254780613

254780613

adenylosuccinate synthetase

GeneID in NCBI database:8209612Locus tag:CLIBASIA_02500
Protein GI in NCBI database:254780613Protein Accession:YP_003065026.1
Gene range:+(661457, 662755)Protein Length:432aa
Gene description:adenylosuccinate synthetase
COG prediction:[F] Adenylosuccinate synthase
KEGG prediction:adenylosuccinate synthetase (EC:6.3.4.4); K01939 adenylosuccinate synthase [EC:6.3.4.4]
SEED prediction:Adenylosuccinate synthetase (EC 6.3.4.4)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Alanine, aspartate and glutamate metabolism [PATH:las00250]
Subsystem involved in SEED:Purine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430--
MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENTLIMSNPFED
ccEEEEEEccccccccHHHHHHHcccccEEEEEccccccccEEEEccEEEEEEcccccccccccEEEEcccEEEcHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccccccccccccHHHHHHHHHcccccccccEEEEEEEccccEEccccccccccccHHHHHHHHccEEccccccccccHHHHHHHHHHHHHHcccccHHEEHHHHHccccEEEEEEEEEEccEEEccccccHHHHHccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccEEEccccccc
ccEEEEEEcccccccHHHHHHHHcccccEEEEccccccccEEEEEccEEEEEccccccccccccEEEEcccccEcHHHHHHHHHHHHcccccHHHHcEEEEcccEEccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccEHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHcEccHHHHHHHHHHHcccEEEEccccHHHcccccccccccccccccHHHHHHHcccHHHEEEEEEEEEccEEEccccccccEcccHHHHHHHHHcccEccccccEcEEEcEEHHHHHHHHHHHcccEEEEEccHHHHHccEEEEEEEEEEccEEcccccccHHHHcccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccEEEccccccc
MTNVVVVGlqwgdegkgKIVDWLSENADVIVRFqggnnaghtlkVNDIVYKLsllpsgvvrpdkmsiigssvvvdphaFISEIESLAHqgicvtpnnlriaNNASLILSIHRDldmlregalspcgahigttqrgigpayedrvgrRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEgaqgflldndhgtypfvtssntmsaqasigsgispgslGYVLGVVKAYttrvgggpfptelknQTGDFLKEVGKefgtvtnrqrrcgwlDLASVRRSVIINGVkgialtkldvldgldelkicvgyrmdgrevdflpddsiyhtrfepvYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALlsigperentlimsnpfed
MTNVVVVGlqwgdegkgkIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSpcgahigttqrgigpayedrvGRRAIRVMDLTDVEHISKKIEQLLLHHnalrrsfgekEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTrvgggpfptelknqTGDFLKEVGKefgtvtnrqrrcgwldlasvRRSVIINGvkgialtkldvldgLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVAllsigperentlimsnpfed
MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSNTMSAQAsigsgispgslgYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENTLIMSNPFED
MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDML**********HIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENTLIMSNPF**
MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENTLIMSNPFED
*TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENTLIMSNPF**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENTLIMSNPFED
MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENTLIMSNPFED
MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPERENTLIMSNPFED

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target432 adenylosuccinate synthetase [Candidatus Liberibacter as
315121813432 adenylosuccinate synthetase [Candidatus Liberibacter so 1 0.0
222149603432 adenylosuccinate synthetase [Agrobacterium vitis S4] Le 1 1e-175
15966481432 adenylosuccinate synthetase [Sinorhizobium meliloti 102 1 1e-174
325293798432 adenylosuccinate synthetase [Agrobacterium sp. H13-3] L 1 1e-173
86358942432 adenylosuccinate synthetase [Rhizobium etli CFN 42] Len 1 1e-173
227823297432 adenylosuccinate synthetase [Sinorhizobium fredii NGR23 1 1e-173
15889718432 adenylosuccinate synthetase [Agrobacterium tumefaciens 1 1e-173
241206036432 adenylosuccinate synthetase [Rhizobium leguminosarum bv 1 1e-172
150397814432 adenylosuccinate synthetase [Sinorhizobium medicae WSM4 1 1e-172
190893170432 adenylosuccinate synthetase [Rhizobium etli CIAT 652] L 1 1e-172
>gi|315121813|ref|YP_004062302.1| adenylosuccinate synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 432 Back     alignment and organism information
 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/432 (86%), Positives = 407/432 (94%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
           MTNVVVVGLQWGDEGKGKIVDWLSEN+DVIVRFQGGNNAGHTLK+ND+VYKLSLLPSGVV
Sbjct: 1   MTNVVVVGLQWGDEGKGKIVDWLSENSDVIVRFQGGNNAGHTLKINDVVYKLSLLPSGVV 60

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
           RPDKMS+IGS VV+DPH+ +SE+E+L  QGI VTP+NLRIANNASLILSIHRDLDMLREG
Sbjct: 61  RPDKMSVIGSGVVIDPHSLVSELENLKSQGISVTPDNLRIANNASLILSIHRDLDMLREG 120

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
           ALS  G  IGTTQRGIGPAYED+VGRRAIRV+DLTD+EHI +KIEQLLLHHNALR SFG+
Sbjct: 121 ALSSSGVPIGTTQRGIGPAYEDKVGRRAIRVIDLTDMEHIPEKIEQLLLHHNALRCSFGK 180

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           KEVL  TILEELMYAREKILPFMDV+WSLLERE+RKGA ILFEGAQGFLLDNDHGTYPFV
Sbjct: 181 KEVLCTTILEELMYAREKILPFMDVVWSLLERETRKGARILFEGAQGFLLDNDHGTYPFV 240

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT+SAQA+IGSG+SP SLGYVLGVVKAYTTRVG GPFPTELKN+ GDFLKEVGKEFG
Sbjct: 241 TSSNTISAQAAIGSGVSPSSLGYVLGVVKAYTTRVGEGPFPTELKNEIGDFLKEVGKEFG 300

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGREVDFLP 360
           TVTNRQRRCGWLDL S+RRS+IINGVKGIALTKLDVLDGLDELKIC+GYR+DGREVDFLP
Sbjct: 301 TVTNRQRRCGWLDLVSIRRSIIINGVKGIALTKLDVLDGLDELKICIGYRIDGREVDFLP 360

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
           DDSIYHTRFEPVYM+LEGW QST G+R ++DLP +A NYIRKIEE+L +PVALLSIGPER
Sbjct: 361 DDSIYHTRFEPVYMVLEGWSQSTYGIRRWSDLPEKAVNYIRKIEEILGIPVALLSIGPER 420

Query: 421 ENTLIMSNPFED 432
            NTLIMSNPFE+
Sbjct: 421 HNTLIMSNPFEN 432


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149603|ref|YP_002550560.1| adenylosuccinate synthetase [Agrobacterium vitis S4] Length = 432 Back     alignment and organism information
>gi|15966481|ref|NP_386834.1| adenylosuccinate synthetase [Sinorhizobium meliloti 1021] Length = 432 Back     alignment and organism information
>gi|325293798|ref|YP_004279662.1| adenylosuccinate synthetase [Agrobacterium sp. H13-3] Length = 432 Back     alignment and organism information
>gi|86358942|ref|YP_470834.1| adenylosuccinate synthetase [Rhizobium etli CFN 42] Length = 432 Back     alignment and organism information
>gi|227823297|ref|YP_002827269.1| adenylosuccinate synthetase [Sinorhizobium fredii NGR234] Length = 432 Back     alignment and organism information
>gi|15889718|ref|NP_355399.1| adenylosuccinate synthetase [Agrobacterium tumefaciens str. C58] Length = 432 Back     alignment and organism information
>gi|241206036|ref|YP_002977132.1| adenylosuccinate synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 432 Back     alignment and organism information
>gi|150397814|ref|YP_001328281.1| adenylosuccinate synthetase [Sinorhizobium medicae WSM419] Length = 432 Back     alignment and organism information
>gi|190893170|ref|YP_001979712.1| adenylosuccinate synthetase [Rhizobium etli CIAT 652] Length = 432 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target432 adenylosuccinate synthetase [Candidatus Liberibacter as
PRK01117430 PRK01117, PRK01117, adenylosuccinate synthetase; Provis 0.0
smart00788421 smart00788, Adenylsucc_synt, Adenylosuccinate synthetas 1e-180
COG0104430 COG0104, PurA, Adenylosuccinate synthase [Nucleotide tr 1e-164
cd03108363 cd03108, AdSS, Adenylosuccinate synthetase (AdSS) catal 1e-140
TIGR00184425 TIGR00184, purA, adenylosuccinate synthase 1e-135
PLN02513427 PLN02513, PLN02513, adenylosuccinate synthase 1e-124
PTZ00350436 PTZ00350, PTZ00350, adenylosuccinate synthetase; Provis 1e-122
PRK13786424 PRK13786, PRK13786, adenylosuccinate synthetase; Provis 1e-108
KOG1355455 KOG1355, KOG1355, KOG1355, Adenylosuccinate synthase [N 1e-103
PRK13783404 PRK13783, PRK13783, adenylosuccinate synthetase; Provis 7e-97
PRK13788404 PRK13788, PRK13788, adenylosuccinate synthetase; Provis 1e-96
PRK13785454 PRK13785, PRK13785, adenylosuccinate synthetase; Provis 6e-96
PRK13787423 PRK13787, PRK13787, adenylosuccinate synthetase; Provis 6e-96
PRK13784428 PRK13784, PRK13784, adenylosuccinate synthetase; Provis 1e-93
PRK04293333 PRK04293, PRK04293, adenylosuccinate synthetase; Provis 4e-62
pfam00709420 pfam00709, Adenylsucc_synt, Adenylosuccinate synthetase 1e-170
PTZ00351710 PTZ00351, PTZ00351, adenylosuccinate synthetase; Provis 8e-14
>gnl|CDD|179227 PRK01117, PRK01117, adenylosuccinate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|129024 smart00788, Adenylsucc_synt, Adenylosuccinate synthetase Back     alignment and domain information
>gnl|CDD|30453 COG0104, PurA, Adenylosuccinate synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|73337 cd03108, AdSS, Adenylosuccinate synthetase (AdSS) catalyzes the first step in the de novo biosynthesis of AMP Back     alignment and domain information
>gnl|CDD|161751 TIGR00184, purA, adenylosuccinate synthase Back     alignment and domain information
>gnl|CDD|178129 PLN02513, PLN02513, adenylosuccinate synthase Back     alignment and domain information
>gnl|CDD|185572 PTZ00350, PTZ00350, adenylosuccinate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184325 PRK13786, PRK13786, adenylosuccinate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|36569 KOG1355, KOG1355, KOG1355, Adenylosuccinate synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|184323 PRK13783, PRK13783, adenylosuccinate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184326 PRK13788, PRK13788, adenylosuccinate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184324 PRK13785, PRK13785, adenylosuccinate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|172324 PRK13787, PRK13787, adenylosuccinate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|172322 PRK13784, PRK13784, adenylosuccinate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179812 PRK04293, PRK04293, adenylosuccinate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|144347 pfam00709, Adenylsucc_synt, Adenylosuccinate synthetase Back     alignment and domain information
>gnl|CDD|173544 PTZ00351, PTZ00351, adenylosuccinate synthetase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 432 adenylosuccinate synthetase [Candidatus Liberibacter as
PRK01117431 adenylosuccinate synthetase; Provisional 100.0
COG0104430 PurA Adenylosuccinate synthase [Nucleotide transport an 100.0
smart00788421 Adenylsucc_synt Adenylosuccinate synthetase. Adenylosuc 100.0
PRK13787423 adenylosuccinate synthetase; Provisional 100.0
PRK13786424 adenylosuccinate synthetase; Provisional 100.0
pfam00709420 Adenylsucc_synt Adenylosuccinate synthetase. 100.0
PRK13784428 adenylosuccinate synthetase; Provisional 100.0
PRK13785442 adenylosuccinate synthetase; Provisional 100.0
PRK13788404 adenylosuccinate synthetase; Provisional 100.0
PRK13783404 adenylosuccinate synthetase; Provisional 100.0
cd03108363 AdSS Adenylosuccinate synthetase (AdSS) catalyzes the f 100.0
KOG1355455 consensus 100.0
PRK04293333 adenylosuccinate synthetase; Provisional 100.0
) plays an important role in purine biosynthesis, by catalyzing the GTP-dependent conversion of IMP and aspartic acid to AMP. Adenylosuccinate synthetase has been characterised from various sources ranging from Escherichia coli (gene purA) to vertebrate tissues. In vertebrates, two isozymes are present - one involved in purine biosynthesis and the other in the purine nucleotide cycle. The crystal structure of adenylosuccinate synthetase from E. coli reveals that the dominant structural element of each monomer of the homodimer is a central beta-sheet of 10 strands. The first nine strands of the sheet are mutually parallel with right-handed crossover connections between the strands. The 10th strand is antiparallel with respect to the first nine strands. In addition, the enzyme has two antiparallel beta-sheets, comprised of two strands and three strands each, 11 alpha-helices and two short 3/10-helices. Further, it has been suggested that the similarities in the GTP-binding domains of the synthetase and the p21ras protein are an example of convergent evolution of two distinct families of GTP-binding proteins . Structures of adenylosuccinate synthetase from Triticum aestivum and Arabidopsis thaliana when compared with the known structures from E. coli reveals that the overall fold is very similar to that of the E. coli protein .; GO: 0004019 adenylosuccinate synthase activity, 0005525 GTP binding, 0006164 purine nucleotide biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00184">TIGR00184431 purA adenylosuccinate synthetase; InterPro: IPR001114 A 100.0
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 91.22
>PRK01117 adenylosuccinate synthetase; Provisional Back     alignment and domain information
>COG0104 PurA Adenylosuccinate synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00788 Adenylsucc_synt Adenylosuccinate synthetase Back     alignment and domain information
>PRK13787 adenylosuccinate synthetase; Provisional Back     alignment and domain information
>PRK13786 adenylosuccinate synthetase; Provisional Back     alignment and domain information
>pfam00709 Adenylsucc_synt Adenylosuccinate synthetase Back     alignment and domain information
>PRK13784 adenylosuccinate synthetase; Provisional Back     alignment and domain information
>PRK13785 adenylosuccinate synthetase; Provisional Back     alignment and domain information
>PRK13788 adenylosuccinate synthetase; Provisional Back     alignment and domain information
>PRK13783 adenylosuccinate synthetase; Provisional Back     alignment and domain information
>cd03108 AdSS Adenylosuccinate synthetase (AdSS) catalyzes the first step in the de novo biosynthesis of AMP Back     alignment and domain information
>KOG1355 consensus Back     alignment and domain information
>PRK04293 adenylosuccinate synthetase; Provisional Back     alignment and domain information
>TIGR00184 purA adenylosuccinate synthetase; InterPro: IPR001114 Adenylosuccinate synthetase (Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target432 adenylosuccinate synthetase [Candidatus Liberibacter as
1juy_A431 Refined Crystal Structure Of Adenylosuccinate Synth 1e-140
1cg0_A431 Structure Of Adenylosuccinate Synthetase From E. Co 1e-140
1kjx_A432 Imp Complex Of E. Coli Adenylosuccinate Synthetase 1e-140
1cg3_A431 Structure Of The Mutant (R143l) Of Adenylosuccinate 1e-140
1cg4_A431 Structure Of The Mutant (R303l) Of Adenylosuccinate 1e-139
3hid_A432 Crystal Structure Of Adenylosuccinate Synthetase Fr 1e-139
1cg1_A431 Structure Of The Mutant (K16q) Of Adenylosuccinate 1e-139
1j4b_A457 Recombinant Mouse-Muscle Adenylosuccinate Synthetas 1e-119
1dj3_A442 Structures Of Adenylosuccinate Synthetase From Trit 1e-117
2v40_A459 Human Adenylosuccinate Synthetase Isozyme 2 In Comp 1e-117
1dj2_A443 Structures Of Adenylosuccinate Synthetase From Trit 1e-116
3r7t_A419 Crystal Structure Of Adenylosuccinate Synthetase Fr 1e-114
1p9b_A442 Structure Of Fully Ligated Adenylosuccinate Synthet 1e-108
2d7u_A339 Crystal Structure Of Hypothetical Adenylosuccinate 3e-65
>gi|157831578|pdb|1JUY|A Chain A, Refined Crystal Structure Of Adenylosuccinate Synthetase From Escherichia Coli Complexed With Hydantocidin 5'- Phosphate Gdp, Hpo4(2-), Mg2+, And Hadacidin Length = 431 Back     alignment and structure
 Score =  502 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 209/432 (48%), Positives = 291/432 (67%), Gaps = 5/432 (1%)

Query: 2   TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVR 61
            NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R
Sbjct: 2   NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILR 61

Query: 62  PDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGA 121
            +  SIIG+ VV+ P A + E++ L  +GI V    L ++    LIL  H  LD  RE A
Sbjct: 62  ENVTSIIGNGVVLSPAALMKEMKELEDRGIPVR-ERLLLSEACPLILDYHVALDNAREKA 120

Query: 122 LSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGEK 181
                  IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++ + 
Sbjct: 121 R--GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA 178

Query: 182 E-VLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
           E V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+V
Sbjct: 179 EAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV 238

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG
Sbjct: 239 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFG 298

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFL 359
             T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   
Sbjct: 299 ATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTT 358

Query: 360 PDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPE 419
           P  +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+
Sbjct: 359 PLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPD 418

Query: 420 RENTLIMSNPFE 431
           R  T+I+ +PF+
Sbjct: 419 RTETMILRDPFD 430


>gi|5542172|pdb|1CG0|A Chain A, Structure Of Adenylosuccinate Synthetase From E. Coli Complexed With Hadacidin, Gdp, 6-Phosphoryl-Imp, And Mg2+ Length = 431 Back     alignment and structure
gi|20150868|pdb|1KJX|A Chain A, Imp Complex Of E. Coli Adenylosuccinate Synthetase Length = 432 Back     alignment and structure
>gi|5542174|pdb|1CG3|A Chain A, Structure Of The Mutant (R143l) Of Adenylosuccinate Synthetase From E. Coli Complexed With Hadacidin, Gdp, 6- Phosphoryl-Imp, And Mg2+ Length = 431 Back     alignment and structure
>gi|5542175|pdb|1CG4|A Chain A, Structure Of The Mutant (R303l) Of Adenylosuccinate Synthetase From E. Coli Complexed With, Gdp, 6-Phosphoryl- Imp, And Mg2+ Length = 431 Back     alignment and structure
gi|238828318|pdb|3HID|A Chain A, Crystal Structure Of Adenylosuccinate Synthetase From Yersinia Pestis Co92 Length = 432 Back     alignment and structure
>gi|5542173|pdb|1CG1|A Chain A, Structure Of The Mutant (K16q) Of Adenylosuccinate Synthetase From E. Coli Complexed With Hadacidin, Gdp, 6- Phosphoryl-Imp, And Mg2+ Length = 431 Back     alignment and structure
gi|17942703|pdb|1J4B|A Chain A, Recombinant Mouse-Muscle Adenylosuccinate Synthetase Length = 457 Back     alignment and structure
>gi|7546404|pdb|1DJ3|A Chain A, Structures Of Adenylosuccinate Synthetase From Triticum Aestivum And Arabidopsis Thaliana Length = 442 Back     alignment and structure
>gi|152149548|pdb|2V40|A Chain A, Human Adenylosuccinate Synthetase Isozyme 2 In Complex With Gdp Length = 459 Back     alignment and structure
>gi|7546402|pdb|1DJ2|A Chain A, Structures Of Adenylosuccinate Synthetase From Triticum Aestivum And Arabidopsis Thaliana Length = 443 Back     alignment and structure
>gi|329666276|pdb|3R7T|A Chain A, Crystal Structure Of Adenylosuccinate Synthetase From Campylobacter Jejuni Length = 419 Back     alignment and structure
>gi|42543274|pdb|1P9B|A Chain A, Structure Of Fully Ligated Adenylosuccinate Synthetase From Plasmodium Falciparum Length = 442 Back     alignment and structure
gi|109157449|pdb|2D7U|A Chain A, Crystal Structure Of Hypothetical Adenylosuccinate Synthetase, Ph0438 From Pyrococcus Horikoshii Ot3 Length = 339 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target432 adenylosuccinate synthetase [Candidatus Liberibacter as
1p9b_A442 Adenylosuccinate synthetase; ligase; HET: IMO GDP; 2.00 1e-141
3hid_A432 Adenylosuccinate synthetase; niaid structural genomics, 1e-129
2v40_A459 Adenylosuccinate synthetase isozyme 2; ligase, purine b 1e-124
1dj2_A443 Adenylosuccinate synthetase; GDP; HET: GDP; 2.90A {Arab 1e-118
2d7u_A339 Adenylosuccinate synthetase; structural genomics, conse 4e-83
>1p9b_A Adenylosuccinate synthetase; ligase; HET: IMO GDP; 2.00A {Plasmodium falciparum} SCOP: c.37.1.10 Length = 442 Back     alignment and structure
 Score =  497 bits (1282), Expect = e-141
 Identities = 165/432 (38%), Positives = 235/432 (54%), Gaps = 11/432 (2%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
              V ++G QWGDEGKGKI+D LSE +D+  RF GG NAGHT+ VND  Y L LLP GV+
Sbjct: 14  GNVVAILGAQWGDEGKGKIIDMLSEYSDITCRFNGGANAGHTISVNDKKYALHLLPCGVL 73

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             + +S++G+ +V+   + + EIES+  + +    + L ++N A ++  IH+ +D ++E 
Sbjct: 74  YDNNISVLGNGMVIHVKSLMEEIESVGGKLL----DRLYLSNKAHILFDIHQIIDSIQET 129

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                G  IGTT+RGIGP Y  +  R  IR+  L + E+      +L+ H   L      
Sbjct: 130 KKLKEGKQIGTTKRGIGPCYSTKASRIGIRLGTLKNFENFKNMYSKLIDHLMDLYN---I 186

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E   +  L        K+   +  + S +         +L EGA   +LD D GTYP+V
Sbjct: 187 TEYDKEKELNLFYNYHIKLRDRIVDVISFMNTNLENNKKVLIEGANAAMLDIDFGTYPYV 246

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS T       G GI    L  V+GVVK+Y TRVG GPF TEL N  G +L+E G E+G
Sbjct: 247 TSSCTTVGGVFSGLGIHHKKLNLVVGVVKSYLTRVGCGPFLTELNNDVGQYLREKGHEYG 306

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMDGR----EV 356
           T T R RRCGWLD+  +     IN +  I LTKLDVL GL+E+ +CV ++        E 
Sbjct: 307 TTTKRPRRCGWLDIPMLLYVKCINSIDMINLTKLDVLSGLEEILLCVNFKNKKTGELLEK 366

Query: 357 DFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSI 416
              P +      +EPVY    GWK+  +    F +LP  A+ YI  IE+ L+ P+  + +
Sbjct: 367 GCYPVEEEISEEYEPVYEKFSGWKEDISTCNEFDELPENAKKYILAIEKYLKTPIVWIGV 426

Query: 417 GPERENTLIMSN 428
           GP R+N ++  N
Sbjct: 427 GPNRKNMIVKKN 438


>3hid_A Adenylosuccinate synthetase; niaid structural genomics, virulence associated factor, PURA, purine ribonucleotide biosynthesis, cytoplasm; 1.60A {Yersinia pestis CO92} PDB: 1kjx_A* 1kkb_A* 1kkf_A* 1ade_A 1adi_A 1cg0_A* 1ch8_A* 1cib_A* 1gim_A* 1gin_A* 1hon_A* 1hoo_A* 1hop_A* 1juy_A* 1ksz_A* 1nht_A* 1qf4_A* 1qf5_A* 1son_A* 1soo_A* ... Length = 432 Back     alignment and structure
>2v40_A Adenylosuccinate synthetase isozyme 2; ligase, purine biosynthesis, metal- binding, purine metabolism, nucleotide-binding, GDP, ADSS2, magnesium; HET: GDP; 1.9A {Homo sapiens} PDB: 1iwe_A* 1j4b_A 1lny_A* 1lon_A* 1loo_A* 1mez_A* 1mf0_A* 1mf1_A* 2dgn_A* Length = 459 Back     alignment and structure
>1dj2_A Adenylosuccinate synthetase; GDP; HET: GDP; 2.90A {Arabidopsis thaliana} SCOP: c.37.1.10 PDB: 1dj3_A* Length = 443 Back     alignment and structure
>2d7u_A Adenylosuccinate synthetase; structural genomics, conserved hypothetical protein, NPPSFA; 2.50A {Pyrococcus horikoshii OT3} Length = 339 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target432 adenylosuccinate synthetase [Candidatus Liberibacter as
3hid_A432 Adenylosuccinate synthetase; niaid structural genomics, 100.0
2v40_A459 Adenylosuccinate synthetase isozyme 2; ligase, purine b 100.0
1p9b_A442 Adenylosuccinate synthetase; ligase; HET: IMO GDP; 2.00 100.0
1dj2_A443 Adenylosuccinate synthetase; GDP, ligase; HET: GDP; 2.9 100.0
2d7u_A339 Adenylosuccinate synthetase; structural genomics, conse 100.0
>3hid_A Adenylosuccinate synthetase; niaid structural genomics, virulence associated factor, PURA, purine ribonucleotide biosynthesis, cytoplasm; 1.60A {Yersinia pestis CO92} PDB: 1kjx_A* 1kkb_A* 1kkf_A* 1ade_A 1adi_A 1cg0_A* 1ch8_A* 1cib_A* 1gim_A* 1gin_A* 1hon_A* 1hoo_A* 1hop_A* 1juy_A* 1ksz_A* 1nht_A* 1qf4_A* 1qf5_A* 1son_A* 1soo_A* ... Back     alignment and structure
Probab=100.00  E-value=0  Score=1240.30  Aligned_cols=429  Identities=48%  Similarity=0.849  Sum_probs=418.4

Q ss_pred             CC-EEEEEECCCCCCCHHHHHHHHCCCCCEEEEECCCCCCCCEEEECCEEEEEEECCCCEECCCCCEEECCCEEECHHHH
Q ss_conf             96-39999577586760566655315788899957768777659989899998103242035988259779389679999
Q gi|254780613|r    1 MT-NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAF   79 (432)
Q Consensus         1 M~-~~vVvG~qwGDEGKGkivd~La~~~d~vvR~~GG~NAGHTVv~~~~~~~~hllPSG~~~p~~~~~ig~GvVidp~~L   79 (432)
                      |+ ++||||+|||||||||||||||+++|+|||||||+||||||+++++||+|||||||+|+|+++|+||+||||||.+|
T Consensus         1 m~k~ivVvG~qwGDEGKGkivD~La~~~d~VvR~~GG~NAGHTVv~~g~k~~lhllPSGil~~~~~~vIG~GvVidp~~L   80 (432)
T 3hid_A            1 MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVISIIGNGVVLAPDAL   80 (432)
T ss_dssp             CCCCEEEEESSSSCSCHHHHHHHHHTTCSEEEECSBCSCCCEEEEETTEEEEESSSCTTTTSTTCEEEECTTBCBCHHHH
T ss_pred             CCCCEEEECCCCCCCCCCHHHHHHHCCCCEEEEECCCCCCCCEEEECCEEEEEECCCCEEECCCCCEEECCCEEECHHHH
T ss_conf             99729997687466772076664506799999967877888689989999999517717605997279889789869999


Q ss_pred             HHHHHHHHHCCCCCCHHHEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             99999999828988811104403320137000787599887620134656763101356777666545677887509899
Q gi|254780613|r   80 ISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEH  159 (432)
Q Consensus        80 ~~Ei~~l~~~Gv~~~~~rL~Is~ra~ii~P~H~~~D~~~E~~rg~~~~~iGTTgrGIGpaY~Dk~~R~giR~~DL~~~~~  159 (432)
                      ++|++.|+++|++. .+||+||+|||||||||+++|+++|++|++  ++||||||||||||+||++|.|||++||++++.
T Consensus        81 ~~Ei~~L~~~gi~~-~~rL~Is~rahli~P~H~~lD~~~E~~rg~--~~iGTTgrGIGpaY~DK~~R~gir~~DL~~~~~  157 (432)
T 3hid_A           81 MKEMTELEARGVPV-RERLLLSEACPLILPYHVALDNAREKARGA--KAIGTTGRGIGPAYEDKVARRGLRVSDLFNKET  157 (432)
T ss_dssp             HHHHHHHHHTTCCH-HHHEEECTTCBBCCHHHHHHHHHHHHTCC----------TTHHHHHHHHHHTCSCBGGGGGSHHH
T ss_pred             HHHHHHHHHCCCCC-CCCEEEECCCCCCCCHHHHHHHHHHHHCCC--CCCCCCCCCHHHHHHHHHCCCCCEEECCCCHHH
T ss_conf             99999998669997-346787064252573677766999997089--754778876178786452278867730216088


Q ss_pred             HHHHHHHHHHHHHHHHH-HCCCCCCCHHHHHHHHHHHHHHHHCCEEEHHHHHHHHHHHCCEEEEECCCCCEEECCCCCCC
Q ss_conf             99999999999888875-23876578899999988888743010202499999884007879998665310101368775
Q gi|254780613|r  160 ISKKIEQLLLHHNALRR-SFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYP  238 (432)
Q Consensus       160 l~~kl~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~~v~d~~~~l~~a~~~g~~ILfEGAQG~lLDid~GtYP  238 (432)
                      |++|++.++.+++.+++ .++..+.+.+++.+++..+.++++|+++|+..+|+++++++++||||||||+|||+||||||
T Consensus       158 ~~~kl~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~l~~~v~dt~~~l~~a~~~gk~vLfEGAQG~lLDid~GtYP  237 (432)
T 3hid_A          158 FAIKLKEIVEYHNFQLVHYYKEAAVDYQKVLDDVLAIADILTAMVVDVSELLDNARKQGELIMFEGAQGTLLDIDHGTYP  237 (432)
T ss_dssp             HHHHHHHHHHHHHHHHHHTSCCCCCCHHHHHHHHHHHHHHHHTTBCCHHHHHHHHHHTTCCEEEECCSCGGGCTTTSSTT
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHHCCCEEEEEECCHHEECCCCCCCC
T ss_conf             99999888999999998603557789999999999998641770433899999998579979999174311555778588


Q ss_pred             CCCCCCCCCCCHHHHHCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             33433574310134215587887649999960423237842213566842225343078877864556766654779988
Q gi|254780613|r  239 FVTSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVR  318 (432)
Q Consensus       239 ~VTSS~T~~~~a~~g~Gi~p~~i~~viGV~KAY~TRVG~GPFPTEl~~~~~~~lr~~g~E~GttTgR~RR~GWlDlv~lk  318 (432)
                      |||||||+++++++|+|++|+.+++|+||+|||+||||+||||||++++.+++||+.|+||||||||||||||||+|++|
T Consensus       238 ~VTSS~tt~~ga~~g~Gi~p~~i~~viGV~KAY~TRVG~GPfpTEl~de~g~~lre~G~E~GttTGRpRR~GWlD~v~lr  317 (432)
T 3hid_A          238 YVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYGATTGRSRRTGWLDIVAVR  317 (432)
T ss_dssp             SCCSSCCSGGGHHHHHCCCGGGCCEEEEEEESEEEECSSSCCTTBCCSHHHHHHHHHTTCCCSSTTCCCEEEEEEHHHHH
T ss_pred             CCCCCCCCHHHHHHCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCEECCCCCHHHHH
T ss_conf             73766751545654069982312079999860223316888887667427789988347788766883314642178888


Q ss_pred             HHHHHCCCCCCEECCCCCCCCCCCCEEEEEEEE-CCEEEECCCCCHHHHCCCEEEEEECCCCCCCHHCCCCHHHHHHHHH
Q ss_conf             999874874000010022135776213523631-8878503899935761577799887788865111669888549999
Q gi|254780613|r  319 RSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQAR  397 (432)
Q Consensus       319 ya~~ing~~~l~lTKlDvL~~~~~ikvC~~Y~~-~g~~~~~~P~~~~~~~~~~PvY~~~~GW~~~~~~~~~~~~LP~~a~  397 (432)
                      ||+++||+|+||||||||||+|++||||++|++ ||++++.||.+...+++|+|||++||||+++++++++|++||+|||
T Consensus       318 ya~~inG~~~lalTklDvL~~~~~ikic~~Y~~~dG~~~~~~P~~~~~l~~~~PvYe~~~GW~~~~~~~~~~~~LP~~a~  397 (432)
T 3hid_A          318 RAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREVDTTPLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAAL  397 (432)
T ss_dssp             HHHHHHTCCEEEEECGGGGTTCSEEEEEEEEECTTSCEESSCCCTTTCSTTCEEEEEEEECCSSCSTTCCSGGGSCHHHH
T ss_pred             HHHHHCCCCEEEEEEEHHHCCCCCCCCCCCEECCCCCEECCCCCCHHHHCCCEEEEEECCCCCCCHHCCCCHHHCCHHHH
T ss_conf             87864476538986022323476301021303589866145996957763776899987899882113777578459999


Q ss_pred             HHHHHHHHHHCCCEEEEEECCCCCEEEEECCCCCC
Q ss_conf             99999999978957999756985317980586789
Q gi|254780613|r  398 NYIRKIEEVLEVPVALLSIGPERENTLIMSNPFED  432 (432)
Q Consensus       398 ~yi~~IE~~~gvpI~~Is~GP~R~~~I~~~~~f~~  432 (432)
                      +||++||+++||||+|||+||+|+|||+++||||-
T Consensus       398 ~yi~~iE~~~gvpV~~is~GP~R~~~I~~~~~f~~  432 (432)
T 3hid_A          398 NYIQRVEELTGVPIDIISTGPDRDETMILRDPFDA  432 (432)
T ss_dssp             HHHHHHHHHHSCCEEEEECSSBTTSEEESSCTTCC
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCHHEEEECCCCCC
T ss_conf             99999999989998999738982315982178789



>2v40_A Adenylosuccinate synthetase isozyme 2; ligase, purine biosynthesis, metal- binding, purine metabolism, nucleotide-binding, GDP, ADSS2, magnesium; HET: GDP; 1.9A {Homo sapiens} PDB: 1iwe_A* 1j4b_A 1lny_A* 1lon_A* 1loo_A* 1mez_A* 1mf0_A* 1mf1_A* 2dgn_A* Back     alignment and structure
>1p9b_A Adenylosuccinate synthetase; ligase; HET: IMO GDP; 2.00A {Plasmodium falciparum} SCOP: c.37.1.10 Back     alignment and structure
>1dj2_A Adenylosuccinate synthetase; GDP, ligase; HET: GDP; 2.90A {Arabidopsis thaliana} SCOP: c.37.1.10 PDB: 1dj3_A* Back     alignment and structure
>2d7u_A Adenylosuccinate synthetase; structural genomics, conserved hypothetical protein, NPPSFA; 2.50A {Pyrococcus horikoshii OT3} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 432 adenylosuccinate synthetase [Candidatus Liberibacter as
d1qf5a_431 c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Esche 1e-127
d1iwea_430 c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Mouse 1e-120
d1p9ba_424 c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Malar 1e-120
d1dj2a_429 c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Mouse 1e-115
>d1qf5a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli [TaxId: 562]} Length = 431 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Adenylosuccinate synthetase, PurA
species: Escherichia coli [TaxId: 562]
 Score =  449 bits (1155), Expect = e-127
 Identities = 208/431 (48%), Positives = 288/431 (66%), Gaps = 5/431 (1%)

Query: 3   NVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRP 62
           NVVV+G QWGDEGKGKIVD L+E A  +VR+QGG+NAGHTL +N     L L+PSG++R 
Sbjct: 3   NVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRE 62

Query: 63  DKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGAL 122
           +  SIIG+ VV+ P A + E++ L  +GI V    L       LIL  H  LD  RE A 
Sbjct: 63  NVTSIIGNGVVLSPAALMKEMKELEDRGIPVRERLLLSEACP-LILDYHVALDNAREKAR 121

Query: 123 SPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSF-GEK 181
                 IGTT RGIGPAYED+V RR +RV DL D E  ++K+++++ +HN    ++   +
Sbjct: 122 G--AKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAE 179

Query: 182 EVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVT 241
            V Y+ +L++ M   + +   +  +  LL++  ++G  ++FEGAQG LLD DHGTYP+VT
Sbjct: 180 AVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVT 239

Query: 242 SSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGT 301
           SSNT +   + GSG+ P  + YVLG++KAY+TRVG GPFPTEL ++TG+FL + G EFG 
Sbjct: 240 SSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGA 299

Query: 302 VTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFLP 360
            T R+RR GWLD  +VRR+V +N + G  LTKLDVLDGL E+K+CV YRM DGREV   P
Sbjct: 300 TTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTP 359

Query: 361 DDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSIGPER 420
             +      EP+Y  + GW +ST G++  + LP  A NYI++IEE+  VP+ ++S GP+R
Sbjct: 360 LAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDR 419

Query: 421 ENTLIMSNPFE 431
             T+I+ +PF+
Sbjct: 420 TETMILRDPFD 430


>d1iwea_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Mouse (Mus musculus) [TaxId: 10090]} Length = 430 Back     information, alignment and structure
>d1p9ba_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 424 Back     information, alignment and structure
>d1dj2a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 429 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target432 adenylosuccinate synthetase [Candidatus Liberibacter as
d1qf5a_431 Adenylosuccinate synthetase, PurA {Escherichia coli [Ta 100.0
d1iwea_430 Adenylosuccinate synthetase, PurA {Mouse (Mus musculus) 100.0
d1p9ba_424 Adenylosuccinate synthetase, PurA {Malaria parasite (Pl 100.0
d1dj2a_429 Adenylosuccinate synthetase, PurA {Mouse-ear cress (Ara 100.0
>d1qf5a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Adenylosuccinate synthetase, PurA
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=1235.06  Aligned_cols=428  Identities=49%  Similarity=0.832  Sum_probs=417.9

Q ss_pred             CEEEEEECCCCCCCHHHHHHHHCCCCCEEEEECCCCCCCCEEEECCEEEEEEECCCCEECCCCCEEECCCEEECHHHHHH
Q ss_conf             63999957758676056665531578889995776877765998989999810324203598825977938967999999
Q gi|254780613|r    2 TNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFIS   81 (432)
Q Consensus         2 ~~~vVvG~qwGDEGKGkivd~La~~~d~vvR~~GG~NAGHTVv~~~~~~~~hllPSG~~~p~~~~~ig~GvVidp~~L~~   81 (432)
                      .++||+|+|||||||||||||||+++|+|||||||+||||||+++++||+|||||||+|+|+++++||+||||||.+|++
T Consensus         2 ~~vvVvG~qwGDEGKGkivD~La~~~d~VvR~~GG~NAGHTVv~~g~~~~lhllPSGil~~~~~~vIG~GvVvdp~~L~~   81 (431)
T d1qf5a_           2 NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMK   81 (431)
T ss_dssp             CEEEEEESSSSCSSHHHHHHHHGGGCSEEEECSCCTTCCEEEEETTEEEEESSSCTTTTCTTCEEEECTTSCBCHHHHHH
T ss_pred             CEEEEECCCCCCCCCCHHHHHHHCCCCEEEEECCCCCCCCEEEECCEEEEEECCCCEECCCCCEEEECCCEEECHHHHHH
T ss_conf             86999757746677207777561679999994786787858998999999953772662699708988978985999999


Q ss_pred             HHHHHHHCCCCCCHHHEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHH
Q ss_conf             99999982898881110440332013700078759988762013465676310135677766654567788750989999
Q gi|254780613|r   82 EIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHIS  161 (432)
Q Consensus        82 Ei~~l~~~Gv~~~~~rL~Is~ra~ii~P~H~~~D~~~E~~rg~~~~~iGTTgrGIGpaY~Dk~~R~giR~~DL~~~~~l~  161 (432)
                      |++.|+++|++. .+||+||+|||||+|||+++|+++|++|++  ++||||||||||||+||++|+|||++||++++.|+
T Consensus        82 Ei~~L~~~Gi~~-~~rL~IS~rAhli~P~H~~~D~~~E~~rg~--~~iGTTgrGIGPaY~DK~~R~gir~~DL~~~~~l~  158 (431)
T d1qf5a_          82 EMKELEDRGIPV-RERLLLSEACPLILDYHVALDNAREKARGA--KAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFA  158 (431)
T ss_dssp             HHHHHHTTTCCH-HHHEEECTTCBBCCHHHHHHHHHHHHHHGG--GCCCCCSSSHHHHHHHHHTTCCCBGGGGGCHHHHH
T ss_pred             HHHHHHHCCCCC-HHHCCCCCCCCEECCHHHHHHHHHHHHCCC--CCCCCCCCCCCHHHHHHHHCCCCCHHHCCCHHHHH
T ss_conf             999999749972-320166676645351799999999986489--62377887601888856521565000101778899


Q ss_pred             HHHHHHHHHHHHHH-HHCCCCCCCHHHHHHHHHHHHHHHHCCEEEHHHHHHHHHHHCCEEEEECCCCCEEECCCCCCCCC
Q ss_conf             99999999988887-52387657889999998888874301020249999988400787999866531010136877533
Q gi|254780613|r  162 KKIEQLLLHHNALR-RSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV  240 (432)
Q Consensus       162 ~kl~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~l~~~v~d~~~~l~~a~~~g~~ILfEGAQG~lLDid~GtYP~V  240 (432)
                      +|++.++.+++.++ +.+...+.+.+++.+++.++.++++++++|+..+|++++++|++||||||||+|||+||||||||
T Consensus       159 ~kl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~dt~~~l~~a~~~gk~iLfEGAQG~lLDid~GtYP~V  238 (431)
T d1qf5a_         159 EKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYV  238 (431)
T ss_dssp             HHHHHHHHHHHHHHHTTTCCCCCCHHHHHHHHHTTHHHHHHTBCCHHHHHHHHHHHTCCEEEECCSCGGGCTTTSSTTSS
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCEEEEECCHHHHHHCCCCCCCCC
T ss_conf             98899998644544302576553256778899999998434200289999999854977998421022110137845432


Q ss_pred             CCCCCCCCCHHHHHCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             43357431013421558788764999996042323784221356684222534307887786455676665477998899
Q gi|254780613|r  241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRS  320 (432)
Q Consensus       241 TSS~T~~~~a~~g~Gi~p~~i~~viGV~KAY~TRVG~GPFPTEl~~~~~~~lr~~g~E~GttTgR~RR~GWlDlv~lkya  320 (432)
                      |||||+++++++|+|++|+.+++|+||+|||+||||+||||||++++.+++||+.|+||||||||||||||||+|++|||
T Consensus       239 TSSntt~~~a~~g~Gi~p~~i~~viGV~KAY~TRVG~GPfPTEl~~~~g~~l~~~g~E~GttTGRpRR~GWlD~v~lrya  318 (431)
T d1qf5a_         239 TSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRA  318 (431)
T ss_dssp             CSSCCSTHHHHHTTCCCGGGCCEEEEEEESSEEECSSSCCTTBCCSHHHHHHHHHHTCBCTTTCCBCEEECEEHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             55665202212026888343435999987500013786588655660777766414778864034105772357888888


Q ss_pred             HHHCCCCCCEECCCCCCCCCCCCEEEEEEEE-CCEEEECCCCCHHHHCCCEEEEEECCCCCCCHHCCCCHHHHHHHHHHH
Q ss_conf             9874874000010022135776213523631-887850389993576157779988778886511166988854999999
Q gi|254780613|r  321 VIINGVKGIALTKLDVLDGLDELKICVGYRM-DGREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNY  399 (432)
Q Consensus       321 ~~ing~~~l~lTKlDvL~~~~~ikvC~~Y~~-~g~~~~~~P~~~~~~~~~~PvY~~~~GW~~~~~~~~~~~~LP~~a~~y  399 (432)
                      +++||+|+||||||||||+|++||||++|++ +|++++.||++...+++++|||++||||+++++++++|++||+|||+|
T Consensus       319 ~~ing~~~lalTklDvL~~~~~ikvc~~Y~~~~G~~~~~~P~~~~~l~~~~PvY~~~~GW~~~~~~~~~~~~LP~~a~~y  398 (431)
T d1qf5a_         319 VQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNY  398 (431)
T ss_dssp             HHHHTCCEEEEECGGGGTTCSEEEEECEEECTTSCEESSCCSSGGGTTTCEEECCEEECCCSCCTTCCSGGGSCHHHHHH
T ss_pred             HHHCCCCCEEEEEEEECCCCCCCCCCCCEECCCCCEEECCCCCHHHHHCCEEEEEECCCCCCCCCCCCCHHHCCHHHHHH
T ss_conf             87525650478731013666753312312237985650388795677077588998689988100687457858999999


Q ss_pred             HHHHHHHHCCCEEEEEECCCCCEEEEECCCCCC
Q ss_conf             999999978957999756985317980586789
Q gi|254780613|r  400 IRKIEEVLEVPVALLSIGPERENTLIMSNPFED  432 (432)
Q Consensus       400 i~~IE~~~gvpI~~Is~GP~R~~~I~~~~~f~~  432 (432)
                      |++||+++||||++||+||+|+|||+++|||+-
T Consensus       399 i~~iE~~~gvpi~~is~GP~R~~tI~~~~~f~~  431 (431)
T d1qf5a_         399 IKRIEELTGVPIDIISTGPDRTETMILRDPFDA  431 (431)
T ss_dssp             HHHHHHHHSSCEEEEECSSBTTSEEESSCTTTC
T ss_pred             HHHHHHHHCCCEEEEEECCCHHHEEEECCCCCC
T ss_conf             999999989998999868880235862078789



>d1iwea_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ba_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1dj2a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 432 adenylosuccinate synthetase [Candidatus Liberibact
1p9b_A_442 (A:) Adenylosuccinate synthetase; ligase; HET: IMO 1e-153
2v40_A_459 (A:) Adenylosuccinate synthetase isozyme 2; ligase 1e-149
1dj2_A_443 (A:) Adenylosuccinate synthetase; GDP; HET: GDP; 2 1e-148
2d7u_A_339 (A:) Adenylosuccinate synthetase; structural genom 1e-109
3hid_A_1-71_217-432287 (A:1-71,A:217-432) Adenylosuccinate synthetase; ni 3e-84
3hid_A_1-71_217-432287 (A:1-71,A:217-432) Adenylosuccinate synthetase; ni 2e-27
3hid_A_72-203132 (A:72-203) Adenylosuccinate synthetase; niaid stru 7e-32
>1p9b_A (A:) Adenylosuccinate synthetase; ligase; HET: IMO GDP; 2.00A {Plasmodium falciparum}Length = 442 Back     alignment and structure
 Score =  534 bits (1377), Expect = e-153
 Identities = 165/436 (37%), Positives = 236/436 (54%), Gaps = 11/436 (2%)

Query: 1   MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVV 60
              V ++G QWGDEGKGKI+D LSE +D+  RF GG NAGHT+ VND  Y L LLP GV+
Sbjct: 14  GNVVAILGAQWGDEGKGKIIDMLSEYSDITCRFNGGANAGHTISVNDKKYALHLLPCGVL 73

Query: 61  RPDKMSIIGSSVVVDPHAFISEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREG 120
             + +S++G+ +V+   + + EIES+  + +      L ++N A ++  IH+ +D ++E 
Sbjct: 74  YDNNISVLGNGMVIHVKSLMEEIESVGGKLLD----RLYLSNKAHILFDIHQIIDSIQET 129

Query: 121 ALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHISKKIEQLLLHHNALRRSFGE 180
                G  IGTT+RGIGP Y  +  R  IR+  L + E+      +L+ H   L   +  
Sbjct: 130 KKLKEGKQIGTTKRGIGPCYSTKASRIGIRLGTLKNFENFKNMYSKLIDHLMDL---YNI 186

Query: 181 KEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV 240
            E   +  L        K+   +  + S +         +L EGA   +LD D GTYP+V
Sbjct: 187 TEYDKEKELNLFYNYHIKLRDRIVDVISFMNTNLENNKKVLIEGANAAMLDIDFGTYPYV 246

Query: 241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFG 300
           TSS T       G GI    L  V+GVVK+Y TRVG GPF TEL N  G +L+E G E+G
Sbjct: 247 TSSCTTVGGVFSGLGIHHKKLNLVVGVVKSYLTRVGCGPFLTELNNDVGQYLREKGHEYG 306

Query: 301 TVTNRQRRCGWLDLASVRRSVIINGVKGIALTKLDVLDGLDELKICVGYRMD----GREV 356
           T T R RRCGWLD+  +     IN +  I LTKLDVL GL+E+ +CV ++        E 
Sbjct: 307 TTTKRPRRCGWLDIPMLLYVKCINSIDMINLTKLDVLSGLEEILLCVNFKNKKTGELLEK 366

Query: 357 DFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQARNYIRKIEEVLEVPVALLSI 416
              P +      +EPVY    GWK+  +    F +LP  A+ YI  IE+ L+ P+  + +
Sbjct: 367 GCYPVEEEISEEYEPVYEKFSGWKEDISTCNEFDELPENAKKYILAIEKYLKTPIVWIGV 426

Query: 417 GPERENTLIMSNPFED 432
           GP R+N ++  N   +
Sbjct: 427 GPNRKNMIVKKNFNLN 442


>2v40_A (A:) Adenylosuccinate synthetase isozyme 2; ligase, purine biosynthesis, metal- binding, purine metabolism, nucleotide-binding, GDP, ADSS2, magnesium; HET: GDP; 1.9A {Homo sapiens} PDB: 1iwe_A* 1j4b_A 1lny_A* 1lon_A* 1loo_A* 1mez_A* 1mf0_A* 1mf1_A* 2dgn_A*Length = 459 Back     alignment and structure
>1dj2_A (A:) Adenylosuccinate synthetase; GDP; HET: GDP; 2.90A {Arabidopsis thaliana}Length = 443 Back     alignment and structure
>2d7u_A (A:) Adenylosuccinate synthetase; structural genomics, conserved hypothetical protein, NPPSFA; 2.50A {Pyrococcus horikoshii OT3}Length = 339 Back     alignment and structure
>3hid_A (A:1-71,A:217-432) Adenylosuccinate synthetase; niaid structural genomics, virulence associated factor, PURA, purine ribonucleotide biosynthesis, cytoplasm; 1.60A {Yersinia pestis CO92} PDB: 1kjx_A* 1kkb_A* 1kkf_A* 1ade_A 1adi_A 1cg0_A* 1ch8_A* 1cib_A* 1gim_A* 1gin_A* 1hon_A* 1hoo_A* 1hop_A* 1juy_A* 1ksz_A* 1nht_A* 1qf4_A* 1qf5_A* 1son_A* 1soo_A* ...Length = 287 Back     alignment and structure
>3hid_A (A:1-71,A:217-432) Adenylosuccinate synthetase; niaid structural genomics, virulence associated factor, PURA, purine ribonucleotide biosynthesis, cytoplasm; 1.60A {Yersinia pestis CO92} PDB: 1kjx_A* 1kkb_A* 1kkf_A* 1ade_A 1adi_A 1cg0_A* 1ch8_A* 1cib_A* 1gim_A* 1gin_A* 1hon_A* 1hoo_A* 1hop_A* 1juy_A* 1ksz_A* 1nht_A* 1qf4_A* 1qf5_A* 1son_A* 1soo_A* ...Length = 287 Back     alignment and structure
>3hid_A (A:72-203) Adenylosuccinate synthetase; niaid structural genomics, virulence associated factor, PURA, purine ribonucleotide biosynthesis, cytoplasm; 1.60A {Yersinia pestis CO92} PDB: 1kjx_A* 1kkb_A* 1kkf_A* 1ade_A 1adi_A 1cg0_A* 1ch8_A* 1cib_A* 1gim_A* 1gin_A* 1hon_A* 1hoo_A* 1hop_A* 1juy_A* 1ksz_A* 1nht_A* 1qf4_A* 1qf5_A* 1son_A* 1soo_A* ...Length = 132 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target432 adenylosuccinate synthetase [Candidatus Liberibacter as
1p9b_A_442 Adenylosuccinate synthetase; ligase; HET: IMO GDP; 100.0
1dj2_A_443 Adenylosuccinate synthetase; GDP; HET: GDP; 2.90A 100.0
2v40_A_459 Adenylosuccinate synthetase isozyme 2; ligase, pur 100.0
2d7u_A_339 Adenylosuccinate synthetase; structural genomics, 100.0
3hid_A_1-71_217-432287 Adenylosuccinate synthetase; niaid structural geno 100.0
3hid_A_72-203132 Adenylosuccinate synthetase; niaid structural geno 100.0
>1p9b_A (A:) Adenylosuccinate synthetase; ligase; HET: IMO GDP; 2.00A {Plasmodium falciparum} Back     alignment and structure
Probab=100.00  E-value=0  Score=1210.21  Aligned_cols=425  Identities=39%  Similarity=0.663  Sum_probs=416.2

Q ss_pred             CCEEEEEECCCCCCCHHHHHHHHCCCCCEEEEECCCCCCCCEEEECCEEEEEEECCCCEECCCCCEEECCCEEECHHHHH
Q ss_conf             96399995775867605666553157888999577687776599898999981032420359882597793896799999
Q gi|254780613|r    1 MTNVVVVGLQWGDEGKGKIVDWLSENADVIVRFQGGNNAGHTLKVNDIVYKLSLLPSGVVRPDKMSIIGSSVVVDPHAFI   80 (432)
Q Consensus         1 M~~~vVvG~qwGDEGKGkivd~La~~~d~vvR~~GG~NAGHTVv~~~~~~~~hllPSG~~~p~~~~~ig~GvVidp~~L~   80 (432)
                      |++++|||+|||||||||||||||+++|+|||||||+||||||++++++|+|||+|||+|+|+++++||+|||+||.+|+
T Consensus        14 m~~~vVvG~qwGDEGKGkivD~La~~~d~VvR~nGG~NAGHTVv~~g~k~~lhliPSG~l~~~~~~vig~GvVidp~~l~   93 (442)
T 1p9b_A           14 GNVVAILGAQWGDEGKGKIIDMLSEYSDITCRFNGGANAGHTISVNDKKYALHLLPCGVLYDNNISVLGNGMVIHVKSLM   93 (442)
T ss_dssp             CCEEEEEESSSSCSSHHHHHHHHGGGCSEEEECSCCTTCCEEEEETTEEEEESSSCTTTTSTTCEEEECTTCEECHHHHH
T ss_pred             CCEEEEECCCCCCCCCCHHHHHHHCCCCEEEEECCCCCCCEEEEECCEEEEEECCCCEECCCCCEEEECCCEEEEHHHHH
T ss_conf             88899986774667731655425057999999468678760899899899995048576059972898898898099999


Q ss_pred             HHHHHHHHCCCCCCHHHEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             99999998289888111044033201370007875998876201346567631013567776665456778875098999
Q gi|254780613|r   81 SEIESLAHQGICVTPNNLRIANNASLILSIHRDLDMLREGALSPCGAHIGTTQRGIGPAYEDRVGRRAIRVMDLTDVEHI  160 (432)
Q Consensus        81 ~Ei~~l~~~Gv~~~~~rL~Is~ra~ii~P~H~~~D~~~E~~rg~~~~~iGTTgrGIGpaY~Dk~~R~giR~~DL~~~~~l  160 (432)
                      +||++|++.|+    +||+||+|||||+|||+++|+++|++|+++.++||||||||||||+||++|.|||++||++++.|
T Consensus        94 ~Ei~~L~~~g~----~rl~Is~ra~ii~p~H~~lD~~~E~~r~~g~~~iGTTg~GIGpay~dk~~R~gir~~DL~~~~~l  169 (442)
T 1p9b_A           94 EEIESVGGKLL----DRLYLSNKAHILFDIHQIIDSIQETKKLKEGKQIGTTKRGIGPCYSTKASRIGIRLGTLKNFENF  169 (442)
T ss_dssp             HHHHHHCTTGG----GGEEEETTSEECCHHHHHHHHHHHHHHHHTTCCCCCCSSSHHHHHHHHHTTCCCBGGGGGSHHHH
T ss_pred             HHHHHHCCCCC----CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCHHHH
T ss_conf             99998505688----87688698656785788766777654114776556688878698897654014412211586789


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCEEEHHHHHHHHHHHCCEEEEECCCCCEEECCCCCCCCC
Q ss_conf             99999999998888752387657889999998888874301020249999988400787999866531010136877533
Q gi|254780613|r  161 SKKIEQLLLHHNALRRSFGEKEVLYKTILEELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFV  240 (432)
Q Consensus       161 ~~kl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~v~d~~~~l~~a~~~g~~ILfEGAQG~lLDid~GtYP~V  240 (432)
                      ++||+.++.+++.+   |+..++++++++++++++.++|+|||+|+..+|++++++|++||||||||+|||+||||||||
T Consensus       170 ~~kl~~~~~~~~~~---~~~~~~~~e~~~~~~~~~~~~l~~~v~D~~~~l~~al~~gk~vLfEGaQG~lLDid~GtYP~V  246 (442)
T 1p9b_A          170 KNMYSKLIDHLMDL---YNITEYDKEKELNLFYNYHIKLRDRIVDVISFMNTNLENNKKVLIEGANAAMLDIDFGTYPYV  246 (442)
T ss_dssp             HHHHHHHHHHHHHH---TTCCCCCHHHHHHHHHHHHHHHGGGEECHHHHHHHHHHTTCCEEEECCSCGGGCTTTSSTTSS
T ss_pred             HHHHHHHHHHHHHH---CCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCEEEECCCEEEECCCCCCCCCC
T ss_conf             99999999877553---123311168899999877898517055689999999987994798614304760466878702


Q ss_pred             CCCCCCCCCHHHHHCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             43357431013421558788764999996042323784221356684222534307887786455676665477998899
Q gi|254780613|r  241 TSSNTMSAQASIGSGISPGSLGYVLGVVKAYTTRVGGGPFPTELKNQTGDFLKEVGKEFGTVTNRQRRCGWLDLASVRRS  320 (432)
Q Consensus       241 TSS~T~~~~a~~g~Gi~p~~i~~viGV~KAY~TRVG~GPFPTEl~~~~~~~lr~~g~E~GttTgR~RR~GWlDlv~lkya  320 (432)
                      |||||+++++++|+|++|+.+++||||+|||+||||+||||||++++.++.||+.|+|||+||||||||||||+|++|||
T Consensus       247 TSSnt~~~~~~~g~Gi~~~~i~~vigV~KAY~TRVG~GpfpTEl~~e~~~~lr~~g~E~G~tTgRpRR~GwlDlv~lrya  326 (442)
T 1p9b_A          247 TSSCTTVGGVFSGLGIHHKKLNLVVGVVKSYLTRVGCGPFLTELNNDVGQYLREKGHEYGTTTKRPRRCGWLDIPMLLYV  326 (442)
T ss_dssp             CSSCCSHHHHHHTTTCCGGGCCEEEEEEESSEEECSSSCCTTBCCSHHHHHHHHHTTCBCTTTCCBCEEECEEHHHHHHH
T ss_pred             CCCCCCHHHHHHHCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             54675153565405889864207999952054444689988767607889998618876765677765675549999998


Q ss_pred             HHHCCCCCCEECCCCCCCCCCCCEEEEEEEEC----CEEEECCCCCHHHHCCCEEEEEECCCCCCCHHCCCCHHHHHHHH
Q ss_conf             98748740000100221357762135236318----87850389993576157779988778886511166988854999
Q gi|254780613|r  321 VIINGVKGIALTKLDVLDGLDELKICVGYRMD----GREVDFLPDDSIYHTRFEPVYMILEGWKQSTAGMRVFADLPIQA  396 (432)
Q Consensus       321 ~~ing~~~l~lTKlDvL~~~~~ikvC~~Y~~~----g~~~~~~P~~~~~~~~~~PvY~~~~GW~~~~~~~~~~~~LP~~a  396 (432)
                      +++||+|+|+||||||||+|++||||++|+++    |++++.||++...+++|+|||++||||++|++++++|++||+||
T Consensus       327 ~~ing~~~lalTklDvL~~~~~ikic~~Y~~~~~~~g~~~~~~P~~~~~l~~~~pvy~~~~GW~~d~~~~~~~~~LP~~a  406 (442)
T 1p9b_A          327 KCINSIDMINLTKLDVLSGLEEILLCVNFKNKKTGELLEKGCYPVEEEISEEYEPVYEKFSGWKEDISTCNEFDELPENA  406 (442)
T ss_dssp             HHHHCCSEEEEECGGGGTTCSEEEEEEEEEETTTCCBCCTTCCCCSHHHHTTEEEEEEEEECCCSCCTTCCSGGGSCHHH
T ss_pred             HHHCCCCEEEEEEEEECCCCCCEEEEEEEEECCCCCCCCCCCCCCCHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHH
T ss_conf             86248875899967602578866898752536887530147799795886788689998379887110598857811999


Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCEEEEECCCCCC
Q ss_conf             999999999978957999756985317980586789
Q gi|254780613|r  397 RNYIRKIEEVLEVPVALLSIGPERENTLIMSNPFED  432 (432)
Q Consensus       397 ~~yi~~IE~~~gvpI~~Is~GP~R~~~I~~~~~f~~  432 (432)
                      ++||++||+++|+||++||+||+|+|||+++++|+|
T Consensus       407 ~~yi~~iE~~~g~pv~~is~GP~r~~~I~~~~~~~~  442 (442)
T 1p9b_A          407 KKYILAIEKYLKTPIVWIGVGPNRKNMIVKKNFNLN  442 (442)
T ss_dssp             HHHHHHHHHHHTCCEEEEECSSSTTCEEECC-----
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCEEEEEECCCCC
T ss_conf             999999999989998999748985427987067889



>1dj2_A (A:) Adenylosuccinate synthetase; GDP; HET: GDP; 2.90A {Arabidopsis thaliana} Back     alignment and structure
>2v40_A (A:) Adenylosuccinate synthetase isozyme 2; ligase, purine biosynthesis, metal- binding, purine metabolism, nucleotide-binding, GDP, ADSS2, magnesium; HET: GDP; 1.9A {Homo sapiens} PDB: 1iwe_A* 1j4b_A 1lny_A* 1lon_A* 1loo_A* 1mez_A* 1mf0_A* 1mf1_A* 2dgn_A* Back     alignment and structure
>2d7u_A (A:) Adenylosuccinate synthetase; structural genomics, conserved hypothetical protein, NPPSFA; 2.50A {Pyrococcus horikoshii OT3} Back     alignment and structure
>3hid_A (A:1-71,A:217-432) Adenylosuccinate synthetase; niaid structural genomics, virulence associated factor, PURA, purine ribonucleotide biosynthesis, cytoplasm; 1.60A {Yersinia pestis CO92} PDB: 1kjx_A* 1kkb_A* 1kkf_A* 1ade_A 1adi_A 1cg0_A* 1ch8_A* 1cib_A* 1gim_A* 1gin_A* 1hon_A* 1hoo_A* 1hop_A* 1juy_A* 1ksz_A* 1nht_A* 1qf4_A* 1qf5_A* 1son_A* 1soo_A* ... Back     alignment and structure
>3hid_A (A:72-203) Adenylosuccinate synthetase; niaid structural genomics, virulence associated factor, PURA, purine ribonucleotide biosynthesis, cytoplasm; 1.60A {Yersinia pestis CO92} PDB: 1kjx_A* 1kkb_A* 1kkf_A* 1ade_A 1adi_A 1cg0_A* 1ch8_A* 1cib_A* 1gim_A* 1gin_A* 1hon_A* 1hoo_A* 1hop_A* 1juy_A* 1ksz_A* 1nht_A* 1qf4_A* 1qf5_A* 1son_A* 1soo_A* ... Back     alignment and structure