254780615

254780615

F0F1 ATP synthase subunit beta

GeneID in NCBI database:8209615Locus tag:CLIBASIA_02510
Protein GI in NCBI database:254780615Protein Accession:YP_003065028.1
Gene range:+(658712, 660148)Protein Length:478aa
Gene description:F0F1 ATP synthase subunit beta
COG prediction:[C] F0F1-type ATP synthase, beta subunit
KEGG prediction:atpD; F0F1 ATP synthase subunit beta (EC:3.6.3.14); K02112 F-type H+-transporting ATPase subunit beta [EC:3.6.3.14]
SEED prediction:ATP synthase beta chain (EC 3.6.3.14)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:F0F1-type ATP synthase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MTTKAKTESVGRIQQIMGAVVDVVFVNSLPPIFSSLETSDKGSRIVFEVVQHLGEKTVRCIAMSRTDGLSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQSTDASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSMLEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERFMSQPFHVAESFTGLPGKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKAEVI
cccccccccEEEEEEEEccEEEEEEcccccccccEEEEcccccEEEEEEEEEEcccEEEEEEcccccccccccEEEEcccEEEEEccHHHHHHHHHHcccccccccccccccEEccccccccHHHHccccccHHccHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccHHHHHHHHHccEEEEEEHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHHcccccccHHHHHHHHHHHHccHHHcccHHHHHHHccHHHHHHHHHcc
ccccEEHccEEEEEEEEccEEEEEEccccccccEEEEEcccccccEEEEEEEEEccEEEEEEcccccccEcccEEEEEEEEcEEEEcHHHcccEEcccccEccccccccccEEEEcccccccHHHccccccEEccccHHHHHHccEEcccEEEEEEcccccHHHHHHHHHHHcccccccEEEEEEEcccHHHHHHHHHHHHHcccccccccccHHHHHccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccccccccHHHccccHHHHHHHHHccccccccccEEEEEEEEcHHHccccHHHHHHHHHccEEEEEcHHHHcccccccEcccccEEccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHcccccHHHHHHHHHcc
MTTKAKTESVGRIQQIMGAVVDVVFVnslppifssletsdkgsRIVFEVVQHLGEKTVRCIAMsrtdglsrgdcvidtgtqitvpvgeatLGRIMNvigepvddqgaiissekraihqpspsyteqstdasilTTGIKVIdlispyqkggkiglfggagvgKTVLIMELINNVAkahggysvfagvgertregnDLYHEMIDSkvnidprknngsavgskCSLLygqmneppgarsrvALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGripsavgyQSTLALEMGELQERITTTLKGsitsvqaiyvpaddltdpapatsfthldATTVLSRQisekgiypaidpldsnssmleidIVGQEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERfmsqpfhvaesftglpgkfvSLEETIRGFKGLvqgeydhlpeLAFYMVGSIDEAVKKAEVI
mttkaktesvgriQQIMGAVVDVVFVNSLPPIFssletsdkgsrIVFEVVQHLGEKTVRCIAMsrtdglsrgdcvidtgtqitvpvgeaTLGRIMNVIGEPVDDQGAIISSEKraihqpspsyteqstdasILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIDSkvnidprknngsAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKgiypaidpldsnSSMLEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILgmdelseeDKLVVARARKLERFMSqpfhvaesftglpgKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKAEVI
MTTKAKTESVGRIQQIMGAVVDVVFVNSLPPIFSSLETSDKGSRIVFEVVQHLGEKTVRCIAMSRTDGLSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQSTDASILTTGIKVIDLISPYQkggkiglfggagvgkTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSMLEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERFMSQPFHVAESFTGLPGKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKAEVI
*************QQIMGAVVDVVFVNSLPPIFSSLETSDKGSRIVFEVVQHLGEKTVRCIAMSRTDGLSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQSTDASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIDSKVNIDPR******VGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSMLEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERFMSQPFHVAESFTGLPGKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKA***
***********RIQQIMGAVVDVVFVNSLPPIFSSLETSDKGSRIVFEVVQHLGEKTVRCIAMSRTDGLSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKR**************DASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSMLEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERFMSQPFHVAESFTGLPGKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKAEVI
*TTKAKTESVGRIQQIMGAVVDVVFVNSLPPIFSSLETSDKGSRIVFEVVQHLGEKTVRCIAMSRTDGLSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQSTDASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSMLEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERFMSQPFHVAESFTGLPGKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKAEV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTKAKTESVGRIQQIMGAVVDVVFVNSLPPIFSSLETSDKGSRIVFEVVQHLGEKTVRCIAMSRTDGLSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQSTDASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSMLEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERFMSQPFHVAESFTGLPGKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKAEVI
MTTKAKTESVGRIQQIMGAVVDVVFVNSLPPIFSSLETSDKGSRIVFEVVQHLGEKTVRCIAMSRTDGLSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQSTDASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSMLEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERFMSQPFHVAESFTGLPGKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKAEVI
MTTKAKTESVGRIQQIMGAVVDVVFVNSLPPIFSSLETSDKGSRIVFEVVQHLGEKTVRCIAMSRTDGLSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQSTDASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSMLEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERFMSQPFHVAESFTGLPGKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKAEVI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target478 F0F1 ATP synthase subunit beta [Candidatus Liberibacter
254780684438 flagellum-specific ATP synthase [Candidatus Liberi 1e-32
254780617509 F0F1 ATP synthase subunit alpha [Candidatus Liberi 3e-21
254780810423 transcription termination factor Rho [Candidatus L 3e-06
>gi|254780684|ref|YP_003065097.1| flagellum-specific ATP synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score =  132 bits (333), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/334 (28%), Positives = 166/334 (49%), Gaps = 25/334 (7%)

Query: 69  LSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSE--KRAIHQPSPSYTEQ 126
           +S GD V   G +  +       GR++N +G+P+D   ++   +     + +  P+   Q
Sbjct: 81  ISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139

Query: 127 STDASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAG- 185
             +     TGI+VID+ +P   G +IG+F G+G+GK+ L+    +  A++     V    
Sbjct: 140 RVEKG-FKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL----SMFARSDCFDKVIISL 194

Query: 186 VGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTV 245
           VGER RE  +   + +   +              K  ++    +E P  R    LT +T+
Sbjct: 195 VGERGREVREFIEDYLGDNLK-------------KSVVVVATSDESPILRKMAPLTAVTI 241

Query: 246 AEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERI--TT 303
           AE+F  +G +VL  +D+I RF  +  EI+   G +P A GY +++  E+  L ERI  + 
Sbjct: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301

Query: 304 TLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSML 363
             KG+IT+V ++ V  D+  DP   +  + LD   VL+R ++E+G YP +DPL S S + 
Sbjct: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361

Query: 364 EIDIVGQEHYDVARRVQEILQRYKSLQDIIAILG 397
           +      E   V+  +  ++ R++  +DI  I G
Sbjct: 362 DKAWSADEKKLVS-SLTHLIHRFEETRDIRLIGG 394

>gi|254780617|ref|YP_003065030.1| F0F1 ATP synthase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Back     alignment
 Score = 94.4 bits (233), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 132/297 (44%), Gaps = 23/297 (7%)

Query: 69  LSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQST 128
           +S GD V  TG  + VPVG   LGR+++ +G P+D +G I   ++      +P   ++ +
Sbjct: 82  ISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQS 141

Query: 129 DASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGG-------YS 181
               L+TGIK ID + P  +G +  + G    GKT +I++   N   +H         Y 
Sbjct: 142 VCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYC 201

Query: 182 VFAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALT 241
           ++  +G++ R     + + ++ +  +           S   ++    ++P   +      
Sbjct: 202 IYVAIGQK-RSSVARFVKALEDRGAL-----------SYSIVVVASASDPAPMQLLAPFA 249

Query: 242 GLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQER- 300
           G  + E+FRD G   L   D++ +   A  ++S LL R P    Y   +      L ER 
Sbjct: 250 GCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERA 309

Query: 301 --ITTTL-KGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAID 354
             ++  L  GS+T++  I    +D++   P    +  D    L  ++  +GI PAI+
Sbjct: 310 AKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAIN 366

>gi|254780810|ref|YP_003065223.1| transcription termination factor Rho [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Back     alignment
 Score = 44.7 bits (104), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 94/225 (41%), Gaps = 25/225 (11%)

Query: 138 KVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAH-GGYSVFAGVGERTREGNDL 196
           +VIDLI+P  KG +  +      GKT+L+  + +++ K H   Y +   + ER  E  D+
Sbjct: 163 RVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDM 222

Query: 197 YHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHFRDQGQDV 256
                        R   G  + S         +E      +VA   +  A+   + G DV
Sbjct: 223 Q------------RSVQGEVISS-------TFDESAARHVQVAEMVIAKAKCLVEYGLDV 263

Query: 257 LFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLK--GSITSVQA 314
           +  +D+I R  +A + +    G+I    G     AL+  +        +K  GS+T +  
Sbjct: 264 VILLDSITRLCRAYNVLMPSSGKI--LTGGVDANALQRPKRFFGAARNIKEGGSLTIIGT 321

Query: 315 IYVPADDLTDPAPATSFTHL-DATTVLSRQISEKGIYPAIDPLDS 358
             V      D      F    ++  VL R+I++K I+PA+D + S
Sbjct: 322 ALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKS 366

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target478 F0F1 ATP synthase subunit beta [Candidatus Liberibacter
315121815480 F0F1 ATP synthase subunit beta [Candidatus Liberibacter 1 0.0
298293437477 ATP synthase F1 subunit beta [Starkeya novella DSM 506] 1 0.0
158425749478 F0F1 ATP synthase subunit beta [Azorhizobium caulinodan 1 0.0
170744668484 F0F1 ATP synthase subunit beta [Methylobacterium sp. 4- 1 0.0
220927118484 F0F1 ATP synthase subunit beta [Methylobacterium nodula 1 0.0
300024907477 ATP synthase F1 subunit beta [Hyphomicrobium denitrific 1 0.0
217976537483 F0F1 ATP synthase subunit beta [Methylocella silvestris 1 0.0
319404806530 ATP synthase beta chain [Bartonella rochalimae ATCC BAA 1 0.0
323137978478 ATP synthase F1, beta subunit [Methylocystis sp. ATCC 4 1 0.0
222150025485 ATP synthase F1, beta subunit [Agrobacterium vitis S4] 1 0.0
>gi|315121815|ref|YP_004062304.1| F0F1 ATP synthase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 480 Back     alignment and organism information
 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/473 (89%), Positives = 452/473 (95%)

Query: 3   TKAKTESVGRIQQIMGAVVDVVFVNSLPPIFSSLETSDKGSRIVFEVVQHLGEKTVRCIA 62
           TK++ +++G+IQQI+GAVVDVVF +SLPPI  SLET +K SRIV EVVQHLGEKTVRCIA
Sbjct: 2   TKSEAQNIGKIQQIVGAVVDVVFTDSLPPILGSLETDNKDSRIVLEVVQHLGEKTVRCIA 61

Query: 63  MSRTDGLSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPS 122
           M +TDGLSRGD +IDTG QITVPVGEATLGRIMNVIGEPVDD GAI++SE+RAIHQ +PS
Sbjct: 62  MGKTDGLSRGDSIIDTGKQITVPVGEATLGRIMNVIGEPVDDHGAILTSERRAIHQLAPS 121

Query: 123 YTEQSTDASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSV 182
           YTEQST +SILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSV
Sbjct: 122 YTEQSTGSSILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSV 181

Query: 183 FAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTG 242
           FAGVGERTREGNDLY EMI SKVN+DP  NNGSAVGSKCSL+YGQMNE PGAR+RVALTG
Sbjct: 182 FAGVGERTREGNDLYREMIGSKVNVDPSTNNGSAVGSKCSLVYGQMNESPGARARVALTG 241

Query: 243 LTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERIT 302
           LTVAEHFRDQGQDVLFF+DNIFRFTQANSEISALLGRIPSAVGYQSTLA EMGELQERIT
Sbjct: 242 LTVAEHFRDQGQDVLFFIDNIFRFTQANSEISALLGRIPSAVGYQSTLASEMGELQERIT 301

Query: 303 TTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSM 362
           TTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSR+ISEKGIYPA+DPLDSNS++
Sbjct: 302 TTLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRKISEKGIYPAVDPLDSNSNI 361

Query: 363 LEIDIVGQEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERFMSQP 422
           LE+D VG+EHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARK+ERFMSQP
Sbjct: 362 LEVDTVGKEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKIERFMSQP 421

Query: 423 FHVAESFTGLPGKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKA 475
           FHVAESFTG PGKFVSLEETI+GFKGLVQG+YDHLPELAFYMVGSIDEAV+KA
Sbjct: 422 FHVAESFTGSPGKFVSLEETIKGFKGLVQGDYDHLPELAFYMVGSIDEAVQKA 474


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|298293437|ref|YP_003695376.1| ATP synthase F1 subunit beta [Starkeya novella DSM 506] Length = 477 Back     alignment and organism information
>gi|158425749|ref|YP_001527041.1| F0F1 ATP synthase subunit beta [Azorhizobium caulinodans ORS 571] Length = 478 Back     alignment and organism information
>gi|170744668|ref|YP_001773323.1| F0F1 ATP synthase subunit beta [Methylobacterium sp. 4-46] Length = 484 Back     alignment and organism information
>gi|220927118|ref|YP_002502420.1| F0F1 ATP synthase subunit beta [Methylobacterium nodulans ORS 2060] Length = 484 Back     alignment and organism information
>gi|300024907|ref|YP_003757518.1| ATP synthase F1 subunit beta [Hyphomicrobium denitrificans ATCC 51888] Length = 477 Back     alignment and organism information
>gi|217976537|ref|YP_002360684.1| F0F1 ATP synthase subunit beta [Methylocella silvestris BL2] Length = 483 Back     alignment and organism information
>gi|319404806|emb|CBI78407.1| ATP synthase beta chain [Bartonella rochalimae ATCC BAA-1498] Length = 530 Back     alignment and organism information
>gi|323137978|ref|ZP_08073052.1| ATP synthase F1, beta subunit [Methylocystis sp. ATCC 49242] Length = 478 Back     alignment and organism information
>gi|222150025|ref|YP_002550982.1| ATP synthase F1, beta subunit [Agrobacterium vitis S4] Length = 485 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target478 F0F1 ATP synthase subunit beta [Candidatus Liberibacter
COG0055468 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [En 0.0
KOG1350521 KOG1350, KOG1350, KOG1350, F0F1-type ATP synthase, beta 0.0
PRK09280463 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Val 0.0
TIGR01039461 TIGR01039, atpD, ATP synthase, F1 beta subunit 0.0
PRK12597461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Pro 0.0
TIGR03305449 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 s 1e-150
COG1157441 COG1157, FliI, Flagellar biosynthesis/type III secretor 3e-62
TIGR02546422 TIGR02546, III_secr_ATP, type III secretion apparatus H 3e-50
PRK06936439 PRK06936, PRK06936, type III secretion system ATPase; P 2e-41
PRK05922434 PRK05922, PRK05922, type III secretion system ATPase; V 5e-24
CHL00060494 CHL00060, atpB, ATP synthase CF1 beta subunit 0.0
cd01133274 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, 1e-135
cd01135276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catal 7e-25
TIGR03324497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 su 2e-23
cd01132274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, centra 1e-21
CHL00059485 CHL00059, atpA, ATP synthase CF1 alpha subunit 9e-13
PTZ00185574 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional 4e-10
PRK12608380 PRK12608, PRK12608, transcription termination factor Rh 6e-05
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, 5e-63
cd01134369 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic 2e-23
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 4e-14
COG1158422 COG1158, Rho, Transcription termination factor [Transcr 2e-06
TIGR01026440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 3e-55
TIGR03496411 TIGR03496, FliI_clade1, flagellar protein export ATPase 6e-53
TIGR03498418 TIGR03498, FliI_clade3, flagellar protein export ATPase 4e-49
PRK06820440 PRK06820, PRK06820, type III secretion system ATPase; V 6e-41
PRK08149428 PRK08149, PRK08149, ATP synthase SpaL; Validated 1e-40
PRK06315442 PRK06315, PRK06315, type III secretion system ATPase; P 3e-38
PRK07196434 PRK07196, fliI, flagellum-specific ATP synthase; Valida 9e-34
COG0056504 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [E 4e-29
TIGR03497413 TIGR03497, FliI_clade2, flagellar protein export ATPase 2e-54
PRK06793432 PRK06793, fliI, flagellum-specific ATP synthase; Valida 5e-39
PRK07721438 PRK07721, fliI, flagellum-specific ATP synthase; Valida 8e-37
cd01136326 cd01136, ATPase_flagellum-secretory_path_III, Flagellum 3e-50
PRK08472434 PRK08472, fliI, flagellum-specific ATP synthase; Valida 1e-43
PRK06002450 PRK06002, fliI, flagellum-specific ATP synthase; Valida 1e-37
PRK09099441 PRK09099, PRK09099, type III secretion system ATPase; P 2e-36
PRK08972444 PRK08972, fliI, flagellum-specific ATP synthase; Valida 5e-35
PRK07594433 PRK07594, PRK07594, type III secretion system ATPase Ss 5e-35
COG1156463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit 4e-33
COG1155588 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit 1e-31
TIGR01041458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B sub 1e-27
PRK07960455 PRK07960, fliI, flagellum-specific ATP synthase; Valida 3e-26
PRK04192586 PRK04192, PRK04192, V-type ATP synthase subunit A; Prov 4e-24
PRK04196460 PRK04196, PRK04196, V-type ATP synthase subunit B; Prov 7e-23
KOG1351489 KOG1351, KOG1351, KOG1351, Vacuolar H+-ATPase V1 sector 8e-21
TIGR01040466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subu 3e-16
TIGR00767415 TIGR00767, rho, transcription termination factor Rho 0.001
PRK05688451 PRK05688, fliI, flagellum-specific ATP synthase; Valida 1e-35
PRK08927442 PRK08927, fliI, flagellum-specific ATP synthase; Valida 3e-35
TIGR00962501 TIGR00962, atpA, proton translocating ATP synthase, F1 6e-23
pfam00306110 pfam00306, ATP-synt_ab_C, ATP synthase alpha/beta chain 7e-31
TIGR01043578 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A sub 4e-28
KOG1352618 KOG1352, KOG1352, KOG1352, Vacuolar H+-ATPase V1 sector 2e-26
TIGR01042591 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subu 1e-24
PRK13343502 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Pr 4e-28
PRK02118436 PRK02118, PRK02118, V-type ATP synthase subunit B; Prov 1e-14
PRK146981017 PRK14698, PRK14698, V-type ATP synthase subunit A; Prov 1e-21
PRK09281502 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Va 6e-12
KOG1353340 KOG1353, KOG1353, KOG1353, F0F1-type ATP synthase, alph 2e-05
pfam0287469 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta famil 2e-11
cd01128249 cd01128, rho_factor, Transcription termination factor r 1e-07
smart00382148 smart00382, AAA, ATPases associated with a variety of c 0.002
>gnl|CDD|30404 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|36564 KOG1350, KOG1350, KOG1350, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181752 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|130111 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>gnl|CDD|31351 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|162913 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|177000 CHL00060, atpB, ATP synthase CF1 beta subunit Back     alignment and domain information
>gnl|CDD|29999 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|30001 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|29998 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|183622 PRK12608, PRK12608, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|143799 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|30000 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|31352 COG1158, Rho, Transcription termination factor [Transcription] Back     alignment and domain information
>gnl|CDD|162162 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|163292 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|181253 PRK08149, PRK08149, ATP synthase SpaL; Validated Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|30405 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132536 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|30002 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|168339 PRK06002, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|31350 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31349 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162170 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|179776 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|179779 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|36565 KOG1351, KOG1351, KOG1351, Vacuolar H+-ATPase V1 sector, subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162169 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>gnl|CDD|162030 TIGR00767, rho, transcription termination factor Rho Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|181583 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|162134 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|144044 pfam00306, ATP-synt_ab_C, ATP synthase alpha/beta chain, C terminal domain Back     alignment and domain information
>gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit Back     alignment and domain information
>gnl|CDD|36566 KOG1352, KOG1352, KOG1352, Vacuolar H+-ATPase V1 sector, subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162171 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|181753 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|36567 KOG1353, KOG1353, KOG1353, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|145823 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain Back     alignment and domain information
>gnl|CDD|29994 cd01128, rho_factor, Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 478 F0F1 ATP synthase subunit beta [Candidatus Liberibacter
PRK09280466 F0F1 ATP synthase subunit beta; Validated 100.0
CHL00060480 atpB ATP synthase CF1 beta subunit 100.0
PRK12597459 F0F1 ATP synthase subunit beta; Provisional 100.0
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. 100.0
COG0055468 AtpD F0F1-type ATP synthase, beta subunit [Energy produ 100.0
TIGR00962520 atpA ATP synthase F1, alpha subunit; InterPro: IPR00529 100.0
PRK07721435 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08927441 fliI flagellum-specific ATP synthase; Validated 100.0
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 100.0
KOG1350521 consensus 100.0
CHL00059501 atpA ATP synthase CF1 alpha subunit 100.0
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha. 100.0
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 100.0
PRK05922434 type III secretion system ATPase; Validated 100.0
PRK06002450 fliI flagellum-specific ATP synthase; Validated 100.0
PRK04196460 V-type ATP synthase subunit B; Provisional 100.0
PRK02118432 V-type ATP synthase subunit B; Provisional 100.0
PRK07165507 F0F1 ATP synthase subunit alpha; Validated 100.0
COG0056504 AtpA F0F1-type ATP synthase, alpha subunit [Energy prod 100.0
TIGR01039460 atpD ATP synthase F1, beta subunit; InterPro: IPR005722 100.0
PTZ00185574 ATPase alpha subunit; Provisional 100.0
COG1156463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy 100.0
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit; InterP 100.0
KOG1351489 consensus 100.0
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 100.0
TIGR02545439 ATP_syn_fliI flagellar protein export ATPase FliI; Inte 100.0
TIGR01026455 fliI_yscN ATPase FliI/YscN family; InterPro: IPR005714 100.0
PRK06936439 type III secretion system ATPase; Provisional 100.0
PRK05688451 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08972440 fliI flagellum-specific ATP synthase; Validated 100.0
COG1157441 FliI Flagellar biosynthesis/type III secretory pathway 100.0
PRK06315442 type III secretion system ATPase; Provisional 100.0
PRK09099441 type III secretion system ATPase; Provisional 100.0
PRK08149427 ATP synthase SpaL; Validated 100.0
PRK07594433 type III secretion system ATPase; Validated 100.0
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. Membe 100.0
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. Membe 100.0
PRK07960455 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08472435 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. Membe 100.0
PRK06820445 type III secretion system ATPase; Validated 100.0
PRK07196434 fliI flagellum-specific ATP synthase; Validated 100.0
PRK06793432 fliI flagellum-specific ATP synthase; Validated 100.0
PRK04192585 V-type ATP synthase subunit A; Provisional 100.0
TIGR01043584 ATP_syn_A_arch ATP synthase archaeal, A subunit; InterP 100.0
COG1155588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy 100.0
KOG1352618 consensus 100.0
TIGR01042596 V-ATPase_V1_A V-type ATPase, A subunit; InterPro: IPR00 100.0
TIGR01040464 V-ATPase_V1_B V-type ATPase, B subunit; InterPro: IPR00 100.0
KOG1353340 consensus 100.0
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-specific 100.0
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subu 100.0
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide 100.0
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central domain. 100.0
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A. 100.0
cd01128249 rho_factor Transcription termination factor rho is a ba 100.0
PRK12678667 transcription termination factor Rho; Provisional 100.0
COG1158422 Rho Transcription termination factor [Transcription] 100.0
TIGR00767420 rho transcription termination factor Rho; InterPro: IPR 99.86
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 94.6
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 100.0
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 99.96
pfam06745231 KaiC KaiC. This family represents a conserved region wi 98.74
PRK06067241 flagellar accessory protein FlaH; Validated 98.7
PRK09302501 circadian clock protein KaiC; Reviewed 98.69
PRK04328250 hypothetical protein; Provisional 98.54
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 98.53
cd01394218 radB RadB. The archaeal protein radB shares similarity 98.32
smart00382148 AAA ATPases associated with a variety of cellular activ 98.31
cd01124187 KaiC KaiC is a circadian clock protein primarily found 98.07
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.75
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 96.96
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 96.51
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 96.25
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 95.55
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 95.48
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 95.23
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 94.58
TIGR02746900 TraC-F-type type-IV secretion system protein TraC; Inte 92.58
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 92.49
PRK10865 857 protein disaggregation chaperone; Provisional 92.23
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 92.15
PRK12608379 transcription termination factor Rho; Provisional 100.0
PRK09376416 rho transcription termination factor Rho; Provisional 100.0
pfam00306110 ATP-synt_ab_C ATP synthase alpha/beta chain, C terminal 99.83
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 92.87
pfam0287469 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barr 98.6
PRK09302 501 circadian clock protein KaiC; Reviewed 98.41
PRK00149447 dnaA chromosomal replication initiation protein; Review 97.18
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 96.71
PRK08506473 replicative DNA helicase; Provisional 96.62
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 96.56
PRK06749428 replicative DNA helicase; Provisional 96.49
PRK05595444 replicative DNA helicase; Provisional 96.38
PRK05748448 replicative DNA helicase; Provisional 96.36
PRK08082453 consensus 96.35
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 96.31
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 96.3
PRK08760476 replicative DNA helicase; Provisional 96.27
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 96.21
PRK08181269 transposase; Validated 96.19
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 96.13
PRK10789569 putative multidrug transporter membrane\ATP-binding com 96.1
PRK08006471 replicative DNA helicase; Provisional 96.09
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 96.06
PRK07004460 replicative DNA helicase; Provisional 96.06
PRK08840464 replicative DNA helicase; Provisional 96.04
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.01
PRK06526254 transposase; Provisional 95.99
PRK08694468 consensus 95.98
PRK07263453 consensus 95.95
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 95.94
PRK09165484 replicative DNA helicase; Provisional 95.9
PRK06904472 replicative DNA helicase; Validated 95.89
PRK09519 790 recA recombinase A; Reviewed 95.86
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 95.8
PRK05636507 replicative DNA helicase; Provisional 95.78
PRK06321472 replicative DNA helicase; Provisional 95.64
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.62
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.58
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 95.46
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 95.24
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 95.22
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.15
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 95.1
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.1
TIGR02142361 modC_ABC molybdate ABC transporter, ATP-binding protein 95.06
PRK09183258 transposase/IS protein; Provisional 95.03
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 95.03
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.03
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 94.99
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 94.99
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 94.98
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 94.91
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 94.9
TIGR00929931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 94.89
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 94.86
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.83
PRK08116262 hypothetical protein; Validated 94.78
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 94.77
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 94.77
COG4608268 AppF ABC-type oligopeptide transport system, ATPase com 94.74
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 94.73
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.62
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 94.6
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 94.58
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.56
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 94.56
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 94.52
PRK07773 868 replicative DNA helicase; Validated 94.48
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.35
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 94.28
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 94.27
PRK08084235 DNA replication initiation factor; Provisional 94.27
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 94.21
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 94.17
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 94.17
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 94.14
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 94.1
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.02
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 93.87
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.81
COG4988559 CydD ABC-type transport system involved in cytochrome b 93.77
PRK06921265 hypothetical protein; Provisional 93.75
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.68
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 93.67
TIGR02759613 TraD_Ftype type IV conjugative transfer system coupling 93.55
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 93.55
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 93.49
PRK10908222 cell division protein FtsE; Provisional 93.47
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 93.47
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 93.45
COG3451796 VirB4 Type IV secretory pathway, VirB4 components [Intr 93.36
PRK13536306 nodulation factor exporter subunit NodI; Provisional 93.3
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 93.25
PTZ00243 1560 ABC transporter; Provisional 93.25
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 93.17
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 93.14
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 93.14
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 93.07
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 93.06
PRK09435325 arginine/ornithine transport system ATPase; Provisional 93.06
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 92.99
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 92.98
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 92.96
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 92.94
KOG0055 1228 consensus 92.8
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 92.79
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 92.77
COG5635 824 Predicted NTPase (NACHT family) [Signal transduction me 92.7
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 92.69
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 92.69
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 92.64
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 92.51
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 92.51
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 92.5
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 92.44
PRK05642234 DNA replication initiation factor; Validated 92.44
PRK06893229 DNA replication initiation factor; Validated 92.38
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 92.38
cd03114148 ArgK-like The function of this protein family is unkown 92.23
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 92.16
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 92.0
COG1484254 DnaC DNA replication protein [DNA replication, recombin 91.96
PRK07261171 topology modulation protein; Provisional 91.96
PRK07429331 phosphoribulokinase; Provisional 91.91
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 91.75
COG4586325 ABC-type uncharacterized transport system, ATPase compo 91.61
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 91.5
PRK13873815 conjugal transfer ATPase TrbE; Provisional 91.45
COG1123539 ATPase components of various ABC-type transport systems 91.38
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 91.3
COG0305435 DnaB Replicative DNA helicase [DNA replication, recombi 91.29
COG1135339 AbcC ABC-type metal ion transport system, ATPase compon 91.28
PRK13898800 type IV secretion system ATPase VirB4; Provisional 91.18
PRK08939306 primosomal protein DnaI; Reviewed 91.06
PRK13830818 conjugal transfer protein TrbE; Provisional 90.89
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 90.6
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 90.46
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 90.43
PRK13891852 conjugal transfer protein TrbE; Provisional 90.4
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 90.29
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 90.29
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 90.28
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 90.26
pfam03266168 DUF265 Protein of unknown function, DUF265. 90.1
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 98.34
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 97.88
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 97.69
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 97.53
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 97.45
PRK13341 726 recombination factor protein RarA/unknown domain fusion 97.26
PRK09354350 recA recombinase A; Provisional 97.2
pfam00931285 NB-ARC NB-ARC domain. 96.92
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 96.87
PRK13342 417 recombination factor protein RarA; Reviewed 96.84
PRK04301318 radA DNA repair and recombination protein RadA; Validat 96.82
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 96.61
PRK11823454 DNA repair protein RadA; Provisional 96.58
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 96.5
PTZ00035350 Rad51; Provisional 96.17
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 95.93
PRK05541176 adenylylsulfate kinase; Provisional 95.85
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.53
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 95.23
COG4172534 ABC-type uncharacterized transport system, duplicated A 95.11
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 94.85
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 94.83
KOG4658 889 consensus 94.5
PRK03846198 adenylylsulfate kinase; Provisional 94.16
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 93.92
COG4619223 ABC-type uncharacterized transport system, ATPase compo 93.82
PRK00889175 adenylylsulfate kinase; Provisional 92.85
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 92.77
KOG1514767 consensus 92.62
KOG0731 774 consensus 91.6
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 91.6
PRK04841 903 transcriptional regulator MalT; Provisional 91.5
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 90.97
KOG1433326 consensus 90.56
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 90.39
KOG0054 1381 consensus 90.25
PRK12422455 chromosomal replication initiation protein; Provisional 97.0
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 95.75
PRK10636638 putative ABC transporter ATP-binding protein; Provision 95.65
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.49
PRK11147632 ABC transporter ATPase component; Reviewed 95.33
COG1127263 Ttg2A ABC-type transport system involved in resistance 94.78
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 94.01
TIGR00416481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 93.91
cd03115173 SRP The signal recognition particle (SRP) mediates the 93.46
KOG0079198 consensus 92.05
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.88
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 96.07
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 96.03
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 95.95
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.87
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 95.74
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 95.7
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.68
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.68
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 95.68
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 95.67
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.66
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.59
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.56
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.56
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.48
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.47
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 95.45
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.45
PRK12289351 ribosome-associated GTPase; Reviewed 95.39
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 95.39
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.36
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 95.35
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.34
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 95.33
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.31
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.28
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 95.28
COG4987573 CydC ABC-type transport system involved in cytochrome b 95.26
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 95.25
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 95.24
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 95.23
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 95.22
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 95.22
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 95.21
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.21
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 95.19
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.19
PRK11147 632 ABC transporter ATPase component; Reviewed 95.17
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 95.15
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 95.15
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 95.1
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 95.09
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 95.07
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 95.06
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 95.05
KOG0057591 consensus 95.05
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 95.01
PRK10744257 phosphate transporter subunit; Provisional 94.97
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 94.96
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 94.94
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 94.94
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.91
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 94.86
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 94.86
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 94.82
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 94.78
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.76
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 94.73
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 94.72
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 94.69
cd03234226 ABCG_White The White subfamily represents ABC transport 94.69
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 94.68
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 94.64
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 94.63
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 94.62
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.61
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 94.6
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 94.6
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 94.58
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.56
PRK13542224 consensus 94.55
PRK07952242 DNA replication protein DnaC; Validated 94.55
TIGR01187331 potA polyamine ABC transporter, ATP-binding protein; In 94.55
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 94.55
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 94.54
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 94.51
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 94.51
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 94.48
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 94.47
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 94.47
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.43
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 94.43
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 94.4
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 94.38
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.34
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 94.29
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 94.28
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 94.26
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.24
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 94.24
pfam00004131 AAA ATPase family associated with various cellular acti 94.22
PRK12377248 putative replication protein; Provisional 94.2
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 94.15
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 94.15
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 94.12
COG3839338 MalK ABC-type sugar transport systems, ATPase component 94.11
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 94.09
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 94.08
PRK09984262 phosphonate/organophosphate ester transporter subunit; 94.05
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 94.02
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 94.01
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 93.95
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 93.93
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 93.84
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 93.83
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 93.83
PRK03695245 vitamin B12-transporter ATPase; Provisional 93.8
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 93.72
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 93.69
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 93.68
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 93.66
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 93.63
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.62
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 93.55
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 93.54
COG0488 530 Uup ATPase components of ABC transporters with duplicat 93.48
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 93.4
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 93.39
PRK13409 590 putative ATPase RIL; Provisional 93.39
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 93.35
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 93.33
PRK08118167 topology modulation protein; Reviewed 93.31
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.28
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 93.26
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 93.25
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 93.25
PTZ00301210 uridine kinase; Provisional 93.22
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 93.16
COG0488530 Uup ATPase components of ABC transporters with duplicat 93.12
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.11
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 93.11
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 93.05
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 93.03
PRK13544208 consensus 92.98
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 92.98
pfam00625182 Guanylate_kin Guanylate kinase. 92.74
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 92.74
pfam03193161 DUF258 Protein of unknown function, DUF258. 92.61
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 92.58
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 92.46
COG4181228 Predicted ABC-type transport system involved in lysopho 92.37
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 92.34
PRK07667190 uridine kinase; Provisional 92.32
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 92.31
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 92.02
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 92.02
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 91.99
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 91.98
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 91.98
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 91.84
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 91.79
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 91.75
COG4167267 SapF ABC-type antimicrobial peptide transport system, A 91.65
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 91.65
COG4525259 TauB ABC-type taurine transport system, ATPase componen 91.65
PRK06217185 hypothetical protein; Validated 91.49
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 91.49
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 91.13
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 91.09
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 91.09
PRK00098298 ribosome-associated GTPase; Reviewed 91.05
PRK12288344 ribosome-associated GTPase; Reviewed 91.04
PRK05480209 uridine kinase; Provisional 90.96
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 90.92
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 90.89
KOG1707 625 consensus 90.82
PRK09270230 frcK putative fructose transport system kinase; Reviewe 90.82
PRK01889353 ribosome-associated GTPase; Reviewed 90.7
COG4136213 ABC-type uncharacterized transport system, ATPase compo 90.69
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 90.65
TIGR01184230 ntrCD nitrate ABC transporter, ATP-binding proteins C a 90.63
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 90.58
KOG0062 582 consensus 90.47
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 90.42
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 90.35
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 90.34
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 90.29
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 90.25
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfamily 90.24
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 90.17
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 90.16
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 90.14
COG1100219 GTPase SAR1 and related small G proteins [General funct 90.1
PRK06696