254780614

254780614

F0F1 ATP synthase subunit epsilon

GeneID in NCBI database:8209614Locus tag:CLIBASIA_02505
Protein GI in NCBI database:254780614Protein Accession:YP_003065027.1
Gene range:+(660178, 660585)Protein Length:135aa
Gene description:F0F1 ATP synthase subunit epsilon
COG prediction:[C] F0F1-type ATP synthase, epsilon subunit (mitochondrial delta subunit)
KEGG prediction:atpC; F0F1 ATP synthase subunit epsilon (EC:3.6.3.14); K02114 F-type H+-transporting ATPase subunit epsilon [EC:3.6.3.14]
SEED prediction:ATP synthase epsilon chain (EC 3.6.3.14)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:F0F1-type ATP synthase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLRRRIQ
cccccEEEEEEEccccEEEccEEEEEEEEccccEEEEcccccEEEEEEccEEEEEEEccccEEEEEEcccEEEEEccEEEEEEEEEEEHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcc
cccHEEEEEEEEcHHHHHHcccEEEEEEEccccccccccccccHHEEcccccEEEEEccccEEEEEEEccEEEEccccEEEEEHHHccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcc
mslvndlhfelvspekcvfsgevqsvvlpselgdiTVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGIcdivpshctvlsetilPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLRRRIQ
MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLsclrrriq
MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLRRRIQ
*S*VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQAL***********************EQLLVDLSCLRR*I*
MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLRRRIQ
*SLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLRRRI*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLRRRIQ
MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLRRRIQ
MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLSCLRRRIQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target135 F0F1 ATP synthase subunit epsilon [Candidatus Liberibac
315121814140 F0F1 ATP synthase subunit epsilon [Candidatus Liberibac 1 1e-44
319780918135 ATP synthase F1 subunit epsilon [Mesorhizobium ciceri b 1 5e-23
15889876136 F0F1 ATP synthase subunit epsilon [Agrobacterium tumefa 1 1e-21
227823625134 F0F1 ATP synthase subunit epsilon [Sinorhizobium fredii 1 1e-21
15966786136 F0F1 ATP synthase subunit epsilon [Sinorhizobium melilo 1 2e-21
325293990136 F0F1 ATP synthase subunit epsilon [Agrobacterium sp. H1 1 3e-21
307301614134 ATP synthase F1, epsilon subunit [Sinorhizobium melilot 1 4e-21
222150024135 F0F1 ATP synthase subunit epsilon [Agrobacterium vitis 1 1e-20
190893715135 ATP synthase, epsilon subunit [Rhizobium etli CIAT 652] 1 1e-20
222087436135 ATP synthase F1, epsilon subunit [Agrobacterium radioba 1 3e-20
>gi|315121814|ref|YP_004062303.1| F0F1 ATP synthase subunit epsilon [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 140 Back     alignment and organism information
 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 107/135 (79%)

Query: 1   MSLVNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCE 60
           MSL+N  HFELVSP++C+FSGEV+SV+LPSE GD+T LVGH+ VL T+K GI+T+SLSC 
Sbjct: 1   MSLINSFHFELVSPKRCIFSGEVKSVILPSESGDMTALVGHSAVLATMKPGIITVSLSCG 60

Query: 61  EIHRYVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM 120
           + HRYVVIGG+CDI+PS CTVL+ET+  +D  CL+ LE R+DE    L +I D DQR Q+
Sbjct: 61  DAHRYVVIGGVCDIMPSRCTVLTETVFSIDQVCLKTLENRMDETRDVLGSIYDSDQRSQL 120

Query: 121 EQLLVDLSCLRRRIQ 135
           EQ LVDLS L  R++
Sbjct: 121 EQFLVDLSYLYSRVR 135


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319780918|ref|YP_004140394.1| ATP synthase F1 subunit epsilon [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 135 Back     alignment and organism information
>gi|15889876|ref|NP_355557.1| F0F1 ATP synthase subunit epsilon [Agrobacterium tumefaciens str. C58] Length = 136 Back     alignment and organism information
>gi|227823625|ref|YP_002827598.1| F0F1 ATP synthase subunit epsilon [Sinorhizobium fredii NGR234] Length = 134 Back     alignment and organism information
>gi|15966786|ref|NP_387139.1| F0F1 ATP synthase subunit epsilon [Sinorhizobium meliloti 1021] Length = 136 Back     alignment and organism information
>gi|325293990|ref|YP_004279854.1| F0F1 ATP synthase subunit epsilon [Agrobacterium sp. H13-3] Length = 136 Back     alignment and organism information
>gi|307301614|ref|ZP_07581373.1| ATP synthase F1, epsilon subunit [Sinorhizobium meliloti BL225C] Length = 134 Back     alignment and organism information
>gi|222150024|ref|YP_002550981.1| F0F1 ATP synthase subunit epsilon [Agrobacterium vitis S4] Length = 135 Back     alignment and organism information
>gi|190893715|ref|YP_001980257.1| ATP synthase, epsilon subunit [Rhizobium etli CIAT 652] Length = 135 Back     alignment and organism information
>gi|222087436|ref|YP_002545973.1| ATP synthase F1, epsilon subunit [Agrobacterium radiobacter K84] Length = 135 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target135 F0F1 ATP synthase subunit epsilon [Candidatus Liberibac
PRK14736133 PRK14736, atpC, F0F1 ATP synthase subunit epsilon; Prov 6e-22
PRK00571135 PRK00571, atpC, F0F1 ATP synthase subunit epsilon; Vali 2e-20
COG0355135 COG0355, AtpC, F0F1-type ATP synthase, epsilon subunit 5e-18
PRK13448135 PRK13448, atpC, F0F1 ATP synthase subunit epsilon; Prov 4e-17
PRK13443136 PRK13443, atpC, F0F1 ATP synthase subunit epsilon; Prov 2e-13
KOG1758159 KOG1758, KOG1758, KOG1758, Mitochondrial F1F0-ATP synth 6e-10
TIGR01216130 TIGR01216, ATP_synt_epsi, ATP synthase, F1 epsilon subu 1e-16
PRK1344988 PRK13449, atpC, F0F1 ATP synthase subunit epsilon; Prov 2e-16
PRK13446136 PRK13446, atpC, F0F1 ATP synthase subunit epsilon; Prov 3e-12
PRK1344289 PRK13442, atpC, F0F1 ATP synthase subunit epsilon; Prov 2e-10
PRK13444127 PRK13444, atpC, F0F1 ATP synthase subunit epsilon; Prov 9e-09
PRK13452145 PRK13452, atpC, F0F1 ATP synthase subunit epsilon; Prov 1e-06
PRK14735139 PRK14735, atpC, F0F1 ATP synthase subunit epsilon; Prov 1e-06
CHL00063134 CHL00063, atpE, ATP synthase CF1 epsilon subunit 1e-05
PRK01474112 PRK01474, atpC, F0F1 ATP synthase subunit epsilon; Vali 2e-05
PRK13450132 PRK13450, atpC, F0F1 ATP synthase subunit epsilon; Prov 3e-05
pfam0282380 pfam02823, ATP-synt_DE_N, ATP synthase, Delta/Epsilon c 2e-18
>gnl|CDD|173198 PRK14736, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|179070 PRK00571, atpC, F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|30704 COG0355, AtpC, F0F1-type ATP synthase, epsilon subunit (mitochondrial delta subunit) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|139579 PRK13448, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|106400 PRK13443, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|36969 KOG1758, KOG1758, KOG1758, Mitochondrial F1F0-ATP synthase, subunit delta/ATP16 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130283 TIGR01216, ATP_synt_epsi, ATP synthase, F1 epsilon subunit (delta in mitochondria) Back     alignment and domain information
>gnl|CDD|184058 PRK13449, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|184056 PRK13446, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|184055 PRK13442, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|139576 PRK13444, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|106409 PRK13452, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|173197 PRK14735, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|177003 CHL00063, atpE, ATP synthase CF1 epsilon subunit Back     alignment and domain information
>gnl|CDD|100879 PRK01474, atpC, F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information
>gnl|CDD|184059 PRK13450, atpC, F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>gnl|CDD|145793 pfam02823, ATP-synt_DE_N, ATP synthase, Delta/Epsilon chain, beta-sandwich domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 135 F0F1 ATP synthase subunit epsilon [Candidatus Liberibac
PRK13446135 atpC F0F1 ATP synthase subunit epsilon; Provisional 100.0
PRK13450132 atpC F0F1 ATP synthase subunit epsilon; Provisional 100.0
PRK13448135 atpC F0F1 ATP synthase subunit epsilon; Provisional 100.0
PRK13452145 atpC F0F1 ATP synthase subunit epsilon; Provisional 100.0
PRK00571135 atpC F0F1 ATP synthase subunit epsilon; Validated 100.0
PRK13443136 atpC F0F1 ATP synthase subunit epsilon; Provisional 100.0
CHL00063133 atpE ATP synthase CF1 epsilon subunit 100.0
PRK13445132 consensus 100.0
PRK13444127 atpC F0F1 ATP synthase subunit epsilon; Provisional 100.0
PRK01474112 atpC F0F1 ATP synthase subunit epsilon; Validated 99.98
COG0355135 AtpC F0F1-type ATP synthase, epsilon subunit (mitochond 99.98
PRK00539130 atpC F0F1 ATP synthase subunit epsilon; Validated 99.97
PRK13451101 atpC F0F1 ATP synthase subunit epsilon; Provisional 99.96
KOG1758159 consensus 99.92
TIGR03166122 alt_F1F0_F1_eps alternate F1F0 ATPase, F1 subunit epsil 99.89
PRK13447147 F0F1 ATP synthase subunit epsilon; Provisional 99.89
PRK06228130 F0F1 ATP synthase subunit epsilon; Validated 99.84
TIGR01216131 ATP_synt_epsi ATP synthase F1, epsilon subunit; InterPr 99.77
PRK1344291 atpC F0F1 ATP synthase subunit epsilon; Provisional 99.95
PRK1344988 atpC F0F1 ATP synthase subunit epsilon; Provisional 99.93
pfam0282380 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-s 99.89
pfam0040148 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alp 93.96
>PRK13446 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK13450 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK13448 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK13452 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK00571 atpC F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information
>PRK13443 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>CHL00063 atpE ATP synthase CF1 epsilon subunit Back     alignment and domain information
>PRK13445 consensus Back     alignment and domain information
>PRK13444 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK01474 atpC F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information
>COG0355 AtpC F0F1-type ATP synthase, epsilon subunit (mitochondrial delta subunit) [Energy production and conversion] Back     alignment and domain information
>PRK00539 atpC F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information
>PRK13451 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>KOG1758 consensus Back     alignment and domain information
>TIGR03166 alt_F1F0_F1_eps alternate F1F0 ATPase, F1 subunit epsilon Back     alignment and domain information
>PRK13447 F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK06228 F0F1 ATP synthase subunit epsilon; Validated Back     alignment and domain information
>TIGR01216 ATP_synt_epsi ATP synthase F1, epsilon subunit; InterPro: IPR001469 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK13442 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>PRK13449 atpC F0F1 ATP synthase subunit epsilon; Provisional Back     alignment and domain information
>pfam02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain Back     alignment and domain information
>pfam00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target135 F0F1 ATP synthase subunit epsilon [Candidatus Liberibac
1aqt_A138 Molecular Architecture Of The Rotary Motor In Atp S 9e-25
1bsh_A138 Solution Structure Of The Epsilon Subunit Of The F1 1e-24
2qe7_H135 Crystal Structure Of The F1-Atpase From The Thermoa 3e-23
2e5y_A133 Epsilon Subunit And Atp Complex Of F1f0-Atp Synthas 9e-23
2rq7_A134 Solution Structure Of The Epsilon Subunit Chimera C 3e-22
2w6i_H168 Low Resolution Structures Of Bovine Mitochondrial F 2e-15
2xnd_H131 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 5e-15
1e79_H146 Bovine F1-Atpase Inhibited By Dccd (Dicyclohexylcar 8e-15
2xok_H160 Refined Structure Of Yeast F1c10 Atpase Complex To 1e-13
3oe7_H137 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 3e-13
2hld_H138 Crystal Structure Of Yeast Mitochondrial F1-Atpase 4e-13
2rq6_A138 Solution Structure Of The Epsilon Subunit Of The F1 4e-16
>gi|157830030|pdb|1AQT|A Chain A, Epsilon Subunit Of F1f0-Atp Synthase From Escherichia Coli Length = 138 Back     alignment and structure
 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 63/128 (49%), Gaps = 1/128 (0%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
           +  H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I         
Sbjct: 2   STYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEF 61

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDL-NNICDVDQRFQMEQL 123
             + GGI ++ P + TVL++T +   +       +   +    + ++  DVD      +L
Sbjct: 62  IYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAEL 121

Query: 124 LVDLSCLR 131
              ++ LR
Sbjct: 122 AKAIAQLR 129


>gi|6729899|pdb|1BSH|A Chain A, Solution Structure Of The Epsilon Subunit Of The F1- Atpsynthase From Escherichia Coli And Orientation Of The Subunit Relative To The Beta Subunits Of The Complex Length = 138 Back     alignment and structure
>gi|158430157|pdb|2QE7|H Chain H, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 135 Back     alignment and structure
gi|152149010|pdb|2E5Y|A Chain A, Epsilon Subunit And Atp Complex Of F1f0-Atp Synthase From The Thermophilic Bacillus Ps3 Length = 133 Back     alignment and structure
>gi|283806761|pdb|2RQ7|A Chain A, Solution Structure Of The Epsilon Subunit Chimera Combining The N-Terminal Beta-Sandwich Domain From T. Elongatus Bp-1 F1 And The C-Terminal Alpha-Helical Domain From Spinach Chloroplast F1 Length = 134 Back     alignment and structure
gi|262118401|pdb|2W6I|H Chain H, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 4b. Length = 168 Back     alignment and structure
>gi|306991571|pdb|2XND|H Chain H, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 131 Back     alignment and structure
>gi|11514063|pdb|1E79|H Chain H, Bovine F1-Atpase Inhibited By Dccd (Dicyclohexylcarbodiimide) Length = 146 Back     alignment and structure
gi|307568105|pdb|2XOK|H Chain H, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 160 Back     alignment and structure
>gi|306991956|pdb|3OE7|H Chain H, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Gamma-I270t Length = 137 Back     alignment and structure
>gi|119389911|pdb|2HLD|H Chain H, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 138 Back     alignment and structure
gi|283806760|pdb|2RQ6|A Chain A, Solution Structure Of The Epsilon Subunit Of The F1-Atpase From Thermosynechococcus Elongatus Bp-1 Length = 138 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target135 F0F1 ATP synthase subunit epsilon [Candidatus Liberibac
2rq6_A138 ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPas 3e-22
2qe7_H135 ATP synthase subunit epsilon; blockage of ATP hydrolysi 1e-20
1aqt_A138 ATP synthase; hydrolase, ATPase, epsilon subunit; 2.30A 4e-20
2xok_H160 ATP synthase; hydrolase, ATP-binding, F(O), F(1), mitoc 4e-19
2w6j_H168 F1-ATPase delta subunit; ATP phosphorylase (H+ transpor 8e-19
2ck3_H146 ATP synthase delta chain; ATP phosphorylase, ATP phosph 9e-19
2e5y_A133 ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPas 2e-18
2hld_H138 ATP synthase delta chain, mitochondrial; ATP phosphoryl 4e-17
3oee_H138 ATP synthase subunit delta; ATP phosphatase, F1F0 ATPas 4e-17
>2rq6_A ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, ATP synthesis, CF1, hydrogen ION transport, hydrolase; NMR {Thermosynechococcus elongatus} PDB: 2rq7_A Length = 138 Back     alignment and structure
 Score = 99.1 bits (247), Expect = 3e-22
 Identities = 27/129 (20%), Positives = 57/129 (44%), Gaps = 1/129 (0%)

Query: 7   LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66
           +   +++P+K V+    + V+LPS  G + +L  HAP+LT +++G++ +    E +    
Sbjct: 3   MTVRVIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVA-IA 61

Query: 67  VIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVD 126
           ++GG  ++  +  T+L       D   L+  +       + L      + +    Q    
Sbjct: 62  LMGGFAEVENNEVTILVNGAERGDTIDLEKAKAEFAAAQAALAQAEQGESKQAKIQATQA 121

Query: 127 LSCLRRRIQ 135
               R R+Q
Sbjct: 122 FRRARARLQ 130


>2qe7_H ATP synthase subunit epsilon; blockage of ATP hydrolysis, F1-ATPase, single particle analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} Length = 135 Back     alignment and structure
>1aqt_A ATP synthase; hydrolase, ATPase, epsilon subunit; 2.30A {Escherichia coli} SCOP: a.2.10.1 b.93.1.1 PDB: 1qo1_J 1bsh_A 1bsn_A 1fs0_E Length = 138 Back     alignment and structure
>2xok_H ATP synthase; hydrolase, ATP-binding, F(O), F(1), mitochondr inner membrane, transmembrane; HET: ANP; 3.01A {Saccharomyces cerevisiae} Length = 160 Back     alignment and structure
>2w6j_H F1-ATPase delta subunit; ATP phosphorylase (H+ transporting), transit peptide, F1FO ATP synthase, ATP phosphorylase; 3.84A {Bos taurus} PDB: 2w6h_H 2w6i_H Length = 168 Back     alignment and structure
>2ck3_H ATP synthase delta chain; ATP phosphorylase, ATP phosphorylase (H+ transporting), F1FO ATP synthase, F1-ATPase, hydrolase, ATP synthesis; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.2.10.1 b.93.1.1 PDB: 1e79_H* 1h8e_H* 2jdi_H* 2v7q_H* Length = 146 Back     alignment and structure
>2e5y_A ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, hydrolase; HET: ATP; 1.92A {Bacillus SP} PDB: 2e5t_A 2e5u_A Length = 133 Back     alignment and structure
>2hld_H ATP synthase delta chain, mitochondrial; ATP phosphorylase (H+ transporting), F1FO, F1- ATPase, hydrolase; HET: ANP; 2.80A {Saccharomyces cerevisiae} PDB: 3fks_H Length = 138 Back     alignment and structure
>3oee_H ATP synthase subunit delta; ATP phosphatase, F1F0 ATPase, ATP synthesis, H ADP, PO4, mitochondria; HET: ANP; 2.74A {Saccharomyces cerevisiae} PDB: 2wpd_H* 3fks_H 2hld_H* 3oeh_H* 3ofn_H* 3oe7_H* Length = 138 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target135 F0F1 ATP synthase subunit epsilon [Candidatus Liberibac
1aqt_A138 ATP synthase; hydrolase, ATPase, epsilon subunit; 2.30A 100.0
2rq6_A138 ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPas 99.98
2e5y_A133 ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPas 99.97
2xok_H160 ATP synthase; hydrolase, ATP-binding, F(O), F(1), mitoc 99.97
2qe7_H135 ATP synthase subunit epsilon; blockage of ATP hydrolysi 99.97
3oee_H138 ATP synthase subunit delta; ATP phosphatase, F1F0 ATPas 99.96
2ck3_H146 ATP synthase delta chain; ATP phosphorylase, ATP phosph 99.95
2w6j_H168 F1-ATPase delta subunit; ATP phosphorylase (H+ transpor 99.95
>1aqt_A ATP synthase; hydrolase, ATPase, epsilon subunit; 2.30A {Escherichia coli} SCOP: a.2.10.1 b.93.1.1 PDB: 1qo1_J 1bsh_A 1bsn_A 1fs0_E Back     alignment and structure
Probab=100.00  E-value=1.6e-32  Score=222.42  Aligned_cols=130  Identities=22%  Similarity=0.336  Sum_probs=114.1

Q ss_pred             CCEEEEEEECCCCEEECCEEEEEEEEECCCEEEECCCCCEEEEECCCCEEEEEECCCCEEEEECCCCEEEEECCEEEEEE
Q ss_conf             44026999848863752213199996057335776898002667068807996268840354226756999499699998
Q gi|254780614|r    4 VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLS   83 (135)
Q Consensus         4 ~~~~~l~ivtP~~~i~~~~v~~v~~p~~~G~~gILp~H~p~i~~L~~G~i~i~~~~~~~~~~~V~gG~~~v~~~~v~Il~   83 (135)
                      ++||+|+||||++.+|+++|++|++||.+|+|||||||+|+|+.|.||+++++..++.+..|+|+|||++|.+|.|+||+
T Consensus         1 ~~Tf~l~IvtP~~~~~~~~v~~V~~p~~~G~~gILp~H~p~it~L~~G~v~i~~~~~~~~~~~v~gG~~~v~~~~v~Ila   80 (138)
T 1aqt_A            1 GSTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLA   80 (138)
T ss_dssp             -CCEEEEEEESSCEEEEEEEEEEEEEBSSSEEEECTTCCCEEEEECSEEEEEEETTTEEEEEEESSEEEEEETTEEEEEE
T ss_pred             CCEEEEEEECCCCEEEEEEEEEEEEECCCCCEEECCCCCCCEEEECCCEEEEEECCCCEEEEEEECCEEEECCCEEEEEE
T ss_conf             95699999979964883578999997694670634897212144016779999759978999983889998199599993


Q ss_pred             ECCEEHHHCCHHHHHHHHHHHHHHHHHCCCHHHHHHH----HHHHHHHHHHHHH
Q ss_conf             1122076859999999999999996507888999999----9999999999886
Q gi|254780614|r   84 ETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQM----EQLLVDLSCLRRR  133 (135)
Q Consensus        84 ~~a~~~~~iD~~~a~~~~e~a~~~l~~~~~~~~~~~~----~~~~~~l~~~r~~  133 (135)
                      ++|++.++||.+++++.+++|+++|++..++.+..++    .+++.+++.+++.
T Consensus        81 ~~a~~~~~Id~~~~~~~~~~a~~~l~~~~~~~~~~~a~~~l~ra~~rl~~~~~~  134 (138)
T 1aqt_A           81 DTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELT  134 (138)
T ss_dssp             SSEEEGGGCCHHHHHHHHHHHHHHHTTCSSSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHEEECCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             530883549999999999999999862877399999999999999999999998



>2rq6_A ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, ATP synthesis, CF1, hydrogen ION transport, hydrolase; NMR {Thermosynechococcus elongatus} PDB: 2rq7_A Back     alignment and structure
>2e5y_A ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, hydrolase; HET: ATP; 1.92A {Bacillus SP} PDB: 2e5t_A 2e5u_A Back     alignment and structure
>2xok_H ATP synthase; hydrolase, ATP-binding, F(O), F(1), mitochondr inner membrane, transmembrane; HET: ANP; 3.01A {Saccharomyces cerevisiae} Back     alignment and structure
>2qe7_H ATP synthase subunit epsilon; blockage of ATP hydrolysis, F1-ATPase, single particle analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} Back     alignment and structure
>3oee_H ATP synthase subunit delta; ATP phosphatase, F1F0 ATPase, ATP synthesis, H ADP, PO4, mitochondria; HET: ANP; 2.74A {Saccharomyces cerevisiae} PDB: 2wpd_H* 3fks_H 2hld_H* 3oeh_H* 3ofn_H* 3oe7_H* Back     alignment and structure
>2ck3_H ATP synthase delta chain; ATP phosphorylase, ATP phosphorylase (H+ transporting), F1FO ATP synthase, F1-ATPase, hydrolase, ATP synthesis; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.2.10.1 b.93.1.1 PDB: 1e79_H* 1h8e_H* 2jdi_H* 2v7q_H* 2wss_H* 2xnd_H* Back     alignment and structure
>2w6j_H F1-ATPase delta subunit; ATP phosphorylase (H+ transporting), transit peptide, F1FO ATP synthase, ATP phosphorylase; 3.84A {Bos taurus} PDB: 2w6h_H 2w6i_H Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 135 F0F1 ATP synthase subunit epsilon [Candidatus Liberibac
d1aqta285 b.93.1.1 (A:2-86) Epsilon subunit of F1F0-ATP synthase 3e-18
d2jdih285 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthas 2e-15
>d1aqta2 b.93.1.1 (A:2-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure

class: All beta proteins
fold: Epsilon subunit of F1F0-ATP synthase N-terminal domain
superfamily: Epsilon subunit of F1F0-ATP synthase N-terminal domain
family: Epsilon subunit of F1F0-ATP synthase N-terminal domain
domain: Epsilon subunit of F1F0-ATP synthase N-terminal domain
species: Escherichia coli [TaxId: 562]
 Score = 84.4 bits (209), Expect = 3e-18
 Identities = 27/81 (33%), Positives = 47/81 (58%)

Query: 5  NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
          +  H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I         
Sbjct: 1  STYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEF 60

Query: 65 YVVIGGICDIVPSHCTVLSET 85
            + GGI ++ P + TVL++T
Sbjct: 61 IYLSGGILEVQPGNVTVLADT 81


>d2jdih2 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Length = 85 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target135 F0F1 ATP synthase subunit epsilon [Candidatus Liberibac
d1aqta285 Epsilon subunit of F1F0-ATP synthase N-terminal domain 99.92
d2jdih285 Epsilon subunit of F1F0-ATP synthase N-terminal domain 99.83
d1aqta150 Epsilon subunit of F1F0-ATP synthase C-terminal domain 92.14
>d1aqta2 b.93.1.1 (A:2-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Epsilon subunit of F1F0-ATP synthase N-terminal domain
superfamily: Epsilon subunit of F1F0-ATP synthase N-terminal domain
family: Epsilon subunit of F1F0-ATP synthase N-terminal domain
domain: Epsilon subunit of F1F0-ATP synthase N-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=99.92  E-value=3.4e-25  Score=175.19  Aligned_cols=85  Identities=32%  Similarity=0.556  Sum_probs=82.0

Q ss_pred             CEEEEEEECCCCEEECCEEEEEEEEECCCEEEECCCCCEEEEECCCCEEEEEECCCCEEEEECCCCEEEEECCEEEEEEE
Q ss_conf             40269998488637522131999960573357768980026670688079962688403542267569994996999981
Q gi|254780614|r    5 NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLSE   84 (135)
Q Consensus         5 ~~~~l~ivtP~~~i~~~~v~~v~~p~~~G~~gILp~H~p~i~~L~~G~i~i~~~~~~~~~~~V~gG~~~v~~~~v~Il~~   84 (135)
                      +||+|+|+||++.+|+++|++|++|+.+|+|||||||+|+|+.|.||+++|+.++++++.|+|+|||++|.+|+|+||++
T Consensus         1 ~Tf~l~IvtP~~~~~~~~v~~v~~~~~~G~~gIL~~H~p~i~~L~~g~v~i~~~~~~~~~~~v~gG~~~v~~n~v~Il~~   80 (85)
T d1aqta2           1 STYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLAD   80 (85)
T ss_dssp             CCEEEEEEESSCEEEEEEEEEEEEEBSSSEEEECTTCCCEEEEECSEEEEEEETTTEEEEEEESSEEEEEETTEEEEEES
T ss_pred             CEEEEEEECCCCEEEEEEEEEEEEECCCCCEEECCCCCCEEEEECCCEEEEEECCCCEEEEEECCCEEEEECCEEEEEEE
T ss_conf             95999999898669965789999977947778968983306882287799998799799999936399998999999992


Q ss_pred             CCEEH
Q ss_conf             12207
Q gi|254780614|r   85 TILPM   89 (135)
Q Consensus        85 ~a~~~   89 (135)
                      .|+..
T Consensus        81 ~A~rg   85 (85)
T d1aqta2          81 TAIRG   85 (85)
T ss_dssp             SEEEG
T ss_pred             EEECC
T ss_conf             53229



>d2jdih2 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1aqta1 a.2.10.1 (A:87-136) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 135 F0F1 ATP synthase subunit epsilon [Candidatus Libe
1aqt_A_138 (A:) ATP synthase; hydrolase, ATPase, epsilon subu 6e-23
2qe7_H_135 (H:) ATP synthase subunit epsilon; blockage of ATP 3e-22
2e5y_A_133 (A:) ATP synthase epsilon chain; F1FO ATP synthase 8e-22
2hld_H_138 (H:) ATP synthase delta chain, mitochondrial; ATP 6e-21
2rq6_A_1-8686 (A:1-86) ATP synthase epsilon chain; F1FO ATP synt 7e-19
2ck3_H_1-100100 (H:1-100) ATP synthase delta chain; ATP phosphoryl 1e-16
2w6j_H_1-123123 (H:1-123) F1-ATPase delta subunit; ATP phosphoryla 2e-16
>1aqt_A (A:) ATP synthase; hydrolase, ATPase, epsilon subunit; 2.30A {Escherichia coli}Length = 138 Back     alignment and structure
 Score =  100 bits (251), Expect = 6e-23
 Identities = 29/120 (24%), Positives = 56/120 (46%)

Query: 5   NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64
           +  H ++VS E+ +FSG V+ + +    G++ +  GHAP+LT IK G++ I         
Sbjct: 2   STYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEF 61

Query: 65  YVVIGGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL 124
             + GGI ++ P + TVL++T +   +       +   +    +++        Q    L
Sbjct: 62  IYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAEL 121


>2qe7_H (H:) ATP synthase subunit epsilon; blockage of ATP hydrolysis, F1-ATPase, single particle analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP}Length = 135 Back     alignment and structure
>2e5y_A (A:) ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, hydrolase; HET: ATP; 1.92A {Bacillus SP} PDB: 2e5t_A 2e5u_ALength = 133 Back     alignment and structure
>2hld_H (H:) ATP synthase delta chain, mitochondrial; ATP phosphorylase (H+ transporting), F1FO, F1- ATPase, hydrolase; HET: ANP; 2.80A {Saccharomyces cerevisiae} PDB: 3fks_HLength = 138 Back     alignment and structure
>2rq6_A (A:1-86) ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, ATP synthesis, CF1, hydrogen ION transport, hydrolase; NMR {Thermosynechococcus elongatus} PDB: 2rq7_ALength = 86 Back     alignment and structure
>2ck3_H (H:1-100) ATP synthase delta chain; ATP phosphorylase, ATP phosphorylase (H+ transporting), F1FO ATP synthase, F1-ATPase, hydrolase, ATP synthesis; HET: ANP ADP; 1.9A {Bos taurus}Length = 100 Back     alignment and structure
>2w6j_H (H:1-123) F1-ATPase delta subunit; ATP phosphorylase (H+ transporting), transit peptide, F1FO ATP synthase, ATP phosphorylase; 3.84A {Bos taurus} PDB: 2w6h_H 2w6i_HLength = 123 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target135 F0F1 ATP synthase subunit epsilon [Candidatus Liberibac
1aqt_A_138 ATP synthase; hydrolase, ATPase, epsilon subunit; 99.98
2e5y_A_133 ATP synthase epsilon chain; F1FO ATP synthase, F1- 99.97
2hld_H_138 ATP synthase delta chain, mitochondrial; ATP phosp 99.96
2qe7_H_135 ATP synthase subunit epsilon; blockage of ATP hydr 99.96
2rq6_A_1-8686 ATP synthase epsilon chain; F1FO ATP synthase, F1- 99.9
2w6j_H_1-123123 F1-ATPase delta subunit; ATP phosphorylase (H+ tra 99.89
2ck3_H_1-100100 ATP synthase delta chain; ATP phosphorylase, ATP p 99.88
>1aqt_A (A:) ATP synthase; hydrolase, ATPase, epsilon subunit; 2.30A {Escherichia coli} Back     alignment and structure
Probab=99.98  E-value=9.2e-31  Score=212.38  Aligned_cols=121  Identities=24%  Similarity=0.341  Sum_probs=113.3

Q ss_pred             CCEEEEEEECCCCEEECCEEEEEEEEECCCEEEECCCCCEEEEECCCCEEEEEECCCCEEEEECCCCEEEEECCEEEEEE
Q ss_conf             44026999848863752213199996057335776898002667068807996268840354226756999499699998
Q gi|254780614|r    4 VNDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVVIGGICDIVPSHCTVLS   83 (135)
Q Consensus         4 ~~~~~l~ivtP~~~i~~~~v~~v~~p~~~G~~gILp~H~p~i~~L~~G~i~i~~~~~~~~~~~V~gG~~~v~~~~v~Il~   83 (135)
                      +++|+|+|+||++.+|+++|++|++||.+|+|||||||+|+|+.|.||+++++..++.+..|+|+|||++|.+|+|+|++
T Consensus         1 a~~l~l~IvtP~~~~~~~~v~~v~~~t~~G~~gILp~H~p~it~L~~G~i~i~~~~~~~~~~~v~gG~~~v~~~~v~I~~   80 (138)
T 1aqt_A            1 GSTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLA   80 (138)
T ss_dssp             -CCEEEEEEESSCEEEEEEEEEEEEEBSSSEEEECTTCCCEEEEECSEEEEEEETTTEEEEEEESSEEEEEETTEEEEEE
T ss_pred             CCEEEEEEECCCCEEEECEEEEEEEECCCCCEEECCCCCCEEEECCCCEEEEEECCCCEEEEEEECCEEEECCCEEEEEH
T ss_conf             96599999989855882457899997694375776898240231436579999859979999984889996699599992


Q ss_pred             ECCEEHHHCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             11220768599999999999999965078889999999999
Q gi|254780614|r   84 ETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQLL  124 (135)
Q Consensus        84 ~~a~~~~~iD~~~a~~~~e~a~~~l~~~~~~~~~~~~~~~~  124 (135)
                      ++|++.++||.+++++.++++++.+++..+..++..++..+
T Consensus        81 ~~a~~~~~id~~~~~~~~~~a~~~l~~~~~~~~~~~~e~~l  121 (138)
T 1aqt_A           81 DTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAEL  121 (138)
T ss_dssp             SSEEEGGGCCHHHHHHHHHHHHHHHTTCSSSHHHHHHHHHH
T ss_pred             HHEEECCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             14075502999999999999999987087708999999999



>2e5y_A (A:) ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, hydrolase; HET: ATP; 1.92A {Bacillus SP} PDB: 2e5t_A 2e5u_A Back     alignment and structure
>2hld_H (H:) ATP synthase delta chain, mitochondrial; ATP phosphorylase (H+ transporting), F1FO, F1- ATPase, hydrolase; HET: ANP; 2.80A {Saccharomyces cerevisiae} PDB: 3fks_H Back     alignment and structure
>2qe7_H (H:) ATP synthase subunit epsilon; blockage of ATP hydrolysis, F1-ATPase, single particle analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} Back     alignment and structure
>2rq6_A (A:1-86) ATP synthase epsilon chain; F1FO ATP synthase, F1-ATPase, epsilon subunit, ATP synthesis, CF1, hydrogen ION transport, hydrolase; NMR {Thermosynechococcus elongatus} PDB: 2rq7_A Back     alignment and structure
>2w6j_H (H:1-123) F1-ATPase delta subunit; ATP phosphorylase (H+ transporting), transit peptide, F1FO ATP synthase, ATP phosphorylase; 3.84A {Bos taurus} PDB: 2w6h_H 2w6i_H Back     alignment and structure
>2ck3_H (H:1-100) ATP synthase delta chain; ATP phosphorylase, ATP phosphorylase (H+ transporting), F1FO ATP synthase, F1-ATPase, hydrolase, ATP synthesis; HET: ANP ADP; 1.9A {Bos taurus} Back     alignment and structure