76
PRK07269364 cystathionine gamma-synthase; Reviewed 99.76
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.75
PRK13578 720 ornithine decarboxylase; Provisional 99.75
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma-synt 99.75
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Amino ac 99.74
PRK02769380 histidine decarboxylase; Provisional 99.72
PRK06434384 cystathionine gamma-lyase; Validated 99.7
cd06450345 DOPA_deC_like DOPA decarboxylase family. This family be 99.67
KOG0053409 consensus 99.61
cd00617431 Tnase_like Tryptophanase family (Tnase). This family be 99.6
TIGR02326366 transamin_PhnW 2-aminoethylphosphonate--pyruvate transa 99.59
TIGR01328392 met_gam_lyase methionine gamma-lyase; InterPro: IPR0062 99.57
PRK13237459 tyrosine phenol-lyase; Provisional 99.53
PRK05367955 glycine dehydrogenase; Provisional 99.5
PRK13238461 tnaA tryptophanase; Provisional 99.45
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- and bet 99.43
PRK12566954 glycine dehydrogenase; Provisional 99.42
KOG0634472 consensus 99.37
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal-bindi 99.36
TIGR02080383 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase; Inte 99.29
KOG0633375 consensus 99.27
KOG20401001 consensus 99.17
TIGR01329415 cysta_beta_ly_E cystathionine beta-lyase; InterPro: IPR 99.15
TIGR01324389 cysta_beta_ly_B cystathionine beta-lyase; InterPro: IPR 99.12
TIGR00461965 gcvP glycine dehydrogenase; InterPro: IPR003437 This fa 99.02
pfam05889389 SLA_LP_auto_ag Soluble liver antigen/liver pancreas ant 98.98
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase; Int 98.87
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transfe 98.82
KOG0629510 consensus 98.78
KOG0628511 consensus 98.57
PRK03080381 phosphoserine aminotransferase; Provisional 98.47
pfam04864363 Alliinase_C Allinase. Allicin is a thiosulphinate that 97.36
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase; InterPro: IPR01344 97.33
KOG2040 1001 consensus 97.06
KOG3843432 consensus 96.4
cd00615294 Orn_deC_like Ornithine decarboxylase family. This famil 99.89
pfam01276417 OKR_DC_1 Orn/Lys/Arg decarboxylase, major domain. 99.88
TIGR01326434 OAH_OAS_sulfhy O-acetylhomoserine aminocarboxypropyltra 99.71
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily (fol 99.88
TIGR03235354 DNA_S_dndA cysteine desulfurase DndA. This model descri 99.74
COG0076460 GadB Glutamate decarboxylase and related PLP-dependent 99.44
pfam06838405 Alum_res Aluminium resistance protein. This family repr 99.37
COG4100416 Cystathionine beta-lyase family protein involved in alu 98.95
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) amin 99.28
PRK09275531 aspartate aminotransferase; Provisional 98.27
KOG1411427 consensus 91.92
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amin 98.93
>TIGR00858 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR004723 8-amino-7-oxononanoate synthase (2 Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase; InterPro: IPR010961 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative; InterPro: IPR010962 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase; InterPro: IPR011282 This entry represents a narrowly defined clade of animal and bacterial (almost exclusively proteobacterial) 2-amino-3-ketobutyrate--CoA ligase Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>KOG1359 consensus Back     alignment and domain information
>KOG1360 consensus Back     alignment and domain information
>KOG1357 consensus Back     alignment and domain information
>KOG1358 consensus Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases; InterPro: IPR004636 This family of proteins, for which ornithine aminotransferases form an outgroup, consists mostly of proteins designated acetylornithine aminotransferase Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase; InterPro: IPR004639 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine--oxo-acid transaminase; InterPro: IPR010164 Ornithine aminotransferase catalyses the conversion of L-ornithine and a 2-oxo acid to L-glutamate 5-semialdehyde and an L-amino acid Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK06942 glutamate-1-semialdehyde 2,1-aminomutase; Validated Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK07894 consensus Back     alignment and domain information
>PRK09792 PLP-dependent GABA aminotransferase; Provisional Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK08466 consensus Back     alignment and domain information
>PRK01278 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information