254780618

254780618

F0F1 ATP synthase subunit delta

GeneID in NCBI database:8209618Locus tag:CLIBASIA_02525
Protein GI in NCBI database:254780618Protein Accession:YP_003065031.1
Gene range:+(655679, 656239)Protein Length:186aa
Gene description:F0F1 ATP synthase subunit delta
COG prediction:[C] F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein)
KEGG prediction:atpH; F0F1 ATP synthase subunit delta (EC:3.6.3.14); K02113 F-type H+-transporting ATPase subunit delta [EC:3.6.3.14]
SEED prediction:ATP synthase delta chain (EC 3.6.3.14)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:F0F1-type ATP synthase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MSHSFALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEVD
ccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHHHccEEEEEEEEcHHHHcEEEEEEccEEEEHHHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEEcHHHHcEEEEEEcccccccHHHHHHHHHHHHHHHcc
mshsfalfsdvpgryshslfgvsneegvldIVSDDISRLEALLMESAdlrffihnplfsmkdrRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEVD
mshsfalfsdvpgrySHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEVD
MSHSFALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEVD
**********VPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILK***
MSHSFALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEVD
***SFALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEVD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHSFALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEVD
MSHSFALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEVD
MSHSFALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEVD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target186 F0F1 ATP synthase subunit delta [Candidatus Liberibacte
315121818186 F0F1 ATP synthase subunit delta [Candidatus Liberibacte 1 1e-72
209551227188 F0F1 ATP synthase subunit delta [Rhizobium leguminosaru 1 3e-31
218662292186 F0F1 ATP synthase subunit delta [Rhizobium etli IE4771] 1 5e-31
163761388199 F0F1 ATP synthase subunit delta [Hoeflea phototrophica 1 5e-31
229260086188 F0F1 ATP synthase subunit delta [Rhizobium etli CFN 42] 1 6e-31
257096196188 RecName: Full=ATP synthase subunit delta; AltName: Full 1 6e-31
222087440194 ATP synthase F1, delta subunit [Agrobacterium radiobact 1 6e-31
86283556233 H(+)-transporting ATP synthase protein, delta subunit [ 1 1e-30
241206628188 F0F1 ATP synthase subunit delta [Rhizobium leguminosaru 1 2e-30
116254142188 F0F1 ATP synthase subunit delta [Rhizobium leguminosaru 1 3e-30
>gi|315121818|ref|YP_004062307.1| F0F1 ATP synthase subunit delta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 186 Back     alignment and organism information
 Score =  276 bits (705), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 160/186 (86%)

Query: 1   MSHSFALFSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSM 60
           MSHS  LF+DV GRYSHSLF VSN EGVLDIVSDDISRLEALL+ES DLR F+ NP+FSM
Sbjct: 1   MSHSIDLFADVFGRYSHSLFSVSNAEGVLDIVSDDISRLEALLVESLDLRSFVQNPIFSM 60

Query: 61  KDRRSVIDDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRA 120
           ++RR V+DDL+  A+FC I  NFL++LVAN RLS+LPAIIKSFR VC++YRNEV+A VR 
Sbjct: 61  EERRLVVDDLINKANFCVIMGNFLQLLVANKRLSILPAIIKSFRMVCLFYRNEVIAHVRT 120

Query: 121 FSGLSLLQQNKLGECLEKIVGKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGC 180
           FS LSL QQNKL +CLEK+V K VILD++EDSAL+GGF+VEI ++QIDASLRT+L KLG 
Sbjct: 121 FSNLSLNQQNKLRDCLEKMVCKRVILDIVEDSALIGGFVVEIDSYQIDASLRTKLFKLGF 180

Query: 181 ILKEVD 186
           ILKEVD
Sbjct: 181 ILKEVD 186


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209551227|ref|YP_002283144.1| F0F1 ATP synthase subunit delta [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 188 Back     alignment and organism information
>gi|218662292|ref|ZP_03518222.1| F0F1 ATP synthase subunit delta [Rhizobium etli IE4771] Length = 186 Back     alignment and organism information
>gi|163761388|ref|ZP_02168462.1| F0F1 ATP synthase subunit delta [Hoeflea phototrophica DFL-43] Length = 199 Back     alignment and organism information
>gi|229260086|ref|YP_471346.2| F0F1 ATP synthase subunit delta [Rhizobium etli CFN 42] Length = 188 Back     alignment and organism information
>gi|257096196|sp|B9JBZ8|ATPD_AGRRK RecName: Full=ATP synthase subunit delta; AltName: Full=ATP synthase F(1) sector subunit delta; AltName: Full=F-type ATPase subunit delta; Short=F-ATPase subunit delta Length = 188 Back     alignment and organism information
>gi|222087440|ref|YP_002545977.1| ATP synthase F1, delta subunit [Agrobacterium radiobacter K84] Length = 194 Back     alignment and organism information
>gi|86283556|gb|ABC92619.1| H(+)-transporting ATP synthase protein, delta subunit [Rhizobium etli CFN 42] Length = 233 Back     alignment and organism information
>gi|241206628|ref|YP_002977724.1| F0F1 ATP synthase subunit delta [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 188 Back     alignment and organism information
>gi|116254142|ref|YP_769980.1| F0F1 ATP synthase subunit delta [Rhizobium leguminosarum bv. viciae 3841] Length = 188 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target186 F0F1 ATP synthase subunit delta [Candidatus Liberibacte
PRK13429181 PRK13429, PRK13429, F0F1 ATP synthase subunit delta; Pr 2e-30
PRK05758177 PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Va 1e-29
COG0712178 COG0712, AtpH, F0F1-type ATP synthase, delta subunit (m 7e-26
KOG1662210 KOG1662, KOG1662, KOG1662, Mitochondrial F1F0-ATP synth 2e-25
CHL00119184 CHL00119, atpD, ATP synthase CF1 delta subunit; Validat 7e-18
TIGR01145172 TIGR01145, ATP_synt_delta, ATP synthase, F1 delta subun 2e-17
PRK13434184 PRK13434, PRK13434, F0F1 ATP synthase subunit delta; Pr 3e-15
PRK13441180 PRK13441, PRK13441, F0F1 ATP synthase subunit delta; Pr 7e-09
PRK13436179 PRK13436, PRK13436, F0F1 ATP synthase subunit delta; Pr 4e-08
PRK13430271 PRK13430, PRK13430, F0F1 ATP synthase subunit delta; Pr 4e-07
pfam00213171 pfam00213, OSCP, ATP synthase delta (OSCP) subunit 1e-32
PRK08474176 PRK08474, PRK08474, F0F1 ATP synthase subunit delta; Va 2e-05
PRK13428445 PRK13428, PRK13428, F0F1 ATP synthase subunit delta; Pr 2e-05
>gnl|CDD|184049 PRK13429, PRK13429, F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>gnl|CDD|180239 PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Validated Back     alignment and domain information
>gnl|CDD|31056 COG0712, AtpH, F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|36875 KOG1662, KOG1662, KOG1662, Mitochondrial F1F0-ATP synthase, subunit OSCP/ATP5 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177042 CHL00119, atpD, ATP synthase CF1 delta subunit; Validated Back     alignment and domain information
>gnl|CDD|130215 TIGR01145, ATP_synt_delta, ATP synthase, F1 delta subunit Back     alignment and domain information
>gnl|CDD|139571 PRK13434, PRK13434, F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>gnl|CDD|184054 PRK13441, PRK13441, F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>gnl|CDD|184053 PRK13436, PRK13436, F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>gnl|CDD|184050 PRK13430, PRK13430, F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>gnl|CDD|143970 pfam00213, OSCP, ATP synthase delta (OSCP) subunit Back     alignment and domain information
>gnl|CDD|181440 PRK08474, PRK08474, F0F1 ATP synthase subunit delta; Validated Back     alignment and domain information
>gnl|CDD|184048 PRK13428, PRK13428, F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 186 F0F1 ATP synthase subunit delta [Candidatus Liberibacte
PRK13432180 consensus 100.0
CHL00119184 atpD ATP synthase CF1 delta subunit; Validated 100.0
PRK13429181 F0F1 ATP synthase subunit delta; Provisional 100.0
PRK13439180 consensus 100.0
PRK13440185 consensus 100.0
PRK13437180 consensus 100.0
PRK13436179 F0F1 ATP synthase subunit delta; Provisional 100.0
PRK13434184 F0F1 ATP synthase subunit delta; Provisional 100.0
PRK13433181 consensus 100.0
PRK13438180 consensus 100.0
pfam00213171 OSCP ATP synthase delta (OSCP) subunit. The ATP D subun 100.0
PRK05758175 F0F1 ATP synthase subunit delta; Validated 100.0
COG0712178 AtpH F0F1-type ATP synthase, delta subunit (mitochondri 100.0
PRK13441180 F0F1 ATP synthase subunit delta; Provisional 100.0
PRK08474176 F0F1 ATP synthase subunit delta; Validated 100.0
KOG1662210 consensus 100.0
PRK13430271 F0F1 ATP synthase subunit delta; Provisional 99.97
PRK13428445 F0F1 ATP synthase subunit delta; Provisional 99.95
TIGR01145172 ATP_synt_delta ATP synthase F1, delta subunit; InterPro 99.86
PRK13431180 F0F1 ATP synthase subunit delta; Provisional 99.43
TIGR03321246 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC a 98.89
PRK09098229 type III secretion system protein HrpB; Validated 95.0
PRK06669268 fliH flagellar assembly protein H; Validated 94.97
PRK03963198 V-type ATP synthase subunit E; Provisional 93.52
PRK06328223 type III secretion system protein; Validated 93.37
pfam02108128 FliH Flagellar assembly protein FliH. 90.21
PRK13430271 F0F1 ATP synthase subunit delta; Provisional 96.62
PRK13428445 F0F1 ATP synthase subunit delta; Provisional 93.82
pfam01991195 vATP-synt_E ATP synthase (E/31 kDa) subunit. This famil 96.33
PRK02292187 V-type ATP synthase subunit E; Provisional 90.65
>PRK13432 consensus Back     alignment and domain information
>CHL00119 atpD ATP synthase CF1 delta subunit; Validated Back     alignment and domain information
>PRK13429 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>PRK13439 consensus Back     alignment and domain information
>PRK13440 consensus Back     alignment and domain information
>PRK13437 consensus Back     alignment and domain information
>PRK13436 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>PRK13434 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>PRK13433 consensus Back     alignment and domain information
>PRK13438 consensus Back     alignment and domain information
>pfam00213 OSCP ATP synthase delta (OSCP) subunit Back     alignment and domain information
>PRK05758 F0F1 ATP synthase subunit delta; Validated Back     alignment and domain information
>COG0712 AtpH F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Energy production and conversion] Back     alignment and domain information
>PRK13441 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>PRK08474 F0F1 ATP synthase subunit delta; Validated Back     alignment and domain information
>KOG1662 consensus Back     alignment and domain information
>PRK13430 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>PRK13428 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>TIGR01145 ATP_synt_delta ATP synthase F1, delta subunit; InterPro: IPR000711 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK13431 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B Back     alignment and domain information
>PRK09098 type III secretion system protein HrpB; Validated Back     alignment and domain information
>PRK06669 fliH flagellar assembly protein H; Validated Back     alignment and domain information
>PRK03963 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK06328 type III secretion system protein; Validated Back     alignment and domain information
>pfam02108 FliH Flagellar assembly protein FliH Back     alignment and domain information
>PRK13430 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>PRK13428 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>pfam01991 vATP-synt_E ATP synthase (E/31 kDa) subunit Back     alignment and domain information
>PRK02292 V-type ATP synthase subunit E; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target186 F0F1 ATP synthase subunit delta [Candidatus Liberibacte
2wss_S190 The Structure Of The Membrane Extrinsic Region Of B 8e-23
2bo5_A120 Bovine Oligomycin Sensitivity Conferral Protein N-T 1e-06
2a7u_B134 Nmr Solution Structure Of The E.Coli F-Atpase Delta 2e-06
>gi|268612216|pdb|2WSS|S Chain S, The Structure Of The Membrane Extrinsic Region Of Bovine Atp Synthase Length = 190 Back     alignment and structure
 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 48/178 (26%), Positives = 86/178 (48%), Gaps = 3/178 (1%)

Query: 10  DVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDD 69
            + GRY+ +L+  ++++  L+ V  ++ R+  +L E       + NP      +   + D
Sbjct: 13  GIEGRYATALYSAASKQNKLEQVEKELLRVGQILKE-PKXAASLLNPYVKRSVKVKSLSD 71

Query: 70  LVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQ 129
                 F  +T+N + +L  NGRL+  PA+I +F      +R EV   V   S L     
Sbjct: 72  XTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFSTXXSVHRGEVPCTVTTASALDETTL 131

Query: 130 NKLGECLEKIV--GKTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEV 185
            +L   L+  +  G+ + L+V  D ++ GG IV IG   +D S +T++ KL    +E+
Sbjct: 132 TELKTVLKSFLSKGQVLKLEVKIDPSIXGGXIVRIGEKYVDXSAKTKIQKLSRAXREI 189


>gi|157881386|pdb|2BO5|A Chain A, Bovine Oligomycin Sensitivity Conferral Protein N-Terminal Domain Length = 120 Back     alignment and structure
>gi|82407697|pdb|2A7U|B Chain B, Nmr Solution Structure Of The E.Coli F-Atpase Delta Subunit N-Terminal Domain In Complex With Alpha Subunit N-Terminal 22 Residues Length = 134 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target186 F0F1 ATP synthase subunit delta [Candidatus Liberibacte
2wss_S190 ATP synthase subunit O, mitochondrial; hydrogen ION tra 2e-22
1abv_A134 Delta subunit of the F1F0-ATP synthase; ATP synthesis, 2e-13
>2wss_S ATP synthase subunit O, mitochondrial; hydrogen ION transport, ATP synthesis, phosphoprotein, UBL conjugation, transit peptide; HET: ANP ADP; 3.20A {Bos taurus} PDB: 2bo5_A 2jmx_A Length = 190 Back     alignment and structure
 Score =  100 bits (250), Expect = 2e-22
 Identities = 47/177 (26%), Positives = 89/177 (50%), Gaps = 3/177 (1%)

Query: 11  VPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDL 70
           + GRY+ +L+  ++++  L+ V  ++ R+  +L E       ++ P      +   + D+
Sbjct: 14  IEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLN-PYVKRSVKVKSLSDM 72

Query: 71  VKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQN 130
                F  +T+N + +L  NGRL+  PA+I +F  +   +R EV   V   S L      
Sbjct: 73  TAKEKFSPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTVTTASALDETTLT 132

Query: 131 KLGECLEKIVG--KTVILDVMEDSALMGGFIVEIGAHQIDASLRTQLLKLGCILKEV 185
           +L   L+  +   + + L+V  D ++MGG IV IG   +D S +T++ KL   ++E+
Sbjct: 133 ELKTVLKSFLSKGQVLKLEVKIDPSIMGGMIVRIGEKYVDMSAKTKIQKLSRAMREI 189


>1abv_A Delta subunit of the F1F0-ATP synthase; ATP synthesis, F1-ATPase, spectroscopy; NMR {Escherichia coli} SCOP: a.70.1.1 PDB: 2a7u_B Length = 134 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target186 F0F1 ATP synthase subunit delta [Candidatus Liberibacte
2wss_S190 ATP synthase subunit O, mitochondrial; hydrogen ION tra 100.0
1abv_A134 Delta subunit of the F1F0-ATP synthase; ATP synthesis, 99.91
2dm9_A198 V-type ATP synthase subunit E; A-ATPase, structural gen 94.77
>2wss_S ATP synthase subunit O, mitochondrial; hydrogen ION transport, ATP synthesis, phosphoprotein, UBL conjugation, transit peptide; HET: ANP ADP; 3.20A {Bos taurus} PDB: 2bo5_A 2jmx_A Back     alignment and structure
Probab=100.00  E-value=6.1e-39  Score=276.19  Aligned_cols=177  Identities=27%  Similarity=0.492  Sum_probs=170.0

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             44555799999999998639989999999999999506998999851845220456578899862046643468999998
Q gi|254780618|r    8 FSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRIL   87 (186)
Q Consensus         8 ~~~ia~~YA~AL~~~a~e~~~l~~v~~~l~~i~~~~~~~~~l~~~l~sp~i~~~~K~~ii~~i~~~~~~~~~~~~fl~~L   87 (186)
                      ..+||+|||+|||++|.+++.++.|.+++..+.+++. +++++.++.||.++.++|..++.+++++.++++.+.||+.+|
T Consensus        11 ~~~va~rYA~ALf~~A~e~~~l~~v~~~l~~~~~~~~-~~~~~~~l~~p~i~~~~K~~~l~~~~~~~~~~~~~~nfl~~L   89 (190)
T 2wss_S           11 IYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILK-EPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLL   89 (190)
T ss_dssp             CCSSSCTTHHHHHHHTTTTTCHHHHHHHHHHHHHHSS-STTSHHHHTCTTTTTSTTTTTTTHHHHTTTCCSSSSHHHHHH
T ss_pred             HCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHC-CHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             3375889999999999974999999999999999983-958899864977679999999999987624788999999999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHEEECCCCCHHHHHHHHHHHHHHH--CCEEEEEEEECCCHHCEEEEEECCE
Q ss_conf             53320110142499999998887655533101056899899999999999974--8958999999741402389997997
Q gi|254780618|r   88 VANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIV--GKTVILDVMEDSALMGGFIVEIGAH  165 (186)
Q Consensus        88 ~~~~r~~~l~~I~~~f~~~~~~~~~~~~~~V~sa~~ls~~~~~~i~~~l~~~~--~~~i~l~~~vD~slIGG~~i~vg~~  165 (186)
                      ++++|++++++|+..|.+++.+++|+..++|+||.|||++|+++|++.+++++  |+++++.++||||||||++|++||+
T Consensus        90 ~~~~r~~~l~~I~~~f~~~~~~~~~~~~~~V~sA~~Ls~~q~~~i~~~l~~~~~~~~~i~l~~~vDpsLIGGi~i~vgd~  169 (190)
T 2wss_S           90 AENGRLTNTPAVISAFSTMMSVHRGEVPCTVTTASALDETTLTELKTVLKSFLSKGQVLKLEVKIDPSIMGGMIVRIGEK  169 (190)
T ss_dssp             HHTTCGGGHHHHHHHHHHHHTTTSCCCCBCSSSCBCCCCSSSTTTTTTTTSSTTTCC----------------------C
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEEEECCHHHCEEEEEECCE
T ss_conf             99876606989999999999998605014799620477879999999999986469858999788832518589999999


Q ss_pred             EEEHHHHHHHHHHHHHHHHC
Q ss_conf             85027999999999985224
Q gi|254780618|r  166 QIDASLRTQLLKLGCILKEV  185 (186)
Q Consensus       166 ~iD~Si~~kL~~l~~~l~~v  185 (186)
                      +||+|++++|++|+++|++|
T Consensus       170 viD~Sik~kL~~lk~~L~~v  189 (190)
T 2wss_S          170 YVDMSAKTKIQKLSRAMREI  189 (190)
T ss_dssp             CTTTTTTTTTTTTCTTTTTC
T ss_pred             EEEHHHHHHHHHHHHHHHHH
T ss_conf             88751999999999998875



>1abv_A Delta subunit of the F1F0-ATP synthase; ATP synthesis, F1-ATPase, spectroscopy; NMR {Escherichia coli} SCOP: a.70.1.1 PDB: 2a7u_B Back     alignment and structure
>2dm9_A V-type ATP synthase subunit E; A-ATPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.85A {Pyrococcus horikoshii OT3} SCOP: d.81.4.1 PDB: 2dma_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 186 F0F1 ATP synthase subunit delta [Candidatus Liberibacte
d1abva_105 a.70.1.1 (A:) N-terminal domain of the delta subunit of 5e-12
>d1abva_ a.70.1.1 (A:) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli [TaxId: 562]} Length = 105 Back     information, alignment and structure

class: All alpha proteins
fold: ATPD N-terminal domain-like
superfamily: N-terminal domain of the delta subunit of the F1F0-ATP synthase
family: N-terminal domain of the delta subunit of the F1F0-ATP synthase
domain: N-terminal domain of the delta subunit of the F1F0-ATP synthase
species: Escherichia coli [TaxId: 562]
 Score = 64.6 bits (157), Expect = 5e-12
 Identities = 18/92 (19%), Positives = 37/92 (40%), Gaps = 3/92 (3%)

Query: 14  RYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKD 73
            Y+ + F  + E   ++   D ++   A + ++  +   +   L       S I   V  
Sbjct: 9   PYAKAAFDFAVEHQSVERWQDMLAFA-AEVTKNEQMAELLSGALAPETLAESFIA--VCG 65

Query: 74  AHFCAITANFLRILVANGRLSVLPAIIKSFRA 105
                   N +R++  NGRL+ LP +++ F  
Sbjct: 66  EQLDENGQNLIRVMAENGRLNALPDVLEQFIH 97


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target186 F0F1 ATP synthase subunit delta [Candidatus Liberibacte
d1abva_105 N-terminal domain of the delta subunit of the F1F0-ATP 99.75
d2dm9a1118 V-type ATP synthase subunit E {Pyrococcus horikoshii [T 95.21
>d1abva_ a.70.1.1 (A:) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: ATPD N-terminal domain-like
superfamily: N-terminal domain of the delta subunit of the F1F0-ATP synthase
family: N-terminal domain of the delta subunit of the F1F0-ATP synthase
domain: N-terminal domain of the delta subunit of the F1F0-ATP synthase
species: Escherichia coli [TaxId: 562]
Probab=99.75  E-value=1e-17  Score=134.54  Aligned_cols=103  Identities=16%  Similarity=0.256  Sum_probs=91.6

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             44555799999999998639989999999999999506998999851845220456578899862046643468999998
Q gi|254780618|r    8 FSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRIL   87 (186)
Q Consensus         8 ~~~ia~~YA~AL~~~a~e~~~l~~v~~~l~~i~~~~~~~~~l~~~l~sp~i~~~~K~~ii~~i~~~~~~~~~~~~fl~~L   87 (186)
                      +++||+|||+|||++|.+++.++.|.+++..+..++ +++++..++.+|.++.++| ..+..+++ +++++.+.|||.+|
T Consensus         3 ~~TiArrYAkALf~lA~e~~~l~~~~~~l~~l~~l~-~~~~~~~~l~~p~~~~~kk-~~l~~~~~-~~~~~~~~nfl~lL   79 (105)
T d1abva_           3 FITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVT-KNEQMAELLSGALAPETLA-ESFIAVCG-EQLDENGQNLIRVM   79 (105)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHH-TSHHHHHHHTCSSCHHHHH-HHHHHHHC-SCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH-CCHHHHHHHHCCCCCHHHH-HHHHHHHH-CCCCHHHHHHHHHH
T ss_conf             246589999999999986197668999999999988-6998999876112849999-99999973-02589999999999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             53320110142499999998887655
Q gi|254780618|r   88 VANGRLSVLPAIIKSFRAVCMYYRNE  113 (186)
Q Consensus        88 ~~~~r~~~l~~I~~~f~~~~~~~~~~  113 (186)
                      ++++|+.++++|+..|..++++++|+
T Consensus        80 ~~~~Rl~~l~~I~~~f~~L~~~~e~T  105 (105)
T d1abva_          80 AENGRLNALPDVLEQFIHLRAVSEAT  105 (105)
T ss_dssp             HHTTCGGGHHHHHHHHHHHHHHHHHC
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             98864989999999999999977387



>d2dm9a1 d.81.4.1 (A:81-198) V-type ATP synthase subunit E {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 186 F0F1 ATP synthase subunit delta [Candidatus Liberi
1abv_A_134 (A:) Delta subunit of the F1F0-ATP synthase; ATP s 7e-20
2wss_S_1-113113 (S:1-113) ATP synthase subunit O, mitochondrial; h 3e-16
>1abv_A (A:) Delta subunit of the F1F0-ATP synthase; ATP synthesis, F1-ATPase, spectroscopy; NMR {Escherichia coli}Length = 134 Back     alignment and structure
 Score = 91.4 bits (227), Expect = 7e-20
 Identities = 25/135 (18%), Positives = 52/135 (38%), Gaps = 3/135 (2%)

Query: 8   FSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVI 67
           F  V   Y+ + F  + E   ++   D ++    +  ++  +   +   L       S I
Sbjct: 3   FITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVT-KNEQMAELLSGALAPETLAESFI 61

Query: 68  DDLVKDAHFCAITANFLRILVANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLL 127
               +         N +R++  NGRL+ LP +++ F  +           V + + LS  
Sbjct: 62  AVCGEQLD--ENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQ 119

Query: 128 QQNKLGECLEKIVGK 142
           Q  K+   +EK + +
Sbjct: 120 QLAKISAAMEKRLSR 134


>2wss_S (S:1-113) ATP synthase subunit O, mitochondrial; hydrogen ION transport, ATP synthesis, phosphoprotein, UBL conjugation, transit peptide; HET: ANP ADP; 3.20A {Bos taurus} PDB: 2bo5_A 2jmx_ALength = 113 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target186 F0F1 ATP synthase subunit delta [Candidatus Liberibacte
1abv_A_134 Delta subunit of the F1F0-ATP synthase; ATP synthe 99.93
2wss_S_1-113113 ATP synthase subunit O, mitochondrial; hydrogen IO 99.72
>1abv_A (A:) Delta subunit of the F1F0-ATP synthase; ATP synthesis, F1-ATPase, spectroscopy; NMR {Escherichia coli} Back     alignment and structure
Probab=99.93  E-value=5.2e-25  Score=185.26  Aligned_cols=132  Identities=19%  Similarity=0.250  Sum_probs=127.7

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             44555799999999998639989999999999999506998999851845220456578899862046643468999998
Q gi|254780618|r    8 FSDVPGRYSHSLFGVSNEEGVLDIVSDDISRLEALLMESADLRFFIHNPLFSMKDRRSVIDDLVKDAHFCAITANFLRIL   87 (186)
Q Consensus         8 ~~~ia~~YA~AL~~~a~e~~~l~~v~~~l~~i~~~~~~~~~l~~~l~sp~i~~~~K~~ii~~i~~~~~~~~~~~~fl~~L   87 (186)
                      .++||+|||+|||++|.+.+.++.|.+++..+..++ ++|+|+.+|.||.++.++|..++..+++  ++++.+.|||.+|
T Consensus         3 ~~~ia~~YA~AL~~~a~~~~~l~~v~~~l~~~~~~~-~~~~~~~~l~~p~i~~~~K~~~l~~l~~--~~~~~~~nfL~~l   79 (134)
T 1abv_A            3 FITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVT-KNEQMAELLSGALAPETLAESFIAVCGE--QLDENGQNLIRVM   79 (134)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHH-TSHHHHHHHTCSSCHHHHHHHHHHHHCS--CCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH-CCHHHHHHHCCCCCCHHHHHHHHHHHHH--HHHHHHHHHHHHH
T ss_conf             025489999999999887199999999999999986-6999998766424659999999999876--7789999999999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             5332011014249999999888765553310105689989999999999997489
Q gi|254780618|r   88 VANGRLSVLPAIIKSFRAVCMYYRNEVMAFVRAFSGLSLLQQNKLGECLEKIVGK  142 (186)
Q Consensus        88 ~~~~r~~~l~~I~~~f~~~~~~~~~~~~~~V~sa~~ls~~~~~~i~~~l~~~~~~  142 (186)
                      ++++|+.++++|+..|..++.+++|+..++|+||.|||++|+++|.+.+++++|+
T Consensus        80 ~~~~r~~~l~~I~~~f~~l~~~~~~~~~~~V~sA~~Ls~~q~~~i~~~l~~~~gK  134 (134)
T 1abv_A           80 AENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSR  134 (134)
T ss_dssp             HHTTCGGGHHHHHHHHHHHHHHHHHC-----------------------------
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             9701132589999999999999759467998779999999999999999988681



>2wss_S (S:1-113) ATP synthase subunit O, mitochondrial; hydrogen ION transport, ATP synthesis, phosphoprotein, UBL conjugation, transit peptide; HET: ANP ADP; 3.20A {Bos taurus} PDB: 2bo5_A 2jmx_A Back     alignment and structure