254780616

254780616

F0F1 ATP synthase subunit gamma

GeneID in NCBI database:8209616Locus tag:CLIBASIA_02515
Protein GI in NCBI database:254780616Protein Accession:YP_003065029.1
Gene range:+(657790, 658674)Protein Length:294aa
Gene description:F0F1 ATP synthase subunit gamma
COG prediction:[C] F0F1-type ATP synthase, gamma subunit
KEGG prediction:atpG; F0F1 ATP synthase subunit gamma (EC:3.6.3.14); K02115 F-type H+-transporting ATPase subunit gamma [EC:3.6.3.14]
SEED prediction:ATP synthase gamma chain (EC 3.6.3.14)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:F0F1-type ATP synthase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHcccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHcccccHHHccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccEEEEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccHcccccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHcccccccccHHHccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKcvvgehfqeypspfvrgtgkdKVYLLVICTAekglcggfNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSielsskkgvdfvqAHGIARQITSLFTSNVFDLCFFIYSEFKSIIqqipiiskiipvdwsqdleQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV
mtslkefksrihsvketqkiteamQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLLVICTAekglcggfNAQIIRFARDRIKEFIAEgkeiklliigrkgyEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV
MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFksiiqqipiiskiipVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV
*TSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVV******Y***FVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPV***************VYRYESTLYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV
MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV
**SLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLE*KQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV
MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV
MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target294 F0F1 ATP synthase subunit gamma [Candidatus Liberibacte
315121816294 F0F1 ATP synthase subunit gamma [Candidatus Liberibacte 1 1e-115
15889878292 F0F1 ATP synthase subunit gamma [Agrobacterium tumefaci 1 5e-77
163761386292 ATP synthase subunit C [Hoeflea phototrophica DFL-43] L 1 1e-75
325293992292 ATP synthase gamma chain F0F1 ATP synthase subunit gamm 1 1e-75
327188927294 H(+)-transporting ATP synthase protein, gamma subunit [ 1 8e-75
190893717294 H(+)-transporting ATP synthase, gamma subunit [Rhizobiu 1 1e-74
162329626294 F0F1 ATP synthase subunit gamma [Rhizobium etli CFN 42] 1 8e-74
222150026293 F0F1 ATP synthase subunit gamma [Agrobacterium vitis S4 1 3e-73
209551225294 F0F1 ATP synthase subunit gamma [Rhizobium leguminosaru 1 4e-73
116254140294 F0F1 ATP synthase subunit gamma [Rhizobium leguminosaru 1 6e-73
>gi|315121816|ref|YP_004062305.1| F0F1 ATP synthase subunit gamma [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 294 Back     alignment and organism information
 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/294 (72%), Positives = 261/294 (88%)

Query: 1   MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGE 60
           M SLKE K+RIHSVKETQKITEAMQL+SVTKLRRAKEAIQNAS YQ HI+DFF+KC V E
Sbjct: 1   MASLKELKNRIHSVKETQKITEAMQLVSVTKLRRAKEAIQNASLYQSHIRDFFIKCAVDE 60

Query: 61  HFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLI 120
              E  SP +RGTG+ +VYL ++CTAEKGLCGGFN+QIIRFAR+RI++ IA+ K++K+LI
Sbjct: 61  FSLEDLSPLIRGTGRSEVYLFIVCTAEKGLCGGFNSQIIRFARERIRQVIADNKQVKILI 120

Query: 121 IGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEF 180
           IGRKG+EGL KEFSSMIIDS+EL SKK +DF QAH IA+++ SLFTSNVFD+CF I+SEF
Sbjct: 121 IGRKGHEGLYKEFSSMIIDSVELPSKKEIDFAQAHNIAQKVVSLFTSNVFDVCFCIHSEF 180

Query: 181 KSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIIL 240
           KSIIQQIPIISKIIPVD+ ++ + K+++ LS+Y YE T+YSVL+ I+ +SIS+++FW +L
Sbjct: 181 KSIIQQIPIISKIIPVDFVRNYKDKKEENLSIYHYEPTVYSVLEKILFQSISAQIFWALL 240

Query: 241 ENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV 294
           ENKASE+GARITAMDNATRNAG+MV++L+LSYNRQRQMRITT+LIEIIAGAE V
Sbjct: 241 ENKASEIGARITAMDNATRNAGRMVEHLILSYNRQRQMRITTDLIEIIAGAEAV 294


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15889878|ref|NP_355559.1| F0F1 ATP synthase subunit gamma [Agrobacterium tumefaciens str. C58] Length = 292 Back     alignment and organism information
>gi|163761386|ref|ZP_02168460.1| ATP synthase subunit C [Hoeflea phototrophica DFL-43] Length = 292 Back     alignment and organism information
>gi|325293992|ref|YP_004279856.1| ATP synthase gamma chain F0F1 ATP synthase subunit gamma [Agrobacterium sp. H13-3] Length = 292 Back     alignment and organism information
>gi|327188927|gb|EGE56119.1| H(+)-transporting ATP synthase protein, gamma subunit [Rhizobium etli CNPAF512] Length = 294 Back     alignment and organism information
>gi|190893717|ref|YP_001980259.1| H(+)-transporting ATP synthase, gamma subunit [Rhizobium etli CIAT 652] Length = 294 Back     alignment and organism information
>gi|162329626|ref|YP_471344.2| F0F1 ATP synthase subunit gamma [Rhizobium etli CFN 42] Length = 294 Back     alignment and organism information
>gi|222150026|ref|YP_002550983.1| F0F1 ATP synthase subunit gamma [Agrobacterium vitis S4] Length = 293 Back     alignment and organism information
>gi|209551225|ref|YP_002283142.1| F0F1 ATP synthase subunit gamma [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 294 Back     alignment and organism information
>gi|116254140|ref|YP_769978.1| F0F1 ATP synthase subunit gamma [Rhizobium leguminosarum bv. viciae 3841] Length = 294 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target294 F0F1 ATP synthase subunit gamma [Candidatus Liberibacte
PRK05621284 PRK05621, PRK05621, F0F1 ATP synthase subunit gamma; Va 4e-81
COG0224287 COG0224, AtpG, F0F1-type ATP synthase, gamma subunit [E 6e-66
TIGR01146287 TIGR01146, ATPsyn_F1gamma, ATP synthase, F1 gamma subun 8e-64
PRK13423288 PRK13423, PRK13423, F0F1 ATP synthase subunit gamma; Pr 4e-58
PRK13424291 PRK13424, PRK13424, F0F1 ATP synthase subunit gamma; Pr 3e-43
KOG1531304 KOG1531, KOG1531, KOG1531, F0F1-type ATP synthase, gamm 1e-42
PRK14111290 PRK14111, PRK14111, F0F1 ATP synthase subunit gamma; Pr 5e-42
PRK13425291 PRK13425, PRK13425, F0F1 ATP synthase subunit gamma; Pr 8e-41
PRK13426291 PRK13426, PRK13426, F0F1 ATP synthase subunit gamma; Pr 3e-40
PRK13427289 PRK13427, PRK13427, F0F1 ATP synthase subunit gamma; Pr 2e-37
PRK14110291 PRK14110, PRK14110, F0F1 ATP synthase subunit gamma; Pr 3e-37
PRK13422298 PRK13422, PRK13422, F0F1 ATP synthase subunit gamma; Pr 2e-31
TIGR03323285 TIGR03323, alt_F1F0_F1_gam, alternate F1F0 ATPase, F1 s 6e-09
pfam00231288 pfam00231, ATP-synt, ATP synthase 7e-74
>gnl|CDD|180168 PRK05621, PRK05621, F0F1 ATP synthase subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|30573 COG0224, AtpG, F0F1-type ATP synthase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162225 TIGR01146, ATPsyn_F1gamma, ATP synthase, F1 gamma subunit Back     alignment and domain information
>gnl|CDD|172046 PRK13423, PRK13423, F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|172047 PRK13424, PRK13424, F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|36744 KOG1531, KOG1531, KOG1531, F0F1-type ATP synthase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184515 PRK14111, PRK14111, F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|139564 PRK13425, PRK13425, F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|184047 PRK13426, PRK13426, F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|172049 PRK13427, PRK13427, F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|184514 PRK14110, PRK14110, F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|184046 PRK13422, PRK13422, F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|163215 TIGR03323, alt_F1F0_F1_gam, alternate F1F0 ATPase, F1 subunit gamma Back     alignment and domain information
>gnl|CDD|143984 pfam00231, ATP-synt, ATP synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 294 F0F1 ATP synthase subunit gamma [Candidatus Liberibacte
TIGR01146330 ATPsyn_F1gamma ATP synthase F1, gamma subunit; InterPro 100.0
PRK13422298 F0F1 ATP synthase subunit gamma; Provisional 100.0
PRK13424291 F0F1 ATP synthase subunit gamma; Provisional 100.0
PRK13426289 F0F1 ATP synthase subunit gamma; Provisional 100.0
PRK13427286 F0F1 ATP synthase subunit gamma; Provisional 100.0
PRK05621287 F0F1 ATP synthase subunit gamma; Validated 100.0
PRK13425291 F0F1 ATP synthase subunit gamma; Provisional 100.0
COG0224287 AtpG F0F1-type ATP synthase, gamma subunit [Energy prod 100.0
PRK13423286 F0F1 ATP synthase subunit gamma; Provisional 100.0
pfam00231288 ATP-synt ATP synthase. 100.0
TIGR03323285 alt_F1F0_F1_gam alternate F1F0 ATPase, F1 subunit gamma 100.0
KOG1531304 consensus 100.0
>TIGR01146 ATPsyn_F1gamma ATP synthase F1, gamma subunit; InterPro: IPR000131 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK13422 F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>PRK13424 F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>PRK13426 F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>PRK13427 F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>PRK05621 F0F1 ATP synthase subunit gamma; Validated Back     alignment and domain information
>PRK13425 F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>COG0224 AtpG F0F1-type ATP synthase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>PRK13423 F0F1 ATP synthase subunit gamma; Provisional Back     alignment and domain information
>pfam00231 ATP-synt ATP synthase Back     alignment and domain information
>TIGR03323 alt_F1F0_F1_gam alternate F1F0 ATPase, F1 subunit gamma Back     alignment and domain information
>KOG1531 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target294 F0F1 ATP synthase subunit gamma [Candidatus Liberibacte
2qe7_G286 Crystal Structure Of The F1-Atpase From The Thermoa 2e-75
2w6e_G298 Low Resolution Structures Of Bovine Mitochondrial F 5e-55
2f43_G273 Rat Liver F1-Atpase Length = 273 7e-54
2jdi_G273 Ground State Structure Of F1-Atpase From Bovine Hea 2e-53
1cow_G272 Bovine Mitochondrial F1-Atpase Complexed With Aurov 2e-53
1mab_G270 Rat Liver F1-Atpase Length = 270 3e-52
2hld_G278 Crystal Structure Of Yeast Mitochondrial F1-Atpase 9e-45
2xok_G311 Refined Structure Of Yeast F1c10 Atpase Complex To 9e-45
3oe7_G278 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 1e-43
1fs0_G230 Complex Of GammaEPSILON ATP SYNTHASE FROM E.COLI Le 4e-48
1ohh_G100 Bovine Mitochondrial F1-Atpase Complexed With The I 1e-16
1ohh_G100 Bovine Mitochondrial F1-Atpase Complexed With The I 9e-07
>gi|158430156|pdb|2QE7|G Chain G, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 286 Back     alignment and structure
 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 155/294 (52%), Gaps = 9/294 (3%)

Query: 1   MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGE 60
           M  ++E K RI SVK T++IT+AM++++  KLRRA+E  +NA  Y   IK+       G 
Sbjct: 1   MQGMREIKRRIRSVKNTRQITKAMKMVAAAKLRRAQETAENARPYADKIKEVISSIAAGT 60

Query: 61  HFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLI 120
               +P    R     K    ++ T+++GL G +NA I+R     I+E      E  +  
Sbjct: 61  KDFSHPMLEARP---VKKTGYMVITSDRGLAGPYNANILRLVSKTIEERHQSKDEYVIFA 117

Query: 121 IGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEF 180
           +GRKG +  +K    ++ +   +S        +   IA+    +F    FD     Y+EF
Sbjct: 118 VGRKGRDFFKKRGYPVVEEVTGISDTPS--LTEIQDIAQSAIGMFADETFDKLTIFYNEF 175

Query: 181 KSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIIL 240
            S I Q P+  +++P+   + L+      +S Y YE    SVL+ ++ +   + ++  +L
Sbjct: 176 VSPIVQRPVEKQLLPLTSEEVLD----GPVSAYEYEPDSESVLEVLLPKYAETLIYSALL 231

Query: 241 ENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV 294
           + KASE GAR+TAM NAT NA +M++ L L +NR RQ  IT E+ EI+AGA  +
Sbjct: 232 DAKASEFGARMTAMGNATDNATEMLETLTLQFNRARQAAITQEIAEIVAGANAL 285


gi|262118386|pdb|2W6E|G Chain G, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 298 Back     alignment and structure
gi|93279424|pdb|2F43|G Chain G, Rat Liver F1-Atpase Length = 273 Back     alignment and structure
>gi|145579797|pdb|2JDI|G Chain G, Ground State Structure Of F1-Atpase From Bovine Heart Mitochondria (Bovine F1-Atpase Crystallised In The Absence Of Azide) Length = 273 Back     alignment and structure
>gi|1827815|pdb|1COW|G Chain G, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 272 Back     alignment and structure
>gi|6729936|pdb|1MAB|G Chain G, Rat Liver F1-Atpase Length = 270 Back     alignment and structure
>gi|119389910|pdb|2HLD|G Chain G, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 278 Back     alignment and structure
gi|307568104|pdb|2XOK|G Chain G, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 311 Back     alignment and structure
>gi|306991955|pdb|3OE7|G Chain G, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Gamma-I270t Length = 278 Back     alignment and structure
>gi|14278249|pdb|1FS0|G Chain G, Complex Of GammaEPSILON ATP SYNTHASE FROM E.COLI Length = 230 Back     alignment and structure
>gi|71042836|pdb|1OHH|G Chain G, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 100 Back     alignment and structure
>gi|71042836|pdb|1OHH|G Chain G, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 100 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target294 F0F1 ATP synthase subunit gamma [Candidatus Liberibacte
3oee_G278 ATP synthase subunit gamma; ATP phosphatase, F1F0 ATPas 4e-58
2xok_G311 ATP synthase subunit gamma, mitochondrial; hydrolase, A 1e-57
2qe7_G286 ATP synthase subunit gamma; blockage of ATP hydrolysis, 2e-51
2hld_G278 ATP synthase gamma chain, mitochondrial; ATP phosphoryl 9e-48
2ck3_G272 ATP synthase gamma chain; ATP phosphorylase, ATP phosph 9e-45
1fs0_G230 ATP synthase gamma subunit; coiled coil, epsilon, hydro 5e-39
>3oee_G ATP synthase subunit gamma; ATP phosphatase, F1F0 ATPase, ATP synthesis, H ADP, PO4, mitochondria; HET: ANP; 2.74A {Saccharomyces cerevisiae} PDB: 2wpd_G* 3fks_G 2hld_G* 3oeh_G* 3ofn_G* 3oe7_G* Length = 278 Back     alignment and structure
 Score =  219 bits (560), Expect = 4e-58
 Identities = 74/290 (25%), Positives = 136/290 (46%), Gaps = 16/290 (5%)

Query: 3   SLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHF 62
           +LKE + R+ S+K  +KIT+ M++++ T+L +A++A  +A        D   +       
Sbjct: 2   TLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKM-----DEAEQLFYKNAE 56

Query: 63  QEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIG 122
            +        TG  K  ++ I T++KGLCG  ++Q+ +  R  + +         ++ IG
Sbjct: 57  TKNLDVEATETGAPKELIVAI-TSDKGLCGSIHSQLAKAVRRHLNDQ----PNADIVTIG 111

Query: 123 RKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFKS 182
            K    L +   + I  SI    K    F ++  IA ++ S+  +  +      Y++  S
Sbjct: 112 DKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYPKISIFYNDPVS 171

Query: 183 IIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILEN 242
            +   P    I         +  +Q          T  +V  D+   ++++++   + + 
Sbjct: 172 SLSFEPSEKPIFN------AKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQG 225

Query: 243 KASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAE 292
            A+E+ AR  AMDNA++NAG M++   + YNR RQ  IT EL++II GA 
Sbjct: 226 YAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGAS 275


>2xok_G ATP synthase subunit gamma, mitochondrial; hydrolase, ATP-binding, F(O), F(1), mitochondr inner membrane, transmembrane; HET: ANP; 3.01A {Saccharomyces cerevisiae} Length = 311 Back     alignment and structure
>2qe7_G ATP synthase subunit gamma; blockage of ATP hydrolysis, F1-ATPase, single particle analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} Length = 286 Back     alignment and structure
>2hld_G ATP synthase gamma chain, mitochondrial; ATP phosphorylase (H+ transporting), F1FO, F1- ATPase, hydrolase; HET: ANP; 2.80A {Saccharomyces cerevisiae} PDB: 3fks_G Length = 278 Back     alignment and structure
>2ck3_G ATP synthase gamma chain; ATP phosphorylase, ATP phosphorylase (H+ transporting), F1FO ATP synthase, F1-ATPase, hydrolase, ATP synthesis; HET: ANP ADP; 1.9A {Bos taurus} SCOP: c.49.2.1 PDB: 1cow_G* 1bmf_G* 1e1q_G* 1e1r_G* 1efr_G* 1e79_G* 1h8h_G* 1nbm_G* 1ohh_G* 1qo1_G 1w0j_G* 1w0k_G* 1h8e_G* 2jiz_G* 2jj1_G* 2jj2_G* 2v7q_G* 2w6j_G 2w6e_G 2w6g_G ... Length = 272 Back     alignment and structure
>1fs0_G ATP synthase gamma subunit; coiled coil, epsilon, hydrolase; 2.10A {Escherichia coli} SCOP: c.49.2.1 Length = 230 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target294 F0F1 ATP synthase subunit gamma [Candidatus Liberibacte
2xok_G311 ATP synthase subunit gamma, mitochondrial; hydrolase, A 100.0
3oee_G278 ATP synthase subunit gamma; ATP phosphatase, F1F0 ATPas 100.0
2ck3_G272 ATP synthase gamma chain; ATP phosphorylase, ATP phosph 100.0
2qe7_G286 ATP synthase subunit gamma; blockage of ATP hydrolysis, 100.0
1fs0_G230 ATP synthase gamma subunit; coiled coil, epsilon, hydro 100.0
>2xok_G ATP synthase subunit gamma, mitochondrial; hydrolase, ATP-binding, F(O), F(1), mitochondr inner membrane, transmembrane; HET: ANP; 3.01A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=0  Score=561.45  Aligned_cols=277  Identities=26%  Similarity=0.344  Sum_probs=232.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             98879999999987568999999999999999999999983023699999999999730157544210002443334325
Q gi|254780616|r    1 MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYL   80 (294)
Q Consensus         1 M~~lk~ik~RI~sv~~~~KITkaMkmVA~skl~ka~~~~~~~~~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (294)
                      ||||||||+||+||+||+||||||||||+|||||||+++..++||.+.+..++.++...     .++....+ ...++.+
T Consensus        33 Ma~LkeIk~RI~SVk~t~KITkAMkmVAasKlrkaq~~~~~~r~y~~~~~~~~~~~~~~-----~~~~~~~~-~~~~k~l  106 (311)
T 2xok_G           33 YATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETK-----NLDVEATE-TGAPKEL  106 (311)
T ss_dssp             -CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSSTTHHHHHHHHHHHTTCC-----C------------CEE
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----CCCCCCCC-CCCCCEE
T ss_conf             88289999999985598999999999999999999999986133999999998623113-----66400013-5788559


Q ss_pred             EEECCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECH-HHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHH
Q ss_conf             53114642442001147999999987653203885038887040-37985102333201111147766403688999997
Q gi|254780616|r   81 LVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRK-GYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIAR  159 (294)
Q Consensus        81 ~IvitSDrGLCG~~Ns~i~k~~~~~i~~~~~~~~~~~l~~vGkK-g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~I~~  159 (294)
                      +|||||||||||+||++|+|.+.+++++    +++..++++|.| |..++++.+.... ........+.++|.++..|++
T Consensus       107 ~IvitSDrGLCG~fNsnlik~~~~~i~~----~~~~~~~~ig~k~~~~~~~~~~~~~~-~~~~~~~~~~p~~~~a~~I~~  181 (311)
T 2xok_G          107 IVAITSDKGLCGSIHSQLAKAVRRHLND----QPNADIVTIGDKIKMQLLRTHPNNIK-LSINGIGKDAPTFQESALIAD  181 (311)
T ss_dssp             EEEECCSCCSSTTHHHHHHHHHHHSSSS----CTTCEEEEESHHHHHHHHTTSTTTEE-EEEESCTTSCCCHHHHHHHHH
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHC----CCCCCEEEEEEEEHHHHHHHCCCCCC-EEEEECCCCCCCHHHHHHHHH
T ss_conf             9999689742678999999999876410----36652799962105766532166651-366303567997999888899


Q ss_pred             HHHHHHHCCCCCCEEEEECCCCCCCCCCEEEEECCCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             65576506787505886201134432220442047887354221100365543224799678789999989999999999
Q gi|254780616|r  160 QITSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWII  239 (294)
Q Consensus       160 ~l~~~~~~~~~d~v~iiYn~f~s~~~q~p~~~~llP~~~~~~~~~~~~~~~~~~~~Ep~~~~il~~l~~~yl~~~l~~al  239 (294)
                      .+++.|.+|++|+|+++||+|+|+++|+|+.++++|.+....   ..+   ..+.++|++++++++|+|.|+.++||+|+
T Consensus       182 ~i~~~~~~g~~d~V~iiYn~F~s~~~q~p~~~~l~p~~~~~~---~~~---~~~~~~~~~~~~l~~ll~~yl~~~i~~al  255 (311)
T 2xok_G          182 KLLSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQ---SPS---FGKFEIDTDANVPRDLFEYTLANQMLTAM  255 (311)
T ss_dssp             HHHHTTCCTTCSEEEEEEEECSSSSCCEEEEEEECCHHHHHH---SGG---GGGSCCCCCSSHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCCCEEEEEEEECCCCEEEEECCCCCCCCHHHHC---CCC---CCEEEECCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             999988668974489984002100365443213576013202---665---66135303113255667889999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9999999999999999999989999999999999998988988999998525319
Q gi|254780616|r  240 LENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV  294 (294)
Q Consensus       240 les~aSE~aaRm~AM~~At~Na~~~i~~L~l~~Nk~RQ~~IT~El~EIisGaeAl  294 (294)
                      +||++|||+|||+|||+|||||+||+++|+++|||+||++||+||+|||||||||
T Consensus       256 les~aSE~aaRm~AM~~At~Na~eli~~L~l~yNk~RQa~IT~El~EIVsGaeAl  310 (311)
T 2xok_G          256 AQGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGASSL  310 (311)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999999959999999999999999998899999999889864



>3oee_G ATP synthase subunit gamma; ATP phosphatase, F1F0 ATPase, ATP synthesis, H ADP, PO4, mitochondria; HET: ANP; 2.74A {Saccharomyces cerevisiae} PDB: 2wpd_G* 3fks_G 2hld_G* 3oeh_G* 3ofn_G* 3oe7_G* Back     alignment and structure
>2ck3_G ATP synthase gamma chain; ATP phosphorylase, ATP phosphorylase (H+ transporting), F1FO ATP synthase, F1-ATPase, hydrolase, ATP synthesis; HET: ANP ADP; 1.9A {Bos taurus} SCOP: c.49.2.1 PDB: 1cow_G* 1bmf_G* 1e1q_G* 1e1r_G* 1efr_G* 1e79_G* 1h8h_G* 1nbm_G* 1ohh_G* 1qo1_G 1w0j_G* 1w0k_G* 1h8e_G* 2jiz_G* 2jj1_G* 2jj2_G* 2v7q_G* 2wss_G* 2xnd_G* 2w6j_G ... Back     alignment and structure
>2qe7_G ATP synthase subunit gamma; blockage of ATP hydrolysis, F1-ATPase, single particle analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} Back     alignment and structure
>1fs0_G ATP synthase gamma subunit; coiled coil, epsilon, hydrolase; 2.10A {Escherichia coli} SCOP: c.49.2.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 294 F0F1 ATP synthase subunit gamma [Candidatus Liberibacte
d2jdig1272 c.49.2.1 (G:1-272) ATP synthase (F1-ATPase), gamma subu 7e-45
d1fs0g_230 c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit { 4e-33
>d2jdig1 c.49.2.1 (G:1-272) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 272 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Pyruvate kinase C-terminal domain-like
superfamily: ATP synthase (F1-ATPase), gamma subunit
family: ATP synthase (F1-ATPase), gamma subunit
domain: ATP synthase (F1-ATPase), gamma subunit
species: Cow (Bos taurus) [TaxId: 9913]
 Score =  174 bits (442), Expect = 7e-45
 Identities = 80/290 (27%), Positives = 143/290 (49%), Gaps = 21/290 (7%)

Query: 3   SLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHF 62
           +LK+   R+ S+K  QKIT++M++++  K  RA+  ++ A  Y                 
Sbjct: 2   TLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGSLAL---------- 51

Query: 63  QEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIG 122
             Y    ++     K +L++  ++++GLCG  ++ + +  +       A GKE+K++ +G
Sbjct: 52  --YEKADIKTPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKSEAANLAAAGKEVKIIGVG 109

Query: 123 RKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEFKS 182
            K    L +  S   + + +   ++   F  A  IA ++  L +   FD    I++ F+S
Sbjct: 110 DKIRSILHRTHSDQFLVTFKEVGRRPPTFGDASVIALEL--LNSGYEFDEGSIIFNRFRS 167

Query: 183 IIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILEN 242
           +I        I  +D     E           Y+     VL +    S+++ +++ + E+
Sbjct: 168 VISYKTEEKPIFSLDTISSAESM-------SIYDDIDADVLRNYQEYSLANIIYYSLKES 220

Query: 243 KASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAE 292
             SE  AR+TAMDNA++NA +M+D L L++NR RQ  IT ELIEII+GA 
Sbjct: 221 TTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAA 270


>d1fs0g_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Escherichia coli [TaxId: 562]} Length = 230 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target294 F0F1 ATP synthase subunit gamma [Candidatus Liberibacte
d2jdig1272 ATP synthase (F1-ATPase), gamma subunit {Cow (Bos tauru 100.0
d1fs0g_230 ATP synthase (F1-ATPase), gamma subunit {Escherichia co 100.0
>d2jdig1 c.49.2.1 (G:1-272) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Pyruvate kinase C-terminal domain-like
superfamily: ATP synthase (F1-ATPase), gamma subunit
family: ATP synthase (F1-ATPase), gamma subunit
domain: ATP synthase (F1-ATPase), gamma subunit
species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00  E-value=0  Score=543.54  Aligned_cols=272  Identities=29%  Similarity=0.454  Sum_probs=237.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             88799999999875689999999999999999999999830236999999999997301575442100024433343255
Q gi|254780616|r    2 TSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLL   81 (294)
Q Consensus         2 ~~lk~ik~RI~sv~~~~KITkaMkmVA~skl~ka~~~~~~~~~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (294)
                      |||+|||+||+||++|+||||||+|||+|||||+|++++++|||+.....++.+            +.+..+...++.++
T Consensus         1 A~Lkeik~RI~Sv~~t~kITkAMkmVAasKlrkaq~~~~~~r~Y~~~~~~~~~~------------~~~~~~~~~~~~l~   68 (272)
T d2jdig1           1 ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGSLALYEK------------ADIKTPEDKKKHLI   68 (272)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC-------------------------------CC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCC------------CCCHHCCCCCCCEE
T ss_conf             986999999999879999999999999999999999998427658886886505------------32010134565116


Q ss_pred             EECCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHH
Q ss_conf             31146424420011479999999876532038850388870403798510233320111114776640368899999765
Q gi|254780616|r   82 VICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQI  161 (294)
Q Consensus        82 IvitSDrGLCG~~Ns~i~k~~~~~i~~~~~~~~~~~l~~vGkKg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~I~~~l  161 (294)
                      |||||||||||+||++|+|.+.+.+.+...++.++.++.+|+||.+++.+.+.......+.......+++..+..+...+
T Consensus        69 IvitSDrGLcG~fN~~iik~~~~~i~~~~~~~~~~~l~~~G~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~  148 (272)
T d2jdig1          69 IGVSSDRGLCGAIHSSVAKQMKSEAANLAAAGKEVKIIGVGDKIRSILHRTHSDQFLVTFKEVGRRPPTFGDASVIALEL  148 (272)
T ss_dssp             CCBCCSCCCSTTHHHHHC------------------CCCBSHHHHHHC----------CBCSCSSSCCCHHHHHHHHHHC
T ss_pred             EEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             99865777777764218999999988752168722898504302445553035212332200577775067789999999


Q ss_pred             HHHHHCCCCCCEEEEECCCCCCCCCCEEEEECCCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             57650678750588620113443222044204788735422110036554322479967878999998999999999999
Q gi|254780616|r  162 TSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILE  241 (294)
Q Consensus       162 ~~~~~~~~~d~v~iiYn~f~s~~~q~p~~~~llP~~~~~~~~~~~~~~~~~~~~Ep~~~~il~~l~~~yl~~~l~~alle  241 (294)
                      ..  ..+++|+|+|+||+|+|+++|.|..++++|+++.       +.....|.|||+++++|+.|+|.|++++||+|++|
T Consensus       149 ~~--~~~~~d~v~i~y~~f~~~~~q~p~~~~l~p~~~~-------~~~~~~~~~~~~~~~vl~~l~~~yl~~~ly~a~~e  219 (272)
T d2jdig1         149 LN--SGYEFDEGSIIFNRFRSVISYKTEEKPIFSLDTI-------SSAESMSIYDDIDADVLRNYQEYSLANIIYYSLKE  219 (272)
T ss_dssp             ------------CCCCCEECSSSCEECC---------------------------------------HHHHHHHHHHHHH
T ss_pred             HH--HHHHCCEEEEEEECCCCCCCCCCEEECCCCCCCC-------CCCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98--6642340379961245554122046416666630-------00000000134437899999999899999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999999999999999989999999999999998988988999998525319
Q gi|254780616|r  242 NKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV  294 (294)
Q Consensus       242 s~aSE~aaRm~AM~~At~Na~~~i~~L~l~~Nk~RQ~~IT~El~EIisGaeAl  294 (294)
                      |+||||+|||+||++|||||+||+++|+++|||+||++||+||+|||||||||
T Consensus       220 s~aSE~aaRm~AM~~At~Na~eli~~L~~~yNr~RQ~~IT~El~EIv~GaeAl  272 (272)
T d2jdig1         220 STTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL  272 (272)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             89999999999999999849999999999999999999999999999778439



>d1fs0g_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 294 F0F1 ATP synthase subunit gamma [Candidatus Liberi
2qe7_G_286 (G:) ATP synthase subunit gamma; blockage of ATP h 6e-55
2hld_G_278 (G:) ATP synthase gamma chain, mitochondrial; ATP 2e-53
2ck3_G_272 (G:) ATP synthase gamma chain; ATP phosphorylase, 3e-52
1fs0_G_230 (G:) ATP synthase gamma subunit; coiled coil, epsi 2e-39
>2qe7_G (G:) ATP synthase subunit gamma; blockage of ATP hydrolysis, F1-ATPase, single particle analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP}Length = 286 Back     alignment and structure
 Score =  208 bits (531), Expect = 6e-55
 Identities = 95/294 (32%), Positives = 155/294 (52%), Gaps = 9/294 (3%)

Query: 1   MTSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGE 60
           M  ++E K RI SVK T++IT+AM++++  KLRRA+E  +NA  Y   IK+         
Sbjct: 1   MQGMREIKRRIRSVKNTRQITKAMKMVAAAKLRRAQETAENARPYADKIKEVISSIAA-- 58

Query: 61  HFQEYPSPFVRGTGKDKVYLLVICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLI 120
             +++  P +      K    ++ T+++GL G +NA I+R     I+E      E  +  
Sbjct: 59  GTKDFSHPML-EARPVKKTGYMVITSDRGLAGPYNANILRLVSKTIEERHQSKDEYVIFA 117

Query: 121 IGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQITSLFTSNVFDLCFFIYSEF 180
           +GRKG +  +K    ++ +   +S        +   IA+    +F    FD     Y+EF
Sbjct: 118 VGRKGRDFFKKRGYPVVEEVTGISDT--PSLTEIQDIAQSAIGMFADETFDKLTIFYNEF 175

Query: 181 KSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIIL 240
            S I Q P+  +++P+      E+     +S Y YE    SVL+ ++ +   + ++  +L
Sbjct: 176 VSPIVQRPVEKQLLPLT----SEEVLDGPVSAYEYEPDSESVLEVLLPKYAETLIYSALL 231

Query: 241 ENKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV 294
           + KASE GAR+TAM NAT NA +M++ L L +NR RQ  IT E+ EI+AGA  +
Sbjct: 232 DAKASEFGARMTAMGNATDNATEMLETLTLQFNRARQAAITQEIAEIVAGANAL 285


>2hld_G (G:) ATP synthase gamma chain, mitochondrial; ATP phosphorylase (H+ transporting), F1FO, F1- ATPase, hydrolase; HET: ANP; 2.80A {Saccharomyces cerevisiae} PDB: 3fks_GLength = 278 Back     alignment and structure
>2ck3_G (G:) ATP synthase gamma chain; ATP phosphorylase, ATP phosphorylase (H+ transporting), F1FO ATP synthase, F1-ATPase, hydrolase, ATP synthesis; HET: ANP ADP; 1.9A {Bos taurus}Length = 272 Back     alignment and structure
>1fs0_G (G:) ATP synthase gamma subunit; coiled coil, epsilon, hydrolase; 2.10A {Escherichia coli}Length = 230 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target294 F0F1 ATP synthase subunit gamma [Candidatus Liberibacte
2hld_G_278 ATP synthase gamma chain, mitochondrial; ATP phosp 100.0
2ck3_G_272 ATP synthase gamma chain; ATP phosphorylase, ATP p 100.0
2qe7_G_286 ATP synthase subunit gamma; blockage of ATP hydrol 100.0
1fs0_G_230 ATP synthase gamma subunit; coiled coil, epsilon, 100.0
>2hld_G (G:) ATP synthase gamma chain, mitochondrial; ATP phosphorylase (H+ transporting), F1FO, F1- ATPase, hydrolase; HET: ANP; 2.80A {Saccharomyces cerevisiae} PDB: 3fks_G Back     alignment and structure
Probab=100.00  E-value=0  Score=538.10  Aligned_cols=277  Identities=25%  Similarity=0.358  Sum_probs=237.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             88799999999875689999999999999999999999830236999999999997301575442100024433343255
Q gi|254780616|r    2 TSLKEFKSRIHSVKETQKITEAMQLISVTKLRRAKEAIQNASSYQFHIKDFFMKCVVGEHFQEYPSPFVRGTGKDKVYLL   81 (294)
Q Consensus         2 ~~lk~ik~RI~sv~~~~KITkaMkmVA~skl~ka~~~~~~~~~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (294)
                      |||++||+||+||++|+|||+||||||++|++|+|+++++.+||++.+.+++.+++..     .+++....++ .++.++
T Consensus         1 Aslk~ik~RI~sv~~i~kIt~AMkmVA~akl~ka~~~~~~~~~y~~~i~~~~~~l~~~-----~~~~~~~~~~-~~~~~~   74 (278)
T 2hld_G            1 ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETK-----NLDVEATETG-APKELI   74 (278)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCC-----C------------CCEE
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----CCCHHHCCCC-CCCEEE
T ss_conf             9859999999998799999999999999999999999986053999999998734222-----6530000247-875169


Q ss_pred             EECCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHH
Q ss_conf             31146424420011479999999876532038850388870403798510233320111114776640368899999765
Q gi|254780616|r   82 VICTAEKGLCGGFNAQIIRFARDRIKEFIAEGKEIKLLIIGRKGYEGLRKEFSSMIIDSIELSSKKGVDFVQAHGIARQI  161 (294)
Q Consensus        82 IvitSDrGLCG~~Ns~i~k~~~~~i~~~~~~~~~~~l~~vGkKg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~I~~~l  161 (294)
                      |||||||||||+||++|+|.+.+++++..   +...++++|+++..++++.+...... ......++++|..+..|++.+
T Consensus        75 IvitSDrGLCG~fN~~iik~~~~~i~~~~---~~~~~~v~~k~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~i~~~~  150 (278)
T 2hld_G           75 VAITSDKGLCGSIHSQLAKAVRRHLNDQP---NADIVTIGDKIKMQLLRTHPNNIKLS-INGIGKDAPTFQESALIADKL  150 (278)
T ss_dssp             EEECCSCCCSTTHHHHHHHHHHHHHHSCT---TCEEEEESHHHHHHHHHHCTTTEEEE-EECCSSSCCCHHHHHHHHHHH
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCCC---CCCCEEECCHHHHHHHHCCCCEEEEE-EECCCCCCCCHHHHHHHHHHH
T ss_conf             98528975067789999999986311234---44402332204776540346502333-301577889799887788999


Q ss_pred             HHHHHCCCCCCEEEEECCCCCCCCCCEEEEECCCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             57650678750588620113443222044204788735422110036554322479967878999998999999999999
Q gi|254780616|r  162 TSLFTSNVFDLCFFIYSEFKSIIQQIPIISKIIPVDWSQDLEQKQQDILSVYRYESTLYSVLDDIVLRSISSRVFWIILE  241 (294)
Q Consensus       162 ~~~~~~~~~d~v~iiYn~f~s~~~q~p~~~~llP~~~~~~~~~~~~~~~~~~~~Ep~~~~il~~l~~~yl~~~l~~alle  241 (294)
                      ++.|.++++|+|+|+||+|+|+++|+|+++++||+++...     ....+.|+++| ++++|++|+|.|++++||+|++|
T Consensus       151 ~~~~~~~~~d~v~iiyn~f~~~~~q~~~~~~llP~~~~~~-----~~~~~~~~~~~-~~~il~~l~~~yl~~~l~~a~~e  224 (278)
T 2hld_G          151 LSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQ-----SPSFGKFEIDT-DANVPRDLFEYTLANQMLTAMAQ  224 (278)
T ss_dssp             HHTSCGGGCSCEEEEEEEESSSSCEEEEEEECCCHHHHHT-----CTTGGGSCCCC-SSCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHCCCCCCEEEEECCCCCCCCCCCHHHHHCCCCCCCC-----CCCCCCCCCCC-CCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9987446752104552112443345606764021000113-----65544332253-20038999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999999999999999989999999999999998988988999998525319
Q gi|254780616|r  242 NKASEVGARITAMDNATRNAGQMVDNLVLSYNRQRQMRITTELIEIIAGAEVV  294 (294)
Q Consensus       242 s~aSE~aaRm~AM~~At~Na~~~i~~L~l~~Nk~RQ~~IT~El~EIisGaeAl  294 (294)
                      |++|||+|||+||++|||||+|++++|+++|||+||++||+||+|||||||||
T Consensus       225 s~~sE~~aR~~aM~~At~Na~~~i~~L~~~yNk~RQ~~IT~El~EIvsGaeal  277 (278)
T 2hld_G          225 GYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGASSL  277 (278)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99999999999999899979999999999999999998899999999889864



>2ck3_G (G:) ATP synthase gamma chain; ATP phosphorylase, ATP phosphorylase (H+ transporting), F1FO ATP synthase, F1-ATPase, hydrolase, ATP synthesis; HET: ANP ADP; 1.9A {Bos taurus} Back     alignment and structure
>2qe7_G (G:) ATP synthase subunit gamma; blockage of ATP hydrolysis, F1-ATPase, single particle analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} Back     alignment and structure
>1fs0_G (G:) ATP synthase gamma subunit; coiled coil, epsilon, hydrolase; 2.10A {Escherichia coli} Back     alignment and structure