254780617

254780617

F0F1 ATP synthase subunit alpha

GeneID in NCBI database:8209617Locus tag:CLIBASIA_02520
Protein GI in NCBI database:254780617Protein Accession:YP_003065030.1
Gene range:+(656239, 657768)Protein Length:509aa
Gene description:F0F1 ATP synthase subunit alpha
COG prediction:[C] F0F1-type ATP synthase, alpha subunit
KEGG prediction:atpA; F0F1 ATP synthase subunit alpha (EC:3.6.3.14); K02111 F-type H+-transporting ATPase subunit alpha [EC:3.6.3.14]
SEED prediction:ATP synthase alpha chain (EC 3.6.3.14)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:F0F1-type ATP synthase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51
MDIHAAEISDILRKRIKDFGNDSEFSEIGRVLSIGDGIARVYGLNNIRAGEMVQFSHGVYGMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMSSFSKFSSDLDSSTQKFLSKGERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAVSQVRKFETNFLSHMRVSSQDILEDIRKQKVLTDDIRSKLINEIKVFLEDFN
ccccHHHHHHHHHHHHHHcccccccccEEEEEEEEccEEEEEcccccccccEEEEcccEEEEEEEEcccEEEEEEcccccccccccEEEEccccccccccHHHHHHHHcccccccccccccccccccccccccccHHHHccccccHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHccccccccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHcccHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccEEEEEEEEccccccccHHHHHHHHHccEEEEEEHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHHccccEccccEEEEEEEEccEEEEEEccccEccEEEEEccccEEEEEEEccccEEEEEcccHHHcccccEEEEEEEEcEEEccHHHcccEEcccccEcccccccccccEEEccccccccccEcccccEcccccHHHHHHcccEcccEcEEEEcccccHHHHHHHHHHHcHHHHccccHHHccEEEEEEEcccHHHHHHHHHHHHHHccHHHEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHHHccccccHHHccccHHHHHHHHHccccEEcHHHcccEEEEEEEEEccccccccHHHHHHHccccEEEEEcHHHHHHcccccEcccccEEccHHHHccHHHHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHc
MDIHAAEISDILRKRIKdfgndsefseIGRVLSIGDGIARVYglnniragemvqfSHGVYGMALNLEVDNVGVVILGsykeisegdivkrtgrivdvpVGLELLGRVVDalgnpidgkgpikceqrscteadapgiiqrqsvceplstgikaidslipigrgqreliigdrktgktSIILDTFlnqksshdkgsekdKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVAsasdpapmqllapfagcamgeyfrdngYHALIAYDDLQKHAVAYRQLSLLlrrppgreaypgdvFYLHSRLLERAAKMSdalgagsltalpVIETqvndvsayiptnvisitdgqifLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYRemssfskfssdldsstQKFLSKGERLTEllkqpqfsplamEEQVVMIFAGISGCLDEVAVSQVRKFETNFLSHMRVSSQDILEDIRKQKVLTDDIRSKLINEIKVFLEDFN
MDIHAAEISDILRKRIKdfgndsefseigrvLSIGDGIARVYGLNNIRAGEMVQFSHGVYGMALNLEVDNVGVVILGSykeisegdivkrtgrivDVPVGLELLGRVVDAlgnpidgkgpikceqRSCTEADAPGIIQRQSVCEPLSTGIKAidslipigrgqreliigdrktgktsIILDTflnqksshdkgsekdKVYCIYVaigqkrssVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMSSfskfssdldsSTQKFLSKGERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAVSQVRKFETNFlshmrvssqdiledirkqkvltddirSKLINEIKVFLEDFN
MDIHAAEISDILRKRIKDFGNDSEFSEIGRVLSIGDGIARVYGLNNIRAGEMVQFSHGVYGMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMssfskfssdldssTQKFLSKGERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAVSQVRKFETNFLSHMRVSSQDILEDIRKQKVLTDDIRSKLINEIKVFLEDFN
*****AE*SDILRKRIKDFGNDSEFSEIGRVLSIGDGIARVYGLNNIRAGEMVQFSHGVYGMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMSSFSKFSSDLDSSTQKFLSKGERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAVSQVRKFETNFLSHMRVSSQDILEDIRK******DIRSKLINEIKVFLEDF*
MDIHAAEISDILRKRIKDFGNDSEFSEIGRVLSIGDGIARVYGLNNIRAGEMVQFSHGVYGMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMS***************FLSKGERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAVSQVRKFETNFLSHMRVSSQDILEDIRKQKVLTDDIRSKLINEIKVFLEDFN
*DIHAAEISDILRKRIKDFGNDSEFSEIGRVLSIGDGIARVYGLNNIRAGEMVQFSHGVYGMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMSSFSKFSSDLDSSTQKFLSKGERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAVSQVRKFETNFLSHMRVSSQDILEDIRKQKVLTDDIRSKLINEIKVFLEDFN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIHAAEISDILRKRIKDFGNDSEFSEIGRVLSIGDGIARVYGLNNIRAGEMVQFSHGVYGMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMSSFSKFSSDLDSSTQKFLSKGERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAVSQVRKFETNFLSHMRVSSQDILEDIRKQKVLTDDIRSKLINEIKVFLEDFN
MDIHAAEISDILRKRIKDFGNDSEFSEIGRVLSIGDGIARVYGLNNIRAGEMVQFSHGVYGMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMSSFSKFSSDLDSSTQKFLSKGERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAVSQVRKFETNFLSHMRVSSQDILEDIRKQKVLTDDIRSKLINEIKVFLEDFN
MDIHAAEISDILRKRIKDFGNDSEFSEIGRVLSIGDGIARVYGLNNIRAGEMVQFSHGVYGMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMSSFSKFSSDLDSSTQKFLSKGERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAVSQVRKFETNFLSHMRVSSQDILEDIRKQKVLTDDIRSKLINEIKVFLEDFN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target509 F0F1 ATP synthase subunit alpha [Candidatus Liberibacte
254780684438 flagellum-specific ATP synthase [Candidatus Liberi 5e-26
254780615478 F0F1 ATP synthase subunit beta [Candidatus Liberib 3e-21
254780810423 transcription termination factor Rho [Candidatus L 3e-04
254780879652 hypothetical protein CLIBASIA_03880 [Candidatus Li 0.022
>gi|254780684|ref|YP_003065097.1| flagellum-specific ATP synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score =  110 bits (275), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 97/345 (28%), Positives = 158/345 (45%), Gaps = 25/345 (7%)

Query: 61  GMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDG--- 117
           G  + + +D V +  +G  +EIS GD+V   GR    P      GRV++ALG PIDG   
Sbjct: 60  GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSAC-WCGRVINALGKPIDGDDS 118

Query: 118 --KGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGK 175
             KG +  E  S      P  + RQ V +   TGI+ ID   P+  GQR  +      GK
Sbjct: 119 LGKGDLSMEIMS----KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGK 174

Query: 176 TSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVK-ALEDRGALSYSIVVVA 234
           ++++  +   +    DK         I   +G++   V  F++  L D   L  S+VVVA
Sbjct: 175 STLL--SMFARSDCFDK--------VIISLVGERGREVREFIEDYLGDN--LKKSVVVVA 222

Query: 235 SASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAY 294
           ++ +   ++ +AP     + EYF   G + L+  D + + A + R+++      P    Y
Sbjct: 223 TSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGY 282

Query: 295 PGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLET 354
           P  VF    RLLER          G++TA+  +    ++ +  I  +V SI DG I L  
Sbjct: 283 PTSVFSELPRLLERIGPSEKE--KGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340

Query: 355 ELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYRE 399
            L  +G  P ++   SVSR+   A     K++  ++   + ++ E
Sbjct: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEE 385

>gi|254780615|ref|YP_003065028.1| F0F1 ATP synthase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Back     alignment
 Score = 94.4 bits (233), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 132/297 (44%), Gaps = 23/297 (7%)

Query: 82  ISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQS 141
           +S GD V  TG  + VPVG   LGR+++ +G P+D +G I   ++      +P   ++ +
Sbjct: 69  LSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQST 128

Query: 142 VCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYC 201
               L+TGIK ID + P  +G +  + G    GKT +I++   N   +H         Y 
Sbjct: 129 DASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGG-------YS 181

Query: 202 IYVAIGQK-RSSVARFVKALEDRGAL-----------SYSIVVVASASDPAPMQLLAPFA 249
           ++  +G++ R     + + ++ +  +           S   ++    ++P   +      
Sbjct: 182 VFAGVGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALT 241

Query: 250 GCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERA 309
           G  + E+FRD G   L   D++ +   A  ++S LL R P    Y   +      L ER 
Sbjct: 242 GLTVAEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQER- 300

Query: 310 AKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAIN 366
             ++  L  GS+T++  I    +D++   P    +  D    L  ++  +GI PAI+
Sbjct: 301 --ITTTL-KGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAID 354

>gi|254780810|ref|YP_003065223.1| transcription termination factor Rho [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Back     alignment
 Score = 38.5 bits (88), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 13/131 (9%)

Query: 151 KAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKR 210
           + ID + PIG+GQR LI+   +TGKT ++      Q  +H       + Y I + I ++ 
Sbjct: 163 RVIDLIAPIGKGQRSLIVAPPRTGKTILL------QNIAHSIKKNHPECYLIVLLIDERP 216

Query: 211 SSVARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDD 270
             V    ++++  G +  S    ++A      +++   A C + EY    G   +I  D 
Sbjct: 217 EEVTDMQRSVQ--GEVISSTFDESAARHVQVAEMVIAKAKCLV-EY----GLDVVILLDS 269

Query: 271 LQKHAVAYRQL 281
           + +   AY  L
Sbjct: 270 ITRLCRAYNVL 280

>gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Back     alignment
 Score = 32.0 bits (71), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 175 KTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVA 234
           K +  L+TF +   ++++ S+  ++  I+   G+ R+   RF+  ++  G++ Y      
Sbjct: 422 KPTDFLETFFSVNHANNQASDDSELLYIHARFGETRTRFYRFLNPVD--GSVEY-FNENG 478

Query: 235 SASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQ 272
            +S P  ++   PF     G   R   YH ++ Y  + 
Sbjct: 479 KSSRPFLLRTPVPFGRMTSGFGMR---YHPILGYSRMH 513

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target509 F0F1 ATP synthase subunit alpha [Candidatus Liberibacte
315121817509 F0F1 ATP synthase subunit alpha [Candidatus Liberibacte 1 0.0
319780915509 ATP synthase F1 subunit alpha [Mesorhizobium ciceri bio 1 0.0
13473458509 F0F1 ATP synthase subunit alpha [Mesorhizobium loti MAF 1 0.0
260466812509 ATP synthase F1, alpha subunit [Mesorhizobium opportuni 1 0.0
62290666509 F0F1 ATP synthase subunit alpha [Brucella abortus bv. 1 1 0.0
161619721509 F0F1 ATP synthase subunit alpha [Brucella canis ATCC 23 1 0.0
306841514509 ATP synthase F1, alpha subunit [Brucella sp. BO2] Lengt 1 0.0
239832879509 ATP synthase F1, alpha subunit [Ochrobactrum intermediu 1 0.0
256160498509 F0F1 ATP synthase subunit alpha [Brucella ceti M490/95/ 1 0.0
254719789509 F0F1 ATP synthase subunit alpha [Brucella sp. 83/13] Le 1 0.0
>gi|315121817|ref|YP_004062306.1| F0F1 ATP synthase subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509 Back     alignment and organism information
 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/509 (84%), Positives = 473/509 (92%)

Query: 1   MDIHAAEISDILRKRIKDFGNDSEFSEIGRVLSIGDGIARVYGLNNIRAGEMVQFSHGVY 60
           MDIHAAE+SDILRKRIK+F NDS+FSEIG VLS+GDGIARVYGLN I+A EMV F+ GVY
Sbjct: 1   MDIHAAEVSDILRKRIKNFSNDSDFSEIGYVLSVGDGIARVYGLNKIKAEEMVLFACGVY 60

Query: 61  GMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDGKGP 120
           GMA +LE DNVGV+ILGS K+ISEGDIVKRTGRIVDVPVG ELLGRVVDALGNPIDGKGP
Sbjct: 61  GMAFSLEADNVGVIILGSDKDISEGDIVKRTGRIVDVPVGPELLGRVVDALGNPIDGKGP 120

Query: 121 IKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIIL 180
           I+C+++SC EA+APGIIQRQSVCEPLSTGIKAID+LIPIG GQRELIIGDRKTGKTSIIL
Sbjct: 121 IECKKKSCIEANAPGIIQRQSVCEPLSTGIKAIDALIPIGLGQRELIIGDRKTGKTSIIL 180

Query: 181 DTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVASASDPA 240
           D FLNQK+SH+K  E+DKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVV A+ASDP 
Sbjct: 181 DAFLNQKTSHEKNVERDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVAATASDPV 240

Query: 241 PMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFY 300
            MQ+LAPF GC++GEYFRDNGYHALIAYDDL KHAVAYRQ+SLLLRR PGREAYPGD+FY
Sbjct: 241 SMQVLAPFTGCSIGEYFRDNGYHALIAYDDLYKHAVAYRQISLLLRRSPGREAYPGDIFY 300

Query: 301 LHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQG 360
           LHSRLLERAAKMSDALG GSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQG
Sbjct: 301 LHSRLLERAAKMSDALGGGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLETELFYQG 360

Query: 361 IRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMSSFSKFSSDLDSSTQKFLSK 420
           IRPA+NIGLSVSRVGSAAQVKAMKQVSGAVKG+LAQYREM SF+KF SDLD STQ FLS+
Sbjct: 361 IRPAVNIGLSVSRVGSAAQVKAMKQVSGAVKGDLAQYREMLSFAKFGSDLDVSTQSFLSR 420

Query: 421 GERLTELLKQPQFSPLAMEEQVVMIFAGISGCLDEVAVSQVRKFETNFLSHMRVSSQDIL 480
           GERLTELLKQPQFSPL MEEQVVMIF+G++G LD++ VSQ+ +FE+  LS+MR SS+ +L
Sbjct: 421 GERLTELLKQPQFSPLKMEEQVVMIFSGVNGYLDKIEVSQIGRFESGLLSYMRSSSKGVL 480

Query: 481 EDIRKQKVLTDDIRSKLINEIKVFLEDFN 509
           EDIR+QKVLTDDI++KL  EI+VFL+DFN
Sbjct: 481 EDIREQKVLTDDIKNKLKGEIEVFLKDFN 509


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319780915|ref|YP_004140391.1| ATP synthase F1 subunit alpha [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 509 Back     alignment and organism information
>gi|13473458|ref|NP_105025.1| F0F1 ATP synthase subunit alpha [Mesorhizobium loti MAFF303099] Length = 509 Back     alignment and organism information
>gi|260466812|ref|ZP_05812997.1| ATP synthase F1, alpha subunit [Mesorhizobium opportunistum WSM2075] Length = 509 Back     alignment and organism information
>gi|62290666|ref|YP_222459.1| F0F1 ATP synthase subunit alpha [Brucella abortus bv. 1 str. 9-941] Length = 509 Back     alignment and organism information
>gi|161619721|ref|YP_001593608.1| F0F1 ATP synthase subunit alpha [Brucella canis ATCC 23365] Length = 509 Back     alignment and organism information
>gi|306841514|ref|ZP_07474213.1| ATP synthase F1, alpha subunit [Brucella sp. BO2] Length = 509 Back     alignment and organism information
>gi|239832879|ref|ZP_04681208.1| ATP synthase F1, alpha subunit [Ochrobactrum intermedium LMG 3301] Length = 509 Back     alignment and organism information
>gi|256160498|ref|ZP_05458187.1| F0F1 ATP synthase subunit alpha [Brucella ceti M490/95/1] Length = 509 Back     alignment and organism information
>gi|254719789|ref|ZP_05181600.1| F0F1 ATP synthase subunit alpha [Brucella sp. 83/13] Length = 509 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target509 F0F1 ATP synthase subunit alpha [Candidatus Liberibacte
CHL00059485 CHL00059, atpA, ATP synthase CF1 alpha subunit 0.0
PRK09281502 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Va 0.0
TIGR00962501 TIGR00962, atpA, proton translocating ATP synthase, F1 0.0
PRK13343502 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Pr 0.0
TIGR03324497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 su 1e-153
COG0056504 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [E 0.0
cd01132274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, centra 1e-142
TIGR03497413 TIGR03497, FliI_clade2, flagellar protein export ATPase 9e-46
PRK05688451 PRK05688, fliI, flagellum-specific ATP synthase; Valida 1e-35
cd01135276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catal 2e-33
PRK06315442 PRK06315, PRK06315, type III secretion system ATPase; P 2e-33
TIGR01041458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B sub 1e-32
PRK08149428 PRK08149, PRK08149, ATP synthase SpaL; Validated 1e-32
PRK08927442 PRK08927, fliI, flagellum-specific ATP synthase; Valida 7e-31
PRK07960455 PRK07960, fliI, flagellum-specific ATP synthase; Valida 3e-27
cd01133274 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, 1e-25
PRK05922434 PRK05922, PRK05922, type III secretion system ATPase; V 2e-25
KOG1351489 KOG1351, KOG1351, KOG1351, Vacuolar H+-ATPase V1 sector 3e-24
TIGR01040466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subu 4e-23
PRK12597461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Pro 7e-22
CHL00060494 CHL00060, atpB, ATP synthase CF1 beta subunit 5e-10
PTZ00185574 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional 1e-110
PRK07165507 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Va 3e-84
COG1157441 COG1157, FliI, Flagellar biosynthesis/type III secretor 9e-55
TIGR02546422 TIGR02546, III_secr_ATP, type III secretion apparatus H 5e-51
TIGR03496411 TIGR03496, FliI_clade1, flagellar protein export ATPase 5e-46
PRK07721438 PRK07721, fliI, flagellum-specific ATP synthase; Valida 5e-40
PRK09099441 PRK09099, PRK09099, type III secretion system ATPase; P 7e-40
COG1156463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit 1e-36
PRK07594433 PRK07594, PRK07594, type III secretion system ATPase Ss 2e-31
TIGR03305449 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 s 6e-27
TIGR01039461 TIGR01039, atpD, ATP synthase, F1 beta subunit 3e-26
PRK06793432 PRK06793, fliI, flagellum-specific ATP synthase; Valida 9e-24
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, 6e-82
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 9e-15
cd01134369 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic 8e-14
TIGR01043578 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A sub 3e-11
TIGR01042591 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subu 3e-08
cd01128249 cd01128, rho_factor, Transcription termination factor r 0.001
KOG1353340 KOG1353, KOG1353, KOG1353, F0F1-type ATP synthase, alph 1e-80
KOG1353340 KOG1353, KOG1353, KOG1353, F0F1-type ATP synthase, alph 3e-54
cd01136326 cd01136, ATPase_flagellum-secretory_path_III, Flagellum 1e-46
PRK08972444 PRK08972, fliI, flagellum-specific ATP synthase; Valida 7e-39
PRK07196434 PRK07196, fliI, flagellum-specific ATP synthase; Valida 1e-32
KOG1350521 KOG1350, KOG1350, KOG1350, F0F1-type ATP synthase, beta 5e-24
PRK06936439 PRK06936, PRK06936, type III secretion system ATPase; P 1e-43
TIGR01026440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 2e-41
TIGR03498418 TIGR03498, FliI_clade3, flagellar protein export ATPase 3e-41
PRK06820440 PRK06820, PRK06820, type III secretion system ATPase; V 9e-40
PRK06002450 PRK06002, fliI, flagellum-specific ATP synthase; Valida 2e-34
PRK04196460 PRK04196, PRK04196, V-type ATP synthase subunit B; Prov 9e-30
PRK08472434 PRK08472, fliI, flagellum-specific ATP synthase; Valida 1e-36
COG0055468 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [En 3e-28
PRK02118436 PRK02118, PRK02118, V-type ATP synthase subunit B; Prov 9e-21
pfam00306110 pfam00306, ATP-synt_ab_C, ATP synthase alpha/beta chain 1e-16
PRK09280463 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Val 3e-15
pfam0287469 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta famil 2e-14
pfam0937888 pfam09378, HAS-barrel, HAS barrel domain 5e-05
COG1155588 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit 9e-14
KOG1352618 KOG1352, KOG1352, KOG1352, Vacuolar H+-ATPase V1 sector 1e-10
PRK146981017 PRK14698, PRK14698, V-type ATP synthase subunit A; Prov 4e-08
PRK04192586 PRK04192, PRK04192, V-type ATP synthase subunit A; Prov 5e-08
PRK09376416 PRK09376, rho, transcription termination factor Rho; Pr 0.001
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|181753 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|162134 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|30405 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|29998 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information
>gnl|CDD|132536 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|30001 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|162170 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|181253 PRK08149, PRK08149, ATP synthase SpaL; Validated Back     alignment and domain information
>gnl|CDD|181583 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|29999 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|36565 KOG1351, KOG1351, KOG1351, Vacuolar H+-ATPase V1 sector, subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162169 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|177000 CHL00060, atpB, ATP synthase CF1 beta subunit Back     alignment and domain information
>gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|180863 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|31351 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|162913 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|163292 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|31350 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>gnl|CDD|130111 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|143799 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|30000 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit Back     alignment and domain information
>gnl|CDD|162171 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>gnl|CDD|29994 cd01128, rho_factor, Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>gnl|CDD|36567 KOG1353, KOG1353, KOG1353, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|36567 KOG1353, KOG1353, KOG1353, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30002 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|36564 KOG1350, KOG1350, KOG1350, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|162162 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|168339 PRK06002, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|179779 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|30404 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|144044 pfam00306, ATP-synt_ab_C, ATP synthase alpha/beta chain, C terminal domain Back     alignment and domain information
>gnl|CDD|181752 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|145823 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain Back     alignment and domain information
>gnl|CDD|150147 pfam09378, HAS-barrel, HAS barrel domain Back     alignment and domain information
>gnl|CDD|31349 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|36566 KOG1352, KOG1352, KOG1352, Vacuolar H+-ATPase V1 sector, subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|179776 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|181809 PRK09376, rho, transcription termination factor Rho; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 509 F0F1 ATP synthase subunit alpha [Candidatus Liberibacte
TIGR00962520 atpA ATP synthase F1, alpha subunit; InterPro: IPR00529 100.0
CHL00059501 atpA ATP synthase CF1 alpha subunit 100.0
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 100.0
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha. 100.0
COG0056504 AtpA F0F1-type ATP synthase, alpha subunit [Energy prod 100.0
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 100.0
CHL00060480 atpB ATP synthase CF1 beta subunit 100.0
COG0055468 AtpD F0F1-type ATP synthase, beta subunit [Energy produ 100.0
KOG1352618 consensus 100.0
TIGR01042596 V-ATPase_V1_A V-type ATPase, A subunit; InterPro: IPR00 100.0
PRK07165507 F0F1 ATP synthase subunit alpha; Validated 100.0
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. 100.0
TIGR01043584 ATP_syn_A_arch ATP synthase archaeal, A subunit; InterP 100.0
TIGR01039460 atpD ATP synthase F1, beta subunit; InterPro: IPR005722 100.0
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 100.0
TIGR02545439 ATP_syn_fliI flagellar protein export ATPase FliI; Inte 100.0
PRK06002450 fliI flagellum-specific ATP synthase; Validated 100.0
PRK05688451 fliI flagellum-specific ATP synthase; Validated 100.0
PRK09099441 type III secretion system ATPase; Provisional 100.0
PRK06820445 type III secretion system ATPase; Validated 100.0
TIGR01026455 fliI_yscN ATPase FliI/YscN family; InterPro: IPR005714 100.0
PTZ00185574 ATPase alpha subunit; Provisional 100.0
PRK08972440 fliI flagellum-specific ATP synthase; Validated 100.0
PRK06936439 type III secretion system ATPase; Provisional 100.0
PRK07594433 type III secretion system ATPase; Validated 100.0
PRK08472435 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08927441 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. Membe 100.0
PRK07721435 fliI flagellum-specific ATP synthase; Validated 100.0
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. Membe 100.0
PRK07196434 fliI flagellum-specific ATP synthase; Validated 100.0
PRK12597459 F0F1 ATP synthase subunit beta; Provisional 100.0
PRK06793432 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07960455 fliI flagellum-specific ATP synthase; Validated 100.0
PRK06315442 type III secretion system ATPase; Provisional 100.0
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. Membe 100.0
PRK08149427 ATP synthase SpaL; Validated 100.0
PRK09280466 F0F1 ATP synthase subunit beta; Validated 100.0
PRK05922434 type III secretion system ATPase; Validated 100.0
COG1157441 FliI Flagellar biosynthesis/type III secretory pathway 100.0
PRK02118432 V-type ATP synthase subunit B; Provisional 100.0
PRK04192585 V-type ATP synthase subunit A; Provisional 100.0
KOG1353340 consensus 100.0
COG1156463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy 100.0
KOG1351489 consensus 100.0
KOG1350521 consensus 100.0
COG1155588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy 100.0
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit; InterP 100.0
TIGR01040464 V-ATPase_V1_B V-type ATPase, B subunit; InterPro: IPR00 100.0
PRK04196460 V-type ATP synthase subunit B; Provisional 100.0
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-specific 100.0
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subu 100.0
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central domain. 100.0
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide 100.0
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A. 100.0
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 100.0
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 99.94
pfam06745231 KaiC KaiC. This family represents a conserved region wi 98.53
PRK09302501 circadian clock protein KaiC; Reviewed 98.52
PRK06067241 flagellar accessory protein FlaH; Validated 98.42
PRK04328250 hypothetical protein; Provisional 98.36
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 98.3
cd01124187 KaiC KaiC is a circadian clock protein primarily found 98.0
smart00382148 AAA ATPases associated with a variety of cellular activ 97.82
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.54
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 97.36
PRK11823454 DNA repair protein RadA; Provisional 96.99
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 96.39
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 92.79
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 90.58
cd01128249 rho_factor Transcription termination factor rho is a ba 100.0
PRK12678667 transcription termination factor Rho; Provisional 99.97
COG1158422 Rho Transcription termination factor [Transcription] 99.97
PRK12608379 transcription termination factor Rho; Provisional 100.0
PRK09376416 rho transcription termination factor Rho; Provisional 100.0
TIGR00767420 rho transcription termination factor Rho; InterPro: IPR 99.73
pfam00306110 ATP-synt_ab_C ATP synthase alpha/beta chain, C terminal 99.43
pfam0287469 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barr 98.48
pfam0937888 HAS-barrel HAS barrel domain. The HAS barrel is named a 90.66
PRK09302 501 circadian clock protein KaiC; Reviewed 98.32
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 95.41
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 94.15
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 93.3
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 92.39
CHL00181287 cbbX CbbX; Provisional 92.04
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 91.79
pfam07475171 Hpr_kinase_C HPr Serine kinase C-terminal domain. This 91.75
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 91.6
PRK06526254 transposase; Provisional 91.58
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 91.58
TIGR02746900 TraC-F-type type-IV secretion system protein TraC; Inte 91.57
PRK08084235 DNA replication initiation factor; Provisional 91.54
PRK08181269 transposase; Validated 91.33
PRK09183258 transposase/IS protein; Provisional 91.23
PRK07773 868 replicative DNA helicase; Validated 90.88
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 97.78
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 97.78
cd01394218 radB RadB. The archaeal protein radB shares similarity 97.76
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 97.23
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 97.1
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 96.88
PRK04301318 radA DNA repair and recombination protein RadA; Validat 96.76
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 96.76
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 96.55
PRK13341 726 recombination factor protein RarA/unknown domain fusion 96.12
pfam00931285 NB-ARC NB-ARC domain. 95.94
PTZ00035350 Rad51; Provisional 95.89
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 95.42
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 95.03
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.0
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 94.59
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 94.03
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 93.71
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 93.1
KOG4658 889 consensus 92.89
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 92.11
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 91.64
PRK08118167 topology modulation protein; Reviewed 91.33
PRK04195403 replication factor C large subunit; Provisional 90.95
PRK07261171 topology modulation protein; Provisional 90.44
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 96.81
PRK09354350 recA recombinase A; Provisional 96.0
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 95.0
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 93.09
pfam04665241 Pox_A32 Poxvirus A32 protein. The A32 protein is though 93.08
KOG0733 802 consensus 92.43
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 92.01
TIGR00630956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 90.45
PRK12422455 chromosomal replication initiation protein; Provisional 96.59
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.52
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 90.1
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 96.13
TIGR02785 1295 addA_Gpos recombination helicase AddA; InterPro: IPR014 90.91
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 96.01
PRK13342417 recombination factor protein RarA; Reviewed 95.84
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.45
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 95.41
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 94.92
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 94.5
COG4172534 ABC-type uncharacterized transport system, duplicated A 94.45
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 93.9
PRK05595444 replicative DNA helicase; Provisional 93.8
TIGR02168 1191 SMC_prok_B chromosome segregation protein SMC; InterPro 93.78
PRK10636638 putative ABC transporter ATP-binding protein; Provision 93.68
PRK08506473 replicative DNA helicase; Provisional 93.62
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 93.56
PRK09165484 replicative DNA helicase; Provisional 93.53
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 93.49
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 93.41
PRK11147632 ABC transporter ATPase component; Reviewed 93.37
PRK08082453 consensus 93.33
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 93.28
CHL00176631 ftsH cell division protein; Validated 93.23
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 93.2
PRK06749428 replicative DNA helicase; Provisional 93.19
PRK08006471 replicative DNA helicase; Provisional 93.17
PRK05748448 replicative DNA helicase; Provisional 93.13
PRK06904472 replicative DNA helicase; Validated 93.12
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 93.09
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 93.07
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 93.04
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 93.03
CHL00195491 ycf46 Ycf46; Provisional 92.99
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 92.99
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.93
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 92.9
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 92.86
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 92.83
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 92.78
PRK10522547 multidrug transporter membrane component/ATP-binding co 92.74
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 92.73
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 92.73
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 92.68
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 92.67
pfam00004131 AAA ATPase family associated with various cellular acti 92.67
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 92.63
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 92.63
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 92.62
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 92.59
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 92.58
PRK08694468 consensus 92.56
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 92.55
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 92.53
cd03246173 ABCC_Protease_Secretion This family represents the ABC 92.48
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 92.45
PRK08840464 replicative DNA helicase; Provisional 92.45
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.4
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 92.4
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.38
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 92.37
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 92.32
PRK07263453 consensus 92.31
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 92.3
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 92.29
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 92.24
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 92.21
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 92.19
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 92.17
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 92.14
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.11
PRK10789569 putative multidrug transporter membrane\ATP-binding com 92.11
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 92.11
PRK08760476 replicative DNA helicase; Provisional 92.09
PRK10744257 phosphate transporter subunit; Provisional 92.08
PRK11147 632 ABC transporter ATPase component; Reviewed 92.08
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 92.02
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 92.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 91.97
PRK07004460 replicative DNA helicase; Provisional 91.95
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 91.95
PRK06321472 replicative DNA helicase; Provisional 91.94
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 91.89
KOG0057591 consensus 91.85
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 91.83
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 91.8
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 91.79
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 91.76
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 91.71
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 91.67
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 91.67
PRK10790593 putative multidrug transporter membrane\ATP-binding com 91.65
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 91.63
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 91.56
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 91.56
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 91.5
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 91.36
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 91.34
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 91.33
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 91.31
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 91.3
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 91.29
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 91.27
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 91.24
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 91.21
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 91.18
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 91.18
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 91.15
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 91.15
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 91.12
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 91.1
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 91.05
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 91.05
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 91.02
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 90.98
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 90.96
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 90.93
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 90.92
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 90.91
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 90.9
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 90.87
PRK13542224 consensus 90.86
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 90.84
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 90.8
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 90.78
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 90.77
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 90.77
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 90.76
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 90.73
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 90.7
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 90.69
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 90.69
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 90.68
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 90.67
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 90.67
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 90.65
cd03234226 ABCG_White The White subfamily represents ABC transport 90.58
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 90.58
PRK00635 1809 excinuclease ABC subunit A; Provisional 90.56
PRK12288344 ribosome-associated GTPase; Reviewed 90.55
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 90.55
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 90.49
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 90.46
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 90.45
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 90.44
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 90.41
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 90.37
COG4987573 CydC ABC-type transport system involved in cytochrome b 90.37
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 90.37
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 90.35
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 90.33
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 90.26
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 90.23
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 90.22
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 90.21
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 90.18
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 90.14
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 90.13
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 90.12
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 90.1
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 90.07
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 90.06
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 90.03
PRK03992390 proteasome-activating nucleotidase; Provisional 95.66
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 93.44
PRK09519790 recA recombinase A; Reviewed 94.06
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 93.49
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 92.49
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 91.44
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 94.06
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 90.05
pfam07088 484 GvpD GvpD gas vesicle protein. This family consists of 93.25
KOG1353340 consensus 92.45
PRK05636507 replicative DNA helicase; Provisional 91.89
KOG0060659 consensus 91.61
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 91.51
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 90.81
>TIGR00962 atpA ATP synthase F1, alpha subunit; InterPro: IPR005294 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>KOG1352 consensus Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type ATPase, A subunit; InterPro: IPR005725 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit; InterPro: IPR005726 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR01039 atpD ATP synthase F1, beta subunit; InterPro: IPR005722 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase; InterPro: IPR013380 Proteins in this entry are found in a variety of bacteria, and are predicted to be ATPases involved in type III secretion systems Back     alignment and domain information
>TIGR02545 ATP_syn_fliI flagellar protein export ATPase FliI; InterPro: IPR013379 FliI proteins are involved in bacterial flagellum systems, acting to drive protein export for flagellar biosynthesis Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family; InterPro: IPR005714 Proteins in this entry show extensive homology to the ATP synthase F1 beta subunit, and are involved in type III protein secretion Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK07594 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information