254780605

254780605

putative aminopeptidase

GeneID in NCBI database:8209604Locus tag:CLIBASIA_02460
Protein GI in NCBI database:254780605Protein Accession:YP_003065018.1
Gene range:+(673130, 674959)Protein Length:609aa
Gene description:putative aminopeptidase
COG prediction:[E] Xaa-Pro aminopeptidase
KEGG prediction:putative aminopeptidase; K01262 Xaa-Pro aminopeptidase [EC:3.4.11.9]
SEED prediction:Xaa-Pro aminopeptidase (EC 3.4.11.9)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Aminopeptidases (EC 3.4.11.-)
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61
MFQSFEMKSSPSKTFERVHNLRSCFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILIDPKWISYRFFKVIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLLDSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARIFLWKYGADFAHGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPETINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLAPLIEDQEVLSWLFSVTAPI
ccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccEEEEEccccccEEEEEEccccEEEEccHHHHHHHHHcccccEEEEccccccHHHHHHHHcccccEEEEEHHHHcHHHHHHHHHHHHHcccEEEcccccHHHHHHHccccccccccEEcccccccHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHcccccccccccEEEEEEEEEccccEEEEEccccccHHHHHHcccccEEEcHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHccccEEccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccEEEEcccccEEcccccccccccEEccccEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccEEccccccEEccccEEEEcccEEEcccEEEEEEEEEEEccccccccccccccccEEcccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccc
cccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccccccccHHHHHHHccccccccEEEEEccccEEEccccHHHHHHHHcccccHHHcccccccHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHcccEEEEcccccHHHHHHccccccccccEcccHHHccccHHHHHHHHHHHHHHccccEEEEccHHHHHHHEHccccccccccEEEEEEEEcccccEEEEEccccccHHHHHHHHcccEEccHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHcccEEEccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcHHHHHHHHHHHHcccccccccccccHHHHccccccEEEEEccccccccccccccEEEEEccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccccccccEEEccccccEEEccccccccccEEEEcccccccccccEEEEEEEEEEEEccccccccccccEEEEEEEcccccccccHHHccHHHHHHHHHHHHHHHHHHcHHcccHHHHHHHHHHcccc
mfqsfemksspsktferVHNLRSCFdslgmdaflvprvdeyrgefvdkGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRlgldsrlhsSFEVDLLQKSLDKiegvivdvpynpidslwkdrpQRLYRKVAMQDMAYAGRESQEKIRDICKILHqkevgavficdpssiAWIFNirgfdipcspyplsrAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLartsmpilidpkwiSYRFFKVIAqkngvmvegsdpscllratKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERCREEIgckmrnplrdiafntiaasgphAAIIHYQATVQSNRLLQKDELLlldsgaqyvngttditrtiaigdvdyEKKYYFTLVLKGMISvstarfpqrtrgcdldSIARIFLWKYGadfahgvghgvgsflpvhegpqgisrtnqepllpgmilsnepgyyrcgafgirienvlcvsepetinngeclmlgfntltlcpidrKLILVELLTNEEKKWCNDYHRrvytslapliedqEVLSWLFSVTAPI
mfqsfemksspsktfERVHNLRSCFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVpynpidslwkdrpQRLYRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILIDPKWISYRFFKVIAQKNgvmvegsdpscLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLLDSgaqyvngttditrtiaigdvdYEKKYYFTLVLKGMISvstarfpqrtrgcDLDSIARIFLWKYGADFAHGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPETINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLapliedqevlSWLFSVTAPI
MFQSFEMKSSPSKTFERVHNLRSCFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILIDPKWISYRFFKVIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRllqkdellllDSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARIFLWKYGADFAHGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPETINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLAPLIEDQEVLSWLFSVTAPI
MFQS*************VHNLRSCFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILIDPKWISYRFFKVIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLLDSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARIFLWKYGADFAHGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPETINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLAPLIEDQEVLSWLFSVTAPI
***************ERVHNLRSCFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILIDPKWISYRFFKVIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLLDSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARIFLWKYGADFAHGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPETINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLAPLIEDQEVLSWLFSVTAPI
****FEMKSSPSKTFERVHNLRSCFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILIDPKWISYRFFKVIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLLDSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARIFLWKYGADFAHGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPETINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLAPLIEDQEVLSWLFSVTAPI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQSFEMKSSPSKTFERVHNLRSCFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILIDPKWISYRFFKVIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLLDSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARIFLWKYGADFAHGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPETINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLAPLIEDQEVLSWLFSVTAPI
MFQSFEMKSSPSKTFERVHNLRSCFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILIDPKWISYRFFKVIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLLDSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARIFLWKYGADFAHGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPETINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLAPLIEDQEVLSWLFSVTAPI
MFQSFEMKSSPSKTFERVHNLRSCFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILIDPKWISYRFFKVIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLLDSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARIFLWKYGADFAHGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPETINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLAPLIEDQEVLSWLFSVTAPI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target609 putative aminopeptidase [Candidatus Liberibacter asiati
315121806609 putative aminopeptidase [Candidatus Liberibacter solana 1 0.0
241205535628 Xaa-Pro aminopeptidase [Rhizobium leguminosarum bv. tri 1 0.0
116253027611 aminopeptidase [Rhizobium leguminosarum bv. viciae 3841 1 0.0
209550152611 peptidase M24 [Rhizobium leguminosarum bv. trifolii WSM 1 0.0
222086424611 aminopeptidase P protein [Agrobacterium radiobacter K84 1 0.0
327194601611 putative aminopeptidase P protein [Rhizobium etli CNPAF 1 0.0
86358430628 aminopeptidase P protein [Rhizobium etli CFN 42] Length 1 0.0
190892562628 aminopeptidase P protein [Rhizobium etli CIAT 652] Leng 1 0.0
218463246628 probable aminopeptidase P protein [Rhizobium etli Kim 5 1 0.0
222149108615 aminopeptidase P [Agrobacterium vitis S4] Length = 615 1 0.0
>gi|315121806|ref|YP_004062295.1| putative aminopeptidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 609 Back     alignment and organism information
 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/609 (76%), Positives = 528/609 (86%)

Query: 1   MFQSFEMKSSPSKTFERVHNLRSCFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFT 60
           MFQSFE++SS  K+FER+ NLRSCFD LG+DAFL+PR DEYRGEFV  GSERLAW+SGFT
Sbjct: 1   MFQSFEVQSSSQKSFERIKNLRSCFDQLGIDAFLIPRADEYRGEFVSSGSERLAWISGFT 60

Query: 61  GSAGIAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIEPLHAWISEHGFVGLRLGL 120
           GSAGIA+VLRQ++ IFVDGRY  QVE+EVDT LFTIKNI IEPLH WI ++    LRLGL
Sbjct: 61  GSAGIAVVLRQEAFIFVDGRYVFQVEQEVDTTLFTIKNIIIEPLHVWILDNALSDLRLGL 120

Query: 121 DSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQ 180
           DSRLHS  EV LLQKSLDK  G+IVD+PYNP+D LW+DRP  L+ K+A+QD+AYAG+ SQ
Sbjct: 121 DSRLHSISEVALLQKSLDKTGGIIVDLPYNPLDRLWEDRPHPLHHKIAIQDIAYAGKSSQ 180

Query: 181 EKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFD 240
           EKIRDICK L++K+V AV ICDPSS+AWIFNIRGFDI C+PYPLSRAILYA+GKA+IF D
Sbjct: 181 EKIRDICKNLNEKQVAAVLICDPSSVAWIFNIRGFDISCAPYPLSRAILYANGKADIFID 240

Query: 241 KQYINEQLKALLSAVAIVLDMDMMDSRLVCLARTSMPILIDPKWISYRFFKVIAQKNGVM 300
           KQYINE+L+  LSAVA+ LDMDM+D +L+ LART+ PILIDP WI YRFFKVI+Q+NGV+
Sbjct: 241 KQYINEELRVFLSAVAVPLDMDMIDLQLITLARTNRPILIDPTWIPYRFFKVISQENGVV 300

Query: 301 VEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEIDIIKKLERC 360
           VEG DPSCLLRA KNKVEIEGM+ AHIQDGVAMV FL W  S++L TITEID++KKLE  
Sbjct: 301 VEGPDPSCLLRAVKNKVEIEGMRLAHIQDGVAMVCFLSWLDSRNLGTITEIDVVKKLENY 360

Query: 361 REEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLLDSGAQYVNGT 420
           REEIG KM NPL DIAFNTIAASGP+AAIIHY+ T QSNR+LQ +EL LLDSGAQYVNGT
Sbjct: 361 REEIGRKMHNPLLDIAFNTIAASGPNAAIIHYRVTTQSNRILQGNELFLLDSGAQYVNGT 420

Query: 421 TDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARIFLWKYGADFA 480
           TDITRTIAIG VD+EKKYYFTLVLKGMI++S   FP +TRGCDLDSIAR+FLWK G DFA
Sbjct: 421 TDITRTIAIGHVDHEKKYYFTLVLKGMIALSNVIFPPKTRGCDLDSIARLFLWKAGVDFA 480

Query: 481 HGVGHGVGSFLPVHEGPQGISRTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPE 540
           HGVGHG+GSFLPVHEGPQGISR NQ+PLL GMILSNEPGYY+   FGIRIENVLCV++P 
Sbjct: 481 HGVGHGIGSFLPVHEGPQGISRMNQQPLLSGMILSNEPGYYKYNDFGIRIENVLCVTDPI 540

Query: 541 TINNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLAPLIEDQEVLS 600
            I+ GECLMLGFNTLTLCPIDR+LILVELLTNEEKKW NDYH RVY +L PLI+D +VLS
Sbjct: 541 KIDGGECLMLGFNTLTLCPIDRRLILVELLTNEEKKWLNDYHSRVYKTLMPLIDDPKVLS 600

Query: 601 WLFSVTAPI 609
           WL S T PI
Sbjct: 601 WLLSATLPI 609


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241205535|ref|YP_002976631.1| Xaa-Pro aminopeptidase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 628 Back     alignment and organism information
>gi|116253027|ref|YP_768865.1| aminopeptidase [Rhizobium leguminosarum bv. viciae 3841] Length = 611 Back     alignment and organism information
>gi|209550152|ref|YP_002282069.1| peptidase M24 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 611 Back     alignment and organism information
>gi|222086424|ref|YP_002544958.1| aminopeptidase P protein [Agrobacterium radiobacter K84] Length = 611 Back     alignment and organism information
>gi|327194601|gb|EGE61451.1| putative aminopeptidase P protein [Rhizobium etli CNPAF512] Length = 611 Back     alignment and organism information
>gi|86358430|ref|YP_470322.1| aminopeptidase P protein [Rhizobium etli CFN 42] Length = 628 Back     alignment and organism information
>gi|190892562|ref|YP_001979104.1| aminopeptidase P protein [Rhizobium etli CIAT 652] Length = 628 Back     alignment and organism information
>gi|218463246|ref|ZP_03503337.1| probable aminopeptidase P protein [Rhizobium etli Kim 5] Length = 628 Back     alignment and organism information
>gi|222149108|ref|YP_002550065.1| aminopeptidase P [Agrobacterium vitis S4] Length = 615 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target609 putative aminopeptidase [Candidatus Liberibacter asiati
cd01085224 cd01085, APP, X-Prolyl Aminopeptidase 2 6e-81
pfam00557207 pfam00557, Peptidase_M24, Metallopeptidase family M24 6e-40
cd01092208 cd01092, APP-like, Similar to Prolidase and Aminopeptid 7e-33
cd01066207 cd01066, APP_MetAP, A family including aminopeptidase P 7e-20
COG0024255 COG0024, Map, Methionine aminopeptidase [Translation, r 5e-05
COG0006384 COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid trans 9e-54
PRK09795361 PRK09795, PRK09795, aminopeptidase; Provisional 5e-17
cd01087243 cd01087, Prolidase, Prolidase 2e-15
KOG2737492 KOG2737, KOG2737, KOG2737, Putative metallopeptidase [G 9e-12
KOG2414488 KOG2414, KOG2414, KOG2414, Putative Xaa-Pro aminopeptid 5e-10
PRK10879438 PRK10879, PRK10879, proline aminopeptidase P II; Provis 5e-10
PRK13607443 PRK13607, PRK13607, proline dipeptidase; Provisional 1e-04
PRK14576405 PRK14576, PRK14576, putative endopeptidase; Provisional 3e-04
pfam01321127 pfam01321, Creatinase_N, Creatinase/Prolidase N-termina 6e-12
KOG2413606 KOG2413, KOG2413, KOG2413, Xaa-Pro aminopeptidase [Amin 1e-129
>gnl|CDD|29970 cd01085, APP, X-Prolyl Aminopeptidase 2 Back     alignment and domain information
>gnl|CDD|144226 pfam00557, Peptidase_M24, Metallopeptidase family M24 Back     alignment and domain information
>gnl|CDD|29977 cd01092, APP-like, Similar to Prolidase and Aminopeptidase P Back     alignment and domain information
>gnl|CDD|29969 cd01066, APP_MetAP, A family including aminopeptidase P, aminopeptidase M, and prolidase Back     alignment and domain information
>gnl|CDD|30374 COG0024, Map, Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30356 COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182080 PRK09795, PRK09795, aminopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|29972 cd01087, Prolidase, Prolidase Back     alignment and domain information
>gnl|CDD|37948 KOG2737, KOG2737, KOG2737, Putative metallopeptidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|37625 KOG2414, KOG2414, KOG2414, Putative Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182804 PRK10879, PRK10879, proline aminopeptidase P II; Provisional Back     alignment and domain information
>gnl|CDD|184178 PRK13607, PRK13607, proline dipeptidase; Provisional Back     alignment and domain information
>gnl|CDD|173040 PRK14576, PRK14576, putative endopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|144790 pfam01321, Creatinase_N, Creatinase/Prolidase N-terminal domain Back     alignment and domain information
>gnl|CDD|37624 KOG2413, KOG2413, KOG2413, Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 609 putative aminopeptidase [Candidatus Liberibacter asiati
KOG2413606 consensus 100.0
cd01085224 APP X-Prolyl Aminopeptidase 2. E.C. 3.4.11.9. Also know 100.0
PRK13607442 proline dipeptidase; Provisional 100.0
PRK12897248 methionine aminopeptidase; Reviewed 100.0
PRK05716252 methionine aminopeptidase; Validated 100.0
PRK12318291 methionine aminopeptidase; Provisional 100.0
PRK12896254 methionine aminopeptidase; Reviewed 100.0
cd01090228 Creatinase Creatine amidinohydrolase. E.C.3.5.3.3. Hydr 100.0
cd01092208 APP-like Similar to Prolidase and Aminopeptidase P. The 100.0
cd01086238 MetAP1 Methionine Aminopeptidase 1. E.C. 3.4.11.18. Als 100.0
cd01087243 Prolidase Prolidase. E.C. 3.4.13.9. Also known as Xaa-P 100.0
pfam00557207 Peptidase_M24 Metallopeptidase family M24. This family 100.0
cd01091243 CDC68-like Related to aminopeptidase P and aminopeptida 100.0
PRK07281286 methionine aminopeptidase; Reviewed 100.0
cd01066207 APP_MetAP A family including aminopeptidase P, aminopep 100.0
cd01089228 PA2G4-like Related to aminopepdidase M, this family con 99.9
TIGR00500265 met_pdase_I methionine aminopeptidase, type I; InterPro 99.89
COG0024255 Map Methionine aminopeptidase [Translation, ribosomal s 99.86
PRK08671293 methionine aminopeptidase; Provisional 99.78
cd01088291 MetAP2 Methionine Aminopeptidase 2. E.C. 3.4.11.18. Als 99.76
KOG2738369 consensus 99.5
PTZ00053435 methionine aminopeptidase II; Provisional 99.37
COG5406 1001 Nucleosome binding factor SPN, SPT16 subunit [Transcrip 99.31
TIGR00501327 met_pdase_II methionine aminopeptidase, type II; InterP 99.2
KOG2775397 consensus 97.92
COG0006384 PepP Xaa-Pro aminopeptidase [Amino acid transport and m 100.0
PRK09795361 aminopeptidase; Provisional 100.0
PRK10879436 proline aminopeptidase P II; Provisional 100.0
KOG2737492 consensus 100.0
KOG2414488 consensus 100.0
TIGR02993391 ectoine_eutD ectoine utilization protein EutD; InterPro 99.87
KOG1189 960 consensus 99.77
PRK09795361 aminopeptidase; Provisional 99.59
pfam01321127 Creatinase_N Creatinase/Prolidase N-terminal domain. Th 99.54
COG0006384 PepP Xaa-Pro aminopeptidase [Amino acid transport and m 98.21
pfam01321127 Creatinase_N Creatinase/Prolidase N-terminal domain. Th 98.95
KOG2413 606 consensus 96.63
KOG2776398 consensus 97.35
TIGR00495407 crvDNA_42K DNA-binding protein, 42 kDa; InterPro: IPR00 95.42
PRK12318291 methionine aminopeptidase; Provisional 96.66
TIGR00500265 met_pdase_I methionine aminopeptidase, type I; InterPro 94.3
COG0024255 Map Methionine aminopeptidase [Translation, ribosomal s 93.73
cd01089228 PA2G4-like Related to aminopepdidase M, this family con 95.99
PRK07281286 methionine aminopeptidase; Reviewed 94.45
PRK12897248 methionine aminopeptidase; Reviewed 92.62
>KOG2413 consensus Back     alignment and domain information
>cd01085 APP X-Prolyl Aminopeptidase 2 Back     alignment and domain information
>PRK13607 proline dipeptidase; Provisional Back     alignment and domain information
>PRK12897 methionine aminopeptidase; Reviewed Back     alignment and domain information
>PRK05716 methionine aminopeptidase; Validated Back     alignment and domain information
>PRK12318 methionine aminopeptidase; Provisional Back     alignment and domain information
>PRK12896 methionine aminopeptidase; Reviewed Back     alignment and domain information
>cd01090 Creatinase Creatine amidinohydrolase Back     alignment and domain information
>cd01092 APP-like Similar to Prolidase and Aminopeptidase P Back     alignment and domain information
>cd01086 MetAP1 Methionine Aminopeptidase 1 Back     alignment and domain information
>cd01087 Prolidase Prolidase Back     alignment and domain information
>pfam00557 Peptidase_M24 Metallopeptidase family M24 Back     alignment and domain information
>cd01091 CDC68-like Related to aminopeptidase P and aminopeptidase M, a member of this domain family is present in cell division control protein 68, a transcription factor Back     alignment and domain information
>PRK07281 methionine aminopeptidase; Reviewed Back     alignment and domain information
>cd01066 APP_MetAP A family including aminopeptidase P, aminopeptidase M, and prolidase Back     alignment and domain information
>cd01089 PA2G4-like Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 Back     alignment and domain information
>TIGR00500 met_pdase_I methionine aminopeptidase, type I; InterPro: IPR002467 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>COG0024 Map Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08671 methionine aminopeptidase; Provisional Back     alignment and domain information
>cd01088 MetAP2 Methionine Aminopeptidase 2 Back     alignment and domain information
>KOG2738 consensus Back     alignment and domain information
>PTZ00053 methionine aminopeptidase II; Provisional Back     alignment and domain information
>COG5406 Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>TIGR00501 met_pdase_II methionine aminopeptidase, type II; InterPro: IPR002468 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>KOG2775 consensus Back     alignment and domain information
>COG0006 PepP Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09795 aminopeptidase; Provisional Back     alignment and domain information
>PRK10879 proline aminopeptidase P II; Provisional Back     alignment and domain information
>KOG2737 consensus Back     alignment and domain information
>KOG2414 consensus Back     alignment and domain information
>TIGR02993 ectoine_eutD ectoine utilization protein EutD; InterPro: IPR014335 Members of this entry are putative peptidases, or non-peptidase homologues that belong to the MEROPS peptidase family M24 (clan MG) or hydrolases similar to Xaa-Pro aminopeptidase Back     alignment and domain information
>KOG1189 consensus Back     alignment and domain information
>PRK09795 aminopeptidase; Provisional Back     alignment and domain information
>pfam01321 Creatinase_N Creatinase/Prolidase N-terminal domain Back     alignment and domain information
>COG0006 PepP Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam01321 Creatinase_N Creatinase/Prolidase N-terminal domain Back     alignment and domain information
>KOG2413 consensus Back     alignment and domain information
>KOG2776 consensus Back     alignment and domain information
>TIGR00495 crvDNA_42K DNA-binding protein, 42 kDa; InterPro: IPR004545 Proteins of this family have been identified in a number of species as a nuclear (but not nucleolar) protein with a cell cycle dependence Back     alignment and domain information
>PRK12318 methionine aminopeptidase; Provisional Back     alignment and domain information
>TIGR00500 met_pdase_I methionine aminopeptidase, type I; InterPro: IPR002467 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>COG0024 Map Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01089 PA2G4-like Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 Back     alignment and domain information
>PRK07281 methionine aminopeptidase; Reviewed Back     alignment and domain information
>PRK12897 methionine aminopeptidase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target609 putative aminopeptidase [Candidatus Liberibacter asiati
3ctz_A623 Structure Of Human Cytosolic X-Prolyl Aminopeptidas 1e-153
1pv9_A348 Prolidase From Pyrococcus Furiosus Length = 348 2e-36
3q6d_A356 Xaa-Pro Dipeptidase From Bacillus Anthracis. Length 6e-36
2zsg_A359 Crystal Structure Of X-Pro Aminopeptidase From Ther 7e-35
1wy2_A351 Crystal Structure Of The Prolidase From Pyrococcus 3e-33
1chm_B401 Enzymatic Mechanism Of Creatine Amidinohydrolase As 4e-16
1chm_A401 Enzymatic Mechanism Of Creatine Amidinohydrolase As 5e-16
1kp0_A402 The Crystal Structure Analysis Of Creatine Amidinoh 5e-12
3l24_A517 Crystal Structure Of The Nerve Agent Degrading Orga 3e-09
3q6d_A356 Xaa-Pro Dipeptidase From Bacillus Anthracis. Length 9e-14
2zsg_A359 Crystal Structure Of X-Pro Aminopeptidase From Ther 5e-11
3qoc_A135 Crystal Structure Of N-Terminal Domain (CreatinaseP 6e-09
3ovk_A132 Crystal Structure Of An Xxa-Pro Aminopeptidase From 4e-07
3il0_A131 The Crystal Structure Of The Aminopeptidase P,Xaa-P 3e-06
1wn1_A356 Crystal Structure Of Dipeptiase From Pyrococcus Hor 5e-35
2iw2_A494 Crystal Structure Of Human Prolidase Length = 494 6e-19
1wl9_A440 Structure Of Aminopeptidase P From E. Coli Length = 2e-25
1m35_A440 Aminopeptidase P From Escherichia Coli Length = 440 2e-25
1jaw_A440 Aminopeptidase P From E. Coli Low Ph Form Length = 2e-25
2bws_A440 His243ala Escherichia Coli Aminopeptidase P Length 6e-25
2bwt_A440 Asp260ala Escherichia Coli Aminopeptidase P Length 2e-24
2bwu_A440 Asp271ala Escherichia Coli Aminopeptidase P Length 3e-24
2bwx_A441 His354ala Escherichia Coli Aminopeptidase P Length 1e-23
2bww_A440 His350ala Escherichia Coli Aminopeptidase P Length 1e-23
2bwv_A440 His361ala Escherichia Coli Aminopeptidase P Length 1e-23
2v3z_A440 Glu383ala Escherichia Coli Aminopeptidase P In Comp 2e-23
2bwy_A440 Glu383ala Escherichia Coli Aminopeptidase P Length 2e-23
4mat_A278 E.Coli Methionine Aminopeptidase His79ala Mutant Le 2e-09
1c27_A263 E. Coli Methionine Aminopeptidase:norleucine Phosph 2e-09
2gu4_A263 E. Coli Methionine Aminopeptidase In Complex With N 2e-09
3mat_A265 E.Coli Methionine Aminopeptidase Transition-State I 2e-09
2p99_A261 E. Coli Methionine Aminopeptidase Monometalated Wit 2e-09
2mat_A264 E.Coli Methionine Aminopeptidase At 1.9 Angstrom Re 2e-09
2p98_A262 E. Coli Methionine Aminopeptidase Monometalated Wit 2e-09
2gg0_A263 Novel Bacterial Methionine Aminopeptidase Inhibitor 2e-09
2gtx_A261 Structural Basis Of Catalysis By Mononuclear Methio 3e-09
1xnz_A264 Crystal Structure Of Mn(Ii) Form Of E. Coli. Methio 3e-09
1qxw_A252 Crystal Structure Of Staphyloccocus Aureus In Compl 2e-08
1o0x_A262 Crystal Structure Of Methionine Aminopeptidase (Tm1 9e-07
3iu7_A288 M. Tuberculosis Methionine Aminopeptidase With Mn I 9e-07
1y1n_A291 Identification Of Sh3 Motif In M. Tuberculosis Meth 9e-07
3pka_A285 M. Tuberculosis Metap With Bengamide Analog Y02, In 9e-07
2b3h_A329 Crystal Structure Of Human Methionine Aminopeptidas 4e-06
2g6p_A304 Crystal Structure Of Truncated (Delta 1-89) Human M 5e-06
3ig4_A427 Structure Of A Putative Aminopeptidase P From Bacil 3e-19
3mr1_A252 Crystal Structure Of Methionine Aminopeptidase From 7e-07
3mx6_A262 Crystal Structure Of Methionine Aminopeptidase From 7e-07
2dfi_A301 Crystal Structure Of Pf-Map(1-292)-C Length = 301 0.004
1xgs_A295 Methionine Aminopeptidase From Hyperthermophile Pyr 0.004
>gi|189096241|pdb|3CTZ|A Chain A, Structure Of Human Cytosolic X-Prolyl Aminopeptidase Length = 623 Back     alignment and structure
 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 203/624 (32%), Positives = 304/624 (48%), Gaps = 30/624 (4%)

Query: 10  SPSKTFERVHNLRSCFDS-----LGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAG 64
            P  T E +  LR    +       + A+++P  D ++ E++     R A++SGF GSAG
Sbjct: 2   PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAG 61

Query: 65  IAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNI--AIEPLHAWISEHGFVGLRLGLDS 122
            AI+  + + ++ DGRY LQ  K++D+    +K           W+      G R+G+D 
Sbjct: 62  TAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDP 121

Query: 123 RLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEK 182
            +  +     + K L      ++ V  N +D +W DRP+R  + +    + Y G   ++K
Sbjct: 122 LIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDK 181

Query: 183 IRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQ 242
           + D+   + ++ V    +     IAW+FN+RG D+  +P   S AI+  +         +
Sbjct: 182 VADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDR 241

Query: 243 YINEQLKALL--------SAVAIVLDMDMMDSRLVCLA---RTSMPILIDPKWISYRFFK 291
                +K  L             V     + S L  L         + +     SY   +
Sbjct: 242 IDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVS-DKASYAVSE 300

Query: 292 VIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSLETITEI 351
            I + +   +  +         KN  E EGM+ AHI+D VA+        +   + + + 
Sbjct: 301 TIPKDHRCCMPYTPICIAKA-VKNSAESEGMRRAHIKDAVALCELF----NWLEKEVPKG 355

Query: 352 DIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLLD 411
            + +     + E   + +    D++F TI+++GP  AIIHY    ++NR L  DE+ L+D
Sbjct: 356 GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPTGAIIHYAPVPETNRTLSLDEVYLID 415

Query: 412 SGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARIF 471
           SGAQY +GTTD+TRT+        +K  FT VLKG I+VS A FP  T+G  LDS AR  
Sbjct: 416 SGAQYKDGTTDVTRTMHFETPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSA 475

Query: 472 LWKYGADFAHGVGHGVGSFLPVHEGPQGISRT--NQEPLLPGMILSNEPGYYRCGAFGIR 529
           LW  G D+ HG GHGVGSFL VHEGP GIS    + EPL  GMI+++EPGYY  GAFGIR
Sbjct: 476 LWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIR 535

Query: 530 IENVLCVSEPETI-NNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTS 588
           IENV+ V   +T  N      L    LTL PI  K+I V+ LT++E  W N+YH      
Sbjct: 536 IENVVLVVPVKTKYNFNNRGSLTLEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDV 595

Query: 589 LAPLIED---QEVLSWLFSVTAPI 609
           +   ++    QE L WL   T PI
Sbjct: 596 IGKELQKQGRQEALEWLIRETQPI 619


gi|47168566|pdb|1PV9|A Chain A, Prolidase From Pyrococcus Furiosus Length = 348 Back     alignment and structure
>gi|321160035|pdb|3Q6D|A Chain A, Xaa-Pro Dipeptidase From Bacillus Anthracis. Length = 356 Back     alignment and structure
gi|209447405|pdb|2ZSG|A Chain A, Crystal Structure Of X-Pro Aminopeptidase From Thermotoga Maritima Msb8 Length = 359 Back     alignment and structure
gi|61680285|pdb|1WY2|A Chain A, Crystal Structure Of The Prolidase From Pyrococcus Horikoshii Ot3 Length = 351 Back     alignment and structure
>gi|515103|pdb|1CHM|B Chain B, Enzymatic Mechanism Of Creatine Amidinohydrolase As Deduced From Crystal Structures Length = 401 Back     alignment and structure
>gi|809294|pdb|1CHM|A Chain A, Enzymatic Mechanism Of Creatine Amidinohydrolase As Deduced From Crystal Structures Length = 401 Back     alignment and structure
>gi|22219065|pdb|1KP0|A Chain A, The Crystal Structure Analysis Of Creatine Amidinohydrolase From Actinobacillus Length = 402 Back     alignment and structure
>gi|284794115|pdb|3L24|A Chain A, Crystal Structure Of The Nerve Agent Degrading Organophosphate AnhydrolasePROLIDASE IN COMPLEX WITH Inhibitors Length = 517 Back     alignment and structure
>gi|321160035|pdb|3Q6D|A Chain A, Xaa-Pro Dipeptidase From Bacillus Anthracis. Length = 356 Back     alignment and structure
gi|209447405|pdb|2ZSG|A Chain A, Crystal Structure Of X-Pro Aminopeptidase From Thermotoga Maritima Msb8 Length = 359 Back     alignment and structure
>gi|326634526|pdb|3QOC|A Chain A, Crystal Structure Of N-Terminal Domain (CreatinasePROLIDASE LIKE Domain) Of Putative Metallopeptidase From Corynebacterium Diphtheriae Length = 135 Back     alignment and structure
>gi|310942897|pdb|3OVK|A Chain A, Crystal Structure Of An Xxa-Pro Aminopeptidase From Streptococcus Pyogenes Length = 132 Back     alignment and structure
>gi|257472024|pdb|3IL0|A Chain A, The Crystal Structure Of The Aminopeptidase P,Xaa-Pro Aminopeptidase From Streptococcus Thermophilus Length = 131 Back     alignment and structure
gi|75765344|pdb|1WN1|A Chain A, Crystal Structure Of Dipeptiase From Pyrococcus Horikoshii Ot3 Length = 356 Back     alignment and structure
>gi|112491419|pdb|2IW2|A Chain A, Crystal Structure Of Human Prolidase Length = 494 Back     alignment and structure
>gi|75765331|pdb|1WL9|A Chain A, Structure Of Aminopeptidase P From E. Coli Length = 440 Back     alignment and structure
>gi|30749440|pdb|1M35|A Chain A, Aminopeptidase P From Escherichia Coli Length = 440 Back     alignment and structure
>gi|157831534|pdb|1JAW|A Chain A, Aminopeptidase P From E. Coli Low Ph Form Length = 440 Back     alignment and structure
>gi|88192502|pdb|2BWS|A Chain A, His243ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>gi|88192503|pdb|2BWT|A Chain A, Asp260ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>gi|88192504|pdb|2BWU|A Chain A, Asp271ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>gi|88192506|pdb|2BWW|A Chain A, His350ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>gi|88192505|pdb|2BWV|A Chain A, His361ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>gi|160877823|pdb|2V3Z|A Chain A, Glu383ala Escherichia Coli Aminopeptidase P In Complex With Substrate Length = 440 Back     alignment and structure
>gi|88192508|pdb|2BWY|A Chain A, Glu383ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>gi|9257170|pdb|4MAT|A Chain A, E.Coli Methionine Aminopeptidase His79ala Mutant Length = 278 Back     alignment and structure
>gi|6573394|pdb|1C27|A Chain A, E. Coli Methionine Aminopeptidase:norleucine Phosphonate Complex Length = 263 Back     alignment and structure
>gi|110590415|pdb|2GU4|A Chain A, E. Coli Methionine Aminopeptidase In Complex With Nlep, 1: 0.5, Di-Metalated Length = 263 Back     alignment and structure
>gi|9257169|pdb|3MAT|A Chain A, E.Coli Methionine Aminopeptidase Transition-State Inhibitor Complex Length = 265 Back     alignment and structure
>gi|160877713|pdb|2P99|A Chain A, E. Coli Methionine Aminopeptidase Monometalated With Inhibitor Ye6 Length = 261 Back     alignment and structure
>gi|5542522|pdb|2MAT|A Chain A, E.Coli Methionine Aminopeptidase At 1.9 Angstrom Resolution Length = 264 Back     alignment and structure
>gi|160877712|pdb|2P98|A Chain A, E. Coli Methionine Aminopeptidase Monometalated With Inhibitor Ye7 Length = 262 Back     alignment and structure
>gi|110590267|pdb|2GG0|A Chain A, Novel Bacterial Methionine Aminopeptidase Inhibitors Length = 263 Back     alignment and structure
>gi|110590410|pdb|2GTX|A Chain A, Structural Basis Of Catalysis By Mononuclear Methionine Aminopeptidase Length = 261 Back     alignment and structure
gi|56554613|pdb|1XNZ|A Chain A, Crystal Structure Of Mn(Ii) Form Of E. Coli. Methionine Aminopeptidase In Complex With 5-(2-Chlorophenyl)furan-2- Carboxylic Acid Length = 264 Back     alignment and structure
gi|47168659|pdb|1QXW|A Chain A, Crystal Structure Of Staphyloccocus Aureus In Complex With An Aminoketone Inhibitor 54135. Length = 252 Back     alignment and structure
>gi|24987887|pdb|1O0X|A Chain A, Crystal Structure Of Methionine Aminopeptidase (Tm1478) From Thermotoga Maritima At 1.90 A Resolution Length = 262 Back     alignment and structure
>gi|283807062|pdb|3IU7|A Chain A, M. Tuberculosis Methionine Aminopeptidase With Mn Inhibitor A02 Length = 288 Back     alignment and structure
>gi|67463881|pdb|1Y1N|A Chain A, Identification Of Sh3 Motif In M. Tuberculosis Methionine Aminopeptidase Suggests A Mode Of Interaction With The Ribosome Length = 291 Back     alignment and structure
gi|329666154|pdb|3PKA|A Chain A, M. Tuberculosis Metap With Bengamide Analog Y02, In Mn Form Length = 285 Back     alignment and structure
>gi|83754210|pdb|2B3H|A Chain A, Crystal Structure Of Human Methionine Aminopeptidase Type I With A Third Cobalt In The Active Site Length = 329 Back     alignment and structure
>gi|110590199|pdb|2G6P|A Chain A, Crystal Structure Of Truncated (Delta 1-89) Human Methionine Aminopeptidase Type 1 In Complex With Pyridyl Pyrimidine Derivative Length = 304 Back     alignment and structure
>gi|255312000|pdb|3IG4|A Chain A, Structure Of A Putative Aminopeptidase P From Bacillus Anthracis Length = 427 Back     alignment and structure
>gi|296863694|pdb|3MR1|A Chain A, Crystal Structure Of Methionine Aminopeptidase From Ricketts Prowazekii Length = 252 Back     alignment and structure
>gi|296863717|pdb|3MX6|A Chain A, Crystal Structure Of Methionine Aminopeptidase From Ricketts Prowazekii Bound To Methionine Length = 262 Back     alignment and structure
>gi|134104119|pdb|2DFI|A Chain A, Crystal Structure Of Pf-Map(1-292)-C Length = 301 Back     alignment and structure
gi|2392623|pdb|1XGS|A Chain A, Methionine Aminopeptidase From Hyperthermophile Pyrococcus Furiosus Length = 295 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target609 putative aminopeptidase [Candidatus Liberibacter asiati
3ctz_A623 XAA-Pro aminopeptidase 1; PITA-bread fold, alternative 1e-155
3cb6_A444 FACT complex subunit SPT16; peptidase homology domain, 3e-38
2v3z_A440 XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- s 9e-17
2iw2_A494 XAA-Pro dipeptidase; metallocarboxypeptidase, disease m 8e-10
3biq_A467 FACT complex subunit SPT16; PITA-bread, aminopeptidase, 2e-35
1kp0_A402 Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sa 2e-34
1wy2_A351 XAA-Pro dipeptidase; structural genomics, prolidase, ri 4e-29
2zsg_A359 Aminopeptidase P, putative; hydrolase; 1.65A {Thermotog 5e-27
1chm_A401 Creatine amidinohydrolase; creatinase; 1.90A {Pseudomon 3e-25
3ig4_A427 XAA-Pro aminopeptidase; csgid, hydrolase, structural ge 2e-34
3mx6_A262 Methionine aminopeptidase; seattle structural genomics 1e-21
1o0x_A262 Methionine aminopeptidase; TM1478, structural genomics, 6e-19
1qxy_A252 Methionyl aminopeptidase; PITA bread fold, hydrolase; H 6e-18
3iu7_A288 Methionine aminopeptidase; enzyme-inhibitor complex, co 4e-12
2gg2_A263 Methionine aminopeptidase; PITA-bread fold, MAP inhibit 3e-11
2b3h_A329 Methionine aminopeptidase 1; hydrolase, metalloprotease 2e-08
2zsg_A359 Aminopeptidase P, putative; hydrolase; 1.65A {Thermotog 4e-05
1wn1_A356 Dipeptidase; prolidase, cobalt(II), structural genomics 2e-26
3l24_A517 XAA-Pro dipeptidase; PITA-bread, detoxification, hydrol 7e-25
3ovk_A132 Aminopeptidase P, XAA-Pro dipeptidase; structural genom 9e-14
3il0_A131 Aminopeptidase P; XAA-Pro aminopeptidase; structural ge 1e-11
1b6a_A478 Methionine aminopeptidase; angiogenesis inhibitor; HET: 1e-09
>3ctz_A XAA-Pro aminopeptidase 1; PITA-bread fold, alternative splicing, cytoplasm, hydrolase, manganese, metal-binding, metalloprotease, protease; HET: P6G; 1.60A {Homo sapiens} Length = 623 Back     alignment and structure
 Score =  544 bits (1402), Expect = e-155
 Identities = 216/625 (34%), Positives = 313/625 (50%), Gaps = 32/625 (5%)

Query: 10  SPSKTFERVHNLRS-----CFDSLGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAG 64
            P  T E +  LR       + +  + A+++P  D ++ E++     R A++SGF GSAG
Sbjct: 2   PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAG 61

Query: 65  IAIVLRQKSVIFVDGRYTLQVEKEVDTALFTIKNIAIE--PLHAWISEHGFVGLRLGLDS 122
            AI+  + + ++ DGRY LQ  K++D+    +K    +      W+      G R+G+D 
Sbjct: 62  TAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDP 121

Query: 123 RLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEK 182
            +  +     + K L      ++ V  N +D +W DRP+R  + +    + Y G   ++K
Sbjct: 122 LIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDK 181

Query: 183 IRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDKQ 242
           + D+   + ++ V    +     IAW+FN+RG D+  +P   S AI+  +    +F D  
Sbjct: 182 VADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLET-IMLFIDGD 240

Query: 243 YIN-EQLKALLSAVAIVL--------DMDMMDSRLVCLARTSMP--ILIDPKWISYRFFK 291
            I+   +K  L     +             + S L  L     P   +      SY   +
Sbjct: 241 RIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSE 300

Query: 292 VIAQKNGVMVEGSDPSCLLRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSL-ETITE 350
            I  K+        P C+ +A KN  E EGM+ AHI+D VA+     W   +     +TE
Sbjct: 301 TI-PKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTE 359

Query: 351 IDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAAIIHYQATVQSNRLLQKDELLLL 410
           I    K E  R +          D++F TI+++GP  AIIHY    ++NR L  DE+ L+
Sbjct: 360 ISAADKAEEFRRQQAD-----FVDLSFPTISSTGPTGAIIHYAPVPETNRTLSLDEVYLI 414

Query: 411 DSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIARI 470
           DSGAQY +GTTD+TRT+        +K  FT VLKG I+VS A FP  T+G  LDS AR 
Sbjct: 415 DSGAQYKDGTTDVTRTMHFETPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARS 474

Query: 471 FLWKYGADFAHGVGHGVGSFLPVHEGPQGISRT--NQEPLLPGMILSNEPGYYRCGAFGI 528
            LW  G D+ HG GHGVGSFL VHEGP GIS    + EPL  GMI+++EPGYY  GAFGI
Sbjct: 475 ALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGI 534

Query: 529 RIENVLCVSEPET-INNGECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYT 587
           RIENV+ V   +T  N      L    LTL PI  K+I V+ LT++E  W N+YH     
Sbjct: 535 RIENVVLVVPVKTKYNFNNRGSLTLEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRD 594

Query: 588 SLAPLIEDQ---EVLSWLFSVTAPI 609
            +   ++ Q   E L WL   T PI
Sbjct: 595 VIGKELQKQGRQEALEWLIRETQPI 619


>3cb6_A FACT complex subunit SPT16; peptidase homology domain, histone binding module, histone H3/H4 chaperone, PITA-bread fold; 1.84A {Schizosaccharomyces pombe} PDB: 3cb5_A Length = 444 Back     alignment and structure
>2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidase P, manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} SCOP: c.55.2.1 d.127.1.1 PDB: 2bwy_A* 1wl9_A 1m35_A 1n51_A* 1w2m_A 1a16_A 1wbq_A 1wl6_A* 1w7v_A 1wlr_A* 2bh3_A* 2bha_A* 2bhb_A* 2bhc_A* 2bhd_A* 2bn7_A* 1jaw_A 2bwt_A* 2bwu_A* 2bww_A* ... Length = 440 Back     alignment and structure
>2iw2_A XAA-Pro dipeptidase; metallocarboxypeptidase, disease mutation, acetylation, peptidase D, polymorphism, collagen degradation, metalloaminopeptidase; 1.82A {Homo sapiens} PDB: 2okn_A Length = 494 Back     alignment and structure
>3biq_A FACT complex subunit SPT16; PITA-bread, aminopeptidase, chromatin, replication, activator, chromosomal protein, coiled coil, DNA damage; 1.73A {Saccharomyces cerevisiae} PDB: 3bip_A 3bit_A* Length = 467 Back     alignment and structure
>1kp0_A Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sandwich; 2.70A {Actinobacillus} SCOP: c.55.2.1 d.127.1.1 Length = 402 Back     alignment and structure
>1wy2_A XAA-Pro dipeptidase; structural genomics, prolidase, riken structural genomics/proteomics initiative, RSGI, hydrolase; 1.70A {Pyrococcus horikoshii OT3} PDB: 1pv9_A Length = 351 Back     alignment and structure
>2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} SCOP: c.55.2.1 d.127.1.1 Length = 401 Back     alignment and structure
>3ig4_A XAA-Pro aminopeptidase; csgid, hydrolase, structural genomics, center for structural genomics of infectious diseases; HET: SO4; 2.89A {Bacillus anthracis} Length = 427 Back     alignment and structure
>3mx6_A Methionine aminopeptidase; seattle structural genomics center for infectious disease, S aminopeptidase, protease, epidermic typhus; 1.70A {Rickettsia prowazekii} PDB: 3mr1_A Length = 262 Back     alignment and structure
>1o0x_A Methionine aminopeptidase; TM1478, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: d.127.1.1 Length = 262 Back     alignment and structure
>1qxy_A Methionyl aminopeptidase; PITA bread fold, hydrolase; HET: M2C; 1.04A {Staphylococcus aureus} SCOP: d.127.1.1 PDB: 1qxw_A* 1qxz_A* Length = 252 Back     alignment and structure
>3iu7_A Methionine aminopeptidase; enzyme-inhibitor complex, cobalt, hydrolase, metal-binding, protease; HET: FCD; 1.40A {Mycobacterium tuberculosis} PDB: 3iu8_A* 3iu9_A* 1y1n_A 1yj3_A Length = 288 Back     alignment and structure
>2gg2_A Methionine aminopeptidase; PITA-bread fold, MAP inhibitor, antibacterial, hydrolase; HET: U12; 1.00A {Escherichia coli K12} SCOP: d.127.1.1 PDB: 2gg0_A* 2gg3_A* 2gg5_A* 2gg7_A* 2gg8_A* 2gg9_A* 2ggb_A* 2ggc_A 2q93_A* 2q95_A* 2q96_A* 1xnz_A* 1mat_A* 2bb7_A* 2evc_A* 2evm_A* 2evo_A* 3mat_A* 1yvm_A* 2mat_A ... Length = 263 Back     alignment and structure
>2b3h_A Methionine aminopeptidase 1; hydrolase, metalloprotease, pitabread fold; HET: GOL; 1.10A {Homo sapiens} PDB: 2b3k_A 2b3l_A 2gz5_A* 2nq6_A* 2nq7_A* 2g6p_A* Length = 329 Back     alignment and structure
>2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii OT3} PDB: 2how_A Length = 356 Back     alignment and structure
>3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} Length = 517 Back     alignment and structure
>3ovk_A Aminopeptidase P, XAA-Pro dipeptidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.00A {Streptococcus pyogenes} Length = 132 Back     alignment and structure
>3il0_A Aminopeptidase P; XAA-Pro aminopeptidase; structural genomics, PSI, MCSG, protein structure initiative; HET: GOL; 2.20A {Streptococcus thermophilus lmg 18311} Length = 131 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target609 putative aminopeptidase [Candidatus Liberibacter asiati
3ctz_A623 XAA-Pro aminopeptidase 1; PITA-bread fold, alternative 100.0
1wy2_A351 XAA-Pro dipeptidase; structural genomics, prolidase, ri 100.0
1kp0_A402 Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sa 100.0
1chm_A401 Creatine amidinohydrolase; creatinase; 1.90A {Pseudomon 100.0
1wn1_A356 Dipeptidase; prolidase, cobalt(II), structural genomics 100.0
2zsg_A359 Aminopeptidase P, putative; hydrolase; 1.65A {Thermotog 100.0
3biq_A467 FACT complex subunit SPT16; PITA-bread, aminopeptidase, 100.0
3l24_A517 XAA-Pro dipeptidase; PITA-bread, detoxification, hydrol 100.0
2iw2_A494 XAA-Pro dipeptidase; metallocarboxypeptidase, disease m 100.0
3cb6_A444 FACT complex subunit SPT16; peptidase homology domain, 100.0
2v3z_A440 XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- s 100.0
3ig4_A427 XAA-Pro aminopeptidase; csgid, hydrolase, structural ge 100.0
3mx6_A262 Methionine aminopeptidase; seattle structural genomics 100.0
2gg2_A263 Methionine aminopeptidase; PITA-bread fold, MAP inhibit 100.0
1o0x_A262 Methionine aminopeptidase; TM1478, structural genomics, 100.0
1qxy_A252 Methionyl aminopeptidase; PITA bread fold, hydrolase; H 100.0
3iu7_A288 Methionine aminopeptidase; enzyme-inhibitor complex, co 100.0
2b3h_A329 Methionine aminopeptidase 1; hydrolase, metalloprotease 100.0
1xgs_A295 Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyr 99.96
2q8k_A401 Proliferation-associated protein 2G4; EBP1, PA2G4, meth 99.97
2nw5_A360 Methionine aminopeptidase 2; metap2, structural genomic 99.95
1b6a_A478 Methionine aminopeptidase; angiogenesis inhibitor; HET: 99.94
3ovk_A132 Aminopeptidase P, XAA-Pro dipeptidase; structural genom 99.72
3il0_A131 Aminopeptidase P; XAA-Pro aminopeptidase; structural ge 99.62
3o5v_A132 X-Pro dipeptidase; creatinase, N-terminal, PSI, MCSG, s 99.37
3ooo_A132 Proline dipeptidase; structural genomics, PSI-2, protei 99.36
3i7m_A140 XAA-Pro dipeptidase; structural genomics, APC64794.2, m 99.22
2zsg_A359 Aminopeptidase P, putative; hydrolase; 1.65A {Thermotog 99.02
1wy2_A351 XAA-Pro dipeptidase; structural genomics, prolidase, ri 98.59
1kp0_A402 Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sa 98.36
1chm_A401 Creatine amidinohydrolase; creatinase; 1.90A {Pseudomon 98.13
1wn1_A356 Dipeptidase; prolidase, cobalt(II), structural genomics 98.08
3biq_A467 FACT complex subunit SPT16; PITA-bread, aminopeptidase, 97.04
3cb6_A444 FACT complex subunit SPT16; peptidase homology domain, 96.58
3il0_A131 Aminopeptidase P; XAA-Pro aminopeptidase; structural ge 99.16
3ooo_A132 Proline dipeptidase; structural genomics, PSI-2, protei 99.15
3o5v_A132 X-Pro dipeptidase; creatinase, N-terminal, PSI, MCSG, s 99.12
3i7m_A140 XAA-Pro dipeptidase; structural genomics, APC64794.2, m 99.11
3ovk_A132 Aminopeptidase P, XAA-Pro dipeptidase; structural genom 99.02
3ctz_A 623 XAA-Pro aminopeptidase 1; PITA-bread fold, alternative 98.81
3l24_A517 XAA-Pro dipeptidase; PITA-bread, detoxification, hydrol 94.42
2b3h_A329 Methionine aminopeptidase 1; hydrolase, metalloprotease 93.53
>3ctz_A XAA-Pro aminopeptidase 1; PITA-bread fold, alternative splicing, cytoplasm, hydrolase, manganese, metal-binding, metalloprotease, protease; HET: P6G; 1.60A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=0  Score=1366.58  Aligned_cols=591  Identities=36%  Similarity=0.579  Sum_probs=545.0

Q ss_pred             CCCCHHHHHHHHHHHHHH-----CCCCEEEEECCCCCCCCCCCCHHCHHHHHHCCCCCCEEEEEECCCCEEEECCHHHHH
Q ss_conf             887558999999999997-----499799960888747860667106100441467650077895783679978814899
Q gi|254780605|r   10 SPSKTFERVHNLRSCFDS-----LGMDAFLVPRVDEYRGEFVDKGSERLAWLSGFTGSAGIAIVLRQKSVIFVDGRYTLQ   84 (609)
Q Consensus        10 ~~~~~~erL~~LR~~m~~-----~~idayiip~~D~h~sEyv~~~~~rl~~isGFtGSaG~aiIt~~~a~L~tDgRY~lQ   84 (609)
                      +|..|+|||++||++|++     +||||||||++|+|||||+|++|+||+||||||||||+||||+++|+||||||||+|
T Consensus         2 ~~~~~~~~l~~lr~~m~~~~~~~~~id~yivp~~D~h~sEy~~~~~~r~~~lsgFtGSaG~avit~~~a~l~tDgRY~~Q   81 (623)
T 3ctz_A            2 PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQ   81 (623)
T ss_dssp             -CBCCHHHHHHHHHHTTCTTTCSSCCSEEEECSCCTTCCSSCCGGGCHHHHHHSCCSSCCEEEEESSCEEEEECGGGHHH
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCHHCCCHHCCCCCCHHHHHHHHCCEEEEEECCHHHHH
T ss_conf             98618999999999987346666780599968988877804740203041401998465517632887599988619999


Q ss_pred             HHHHHCCCCEEEEEC---CCCCHHHHHHHHCCCCCEEEECCEECCHHHHHHHHHHHHHCCCEEEECCCHHHHHHHCCCCC
Q ss_conf             998619671799866---89999998887437998899656341399999999985334761997050011122012763
Q gi|254780605|r   85 VEKEVDTALFTIKNI---AIEPLHAWISEHGFVGLRLGLDSRLHSSFEVDLLQKSLDKIEGVIVDVPYNPIDSLWKDRPQ  161 (609)
Q Consensus        85 A~~el~~~~~~~~~~---~~~~~~~wl~~~~~~g~~IG~Dp~l~s~~~~~~l~~~l~~~~~~l~~~~~NlVD~iW~~rP~  161 (609)
                      |++|+|++| .+++.   +.+++.+||.+++++|.+|||||+++|++++++|++.++++++.|++++.||||+||+|||.
T Consensus        82 A~~q~~~~~-~l~~~~~~~~~~~~~wl~~~~~~~~~ig~Dp~l~s~~~~~~l~~~~~~~~~~l~~~~~nliD~iW~~rP~  160 (623)
T 3ctz_A           82 AAKQMDSNW-TLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPE  160 (623)
T ss_dssp             HHHHBCTTE-EEEETTSTTCCCHHHHHHHHCCTTCEEEECGGGSBHHHHHHHHHHHHHTTCEEEECSSCHHHHHCTTCCC
T ss_pred             HHHHCCCCE-EEEECCCCCCCCHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHCCC
T ss_conf             999619980-9996488899899999998646899899888537899999999999877987997441177887630863


Q ss_pred             CCCCEEEECCHHHCCCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHCCCCCCCCCCHHHHHHHHCCCCCCEEECCC
Q ss_conf             32200012012335877388999999860233430676028420234432013553778700233220147862000353
Q gi|254780605|r  162 RLYRKVAMQDMAYAGRESQEKIRDICKILHQKEVGAVFICDPSSIAWIFNIRGFDIPCSPYPLSRAILYADGKAEIFFDK  241 (609)
Q Consensus       162 ~~~~~i~~~~~~~aG~s~~eKi~~ir~~L~~~~~daliit~~d~IaWLlNiRG~Di~~tPv~~a~aiI~~~~~~~Lfvd~  241 (609)
                      .|.+++|.||.+|+|+|+++||++||+.|+++++|+++||+|||||||||+||+|++|+|+|+||++|+.+ .+.||++.
T Consensus       161 ~~~~~i~~~~~~~~G~s~~~Kl~rlr~~L~~~~~Dallit~~dnIawLlNiRg~di~~~Pv~~s~~iI~~~-~~~lf~~~  239 (623)
T 3ctz_A          161 RPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLE-TIMLFIDG  239 (623)
T ss_dssp             CCCCCCEECCHHHHSSCHHHHHHHHHHHHHTTTEEEEEECCHHHHHHHHTEECCSSSSSCCCSCEEEEESS-CEEEECCS
T ss_pred             CCCCHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCEEEECCCCCCCCCCCCCCEEEECCCC-CCEEEECC
T ss_conf             23432441781014863999999999999876998899934643200245522787877440124330455-41564034


Q ss_pred             CCCCHHH-HHHH--------CCCCEEECHHHHHHHHHHCCC---CCCEEEECCCCCCHHHHHHHHHCCCEEECCCCCCHH
Q ss_conf             1121567-8741--------256357074451577863013---574289725317788975312139567515432115
Q gi|254780605|r  242 QYINEQL-KALL--------SAVAIVLDMDMMDSRLVCLAR---TSMPILIDPKWISYRFFKVIAQKNGVMVEGSDPSCL  309 (609)
Q Consensus       242 ~k~~~~~-~~~l--------~~~~~~~~~~~~~~~l~~l~~---~~~~i~id~~~~s~~~~~~l~~~~~~~i~~~~pI~~  309 (609)
                      .++.... +.++        .....+.+++.+...+..+..   ...+++++ ..+++++++.+.. +..++...+||..
T Consensus       240 ~k~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~l~~~~~~~~~i~~~-~~~s~~~~~~l~~-~~~ii~~~~pI~~  317 (623)
T 3ctz_A          240 DRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVS-DKASYAVSETIPK-DHRCCMPYTPICI  317 (623)
T ss_dssp             GGGGSHHHHHHTTTTSCCCGGGCEEEECGGGHHHHHHHHHHTCCTTCEEEEE-TTSBHHHHHHSCG-GGEEEESSCHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCEEECCHHHHHHHHHHHHHHCCCCCEEEEC-CCCHHHHHHHHHC-CCEEEECCCHHHH
T ss_conf             2016777665442101223223233055899999999876521665405415-6223999998631-6717715897899


Q ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
Q ss_conf             666199999987999984438999999875332100-1245301889999999875433027855554100001233543
Q gi|254780605|r  310 LRATKNKVEIEGMQTAHIQDGVAMVYFLFWFYSQSL-ETITEIDIIKKLERCREEIGCKMRNPLRDIAFNTIAASGPHAA  388 (609)
Q Consensus       310 lRaiKn~~EI~~mr~Ahi~DgvAl~kfl~wL~~~~~-~~iTE~~ia~~Le~~R~~~~~~~~~~~~~~SF~TIva~G~N~A  388 (609)
                      ||+|||++||++||+||++||+|+++|++||+.... ..++|.+++.+++.+|++     ++++.++||+||+++|+|||
T Consensus       318 lRaIKn~~EI~~mR~A~~~d~~Al~~~l~~L~~~~~~~~i~e~~~~~~l~~~r~~-----~~~~~~~Sf~tI~asG~n~A  392 (623)
T 3ctz_A          318 AKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQ-----QADFVDLSFPTISSTGPTGA  392 (623)
T ss_dssp             HHHSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGTCCBHHHHHHHHHHHHHT-----STTEEEESSCCEEEEGGGGG
T ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH-----CCCCCCCCCCCCCCCCCCCC
T ss_conf             7744998999999999998889999888887503630568988899999998863-----27754543222235577655


Q ss_pred             CCCCCCCCCCCEEECCCCEEEEECCCCEECCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH
Q ss_conf             22224554332050389879983032010561222143210378888843336677888889972178978888999987
Q gi|254780605|r  389 IIHYQATVQSNRLLQKDELLLLDSGAQYVNGTTDITRTIAIGDVDYEKKYYFTLVLKGMISVSTARFPQRTRGCDLDSIA  468 (609)
Q Consensus       389 ipHY~~~~~s~~~i~~~~~~LiDsG~qY~~GtTDiTRT~~~G~~~~e~k~~yt~VLk~~ial~~a~fp~g~~g~~lD~~a  468 (609)
                      +|||+|+..+++++++|+++|+|+||||.+|||||||||++|+|+++||++||+||+||++++.++||+|++|.++|++|
T Consensus       393 ~~Hy~~~~~~~~~i~~gd~~liD~G~~y~gy~tDiTRT~~~G~pt~e~k~~y~~vl~~~~~~~~a~~p~g~~g~~~d~~a  472 (623)
T 3ctz_A          393 IIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFETPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFA  472 (623)
T ss_dssp             CTTCCCCGGGCCBCCTTSCEEEEECEEETTEECCEEEEECSSCCCHHHHHHHHHHHHHHHHHHTCCEETTCBGGGGGGGG
T ss_pred             CCCCCCCCCCCCEECCCCCEEEEEEEEECCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             34532110222100168850565546974503662687447889999998899999999999998579998048999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCEECCCCEEEECCCEEECCCCCEEEEEEEEEEECCCC-CCC
Q ss_conf             366774186547764323211356077886237--78986005698788468603568752150025999727877-877
Q gi|254780605|r  469 RIFLWKYGADFAHGVGHGVGSFLPVHEGPQGIS--RTNQEPLLPGMILSNEPGYYRCGAFGIRIENVLCVSEPETI-NNG  545 (609)
Q Consensus       469 R~~l~~~g~dy~HgtGHGVG~~l~VHE~P~~is--~~~~~~l~~Gmv~s~EPG~Y~~g~~GiRIEn~v~v~~~~~~-~~~  545 (609)
                      |.+||++|+||.||||||||+||+|||+|++|+  ..++.+|+||||+|||||||+||+|||||||+|+||+.++. +++
T Consensus       473 r~~l~~~G~~~~hgtGHGvG~~l~VHE~P~~i~~~~~~~~~Le~GMv~siEPG~Y~~g~~GiRiEn~v~Vte~~~~~~~~  552 (623)
T 3ctz_A          473 RSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFN  552 (623)
T ss_dssp             THHHHHTTCCCSSCSEEBCCSSSCSSCCSCEECTTCSCSCBCCTTCEEEECCEEEETTTEEEECBEEEEEEEECCSSCCS
T ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCEEEECCEEEECCCEEEEEEEEEEEEECCCCCCCC
T ss_conf             99999809997889986589999888898646657999977489999988998898895899702189999789756678


Q ss_pred             CCCEEEEEECCCCCCCHHCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCCC---HHHHHHHHHHCCCC
Q ss_conf             66424221011653001107867789999999999999999997441180---79999999732579
Q gi|254780605|r  546 ECLMLGFNTLTLCPIDRKLILVELLTNEEKKWCNDYHRRVYTSLAPLIED---QEVLSWLFSVTAPI  609 (609)
Q Consensus       546 ~~~fl~Fe~lT~vP~~~~li~~~ll~~~e~~wln~Yh~~v~~~~~p~l~~---~~~~~wl~~~t~~i  609 (609)
                      +..||+||+||+||||++|||++|||++||+|||+||++|+++|+|+|++   .++++||+++|+||
T Consensus       553 ~~~fl~fe~lT~~P~~~~li~~~ll~~~e~~wln~yh~~v~~~~~~~l~~~~~~~~~~wl~~~t~~i  619 (623)
T 3ctz_A          553 NRGSLTLEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPI  619 (623)
T ss_dssp             SSCEEEEEECCCCCCCGGGSCGGGSCHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCCC
T ss_pred             CCCCCCCCEEEECCCCHHHCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCC
T ss_conf             8763355522278662754484549999999999999999999888648232278999999827213



>1wy2_A XAA-Pro dipeptidase; structural genomics, prolidase, riken structural genomics/proteomics initiative, RSGI, hydrolase; 1.70A {Pyrococcus horikoshii OT3} PDB: 1pv9_A Back     alignment and structure
>1kp0_A Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sandwich; 2.70A {Actinobacillus} SCOP: c.55.2.1 d.127.1.1 Back     alignment and structure
>1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} SCOP: c.55.2.1 d.127.1.1 Back     alignment and structure
>1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii OT3} PDB: 2how_A Back     alignment and structure
>2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} Back     alignment and structure
>3biq_A FACT complex subunit SPT16; PITA-bread, aminopeptidase, chromatin, replication, activator, chromosomal protein, coiled coil, DNA damage; 1.73A {Saccharomyces cerevisiae} PDB: 3bip_A 3bit_A* Back     alignment and structure
>3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} PDB: 3l7g_A* Back     alignment and structure
>2iw2_A XAA-Pro dipeptidase; metallocarboxypeptidase, disease mutation, acetylation, peptidase D, polymorphism, collagen degradation, metalloaminopeptidase; 1.82A {Homo sapiens} PDB: 2okn_A Back     alignment and structure
>3cb6_A FACT complex subunit SPT16; peptidase homology domain, histone binding module, histone H3/H4 chaperone, PITA-bread fold; 1.84A {Schizosaccharomyces pombe} PDB: 3cb5_A Back     alignment and structure
>2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidase P, manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} SCOP: c.55.2.1 d.127.1.1 PDB: 2bwy_A* 1wl9_A 1m35_A 1n51_A* 1w2m_A 1a16_A 1wbq_A 1wl6_A* 1w7v_A 1wlr_A* 2bh3_A* 2bha_A* 2bhb_A* 2bhc_A* 2bhd_A* 2bn7_A* 1jaw_A 2bwt_A* 2bwu_A* 2bww_A* ... Back     alignment and structure
>3ig4_A XAA-Pro aminopeptidase; csgid, hydrolase, structural genomics, center for structural genomics of infectious diseases; HET: SO4; 2.89A {Bacillus anthracis} Back     alignment and structure