254780619

254780619

primosome assembly protein PriA

GeneID in NCBI database:8209619Locus tag:CLIBASIA_02530
Protein GI in NCBI database:254780619Protein Accession:YP_003065032.1
Gene range:+(653006, 655201)Protein Length:731aa
Gene description:primosome assembly protein PriA
COG prediction:none
KEGG prediction:priA; primosome assembly protein PriA; K04066 primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.1.-]
SEED prediction:Helicase PriA essential for oriC/DnaA-independent DNA replication
Pathway involved in KEGG:Homologous recombination [PATH:las03440]
Subsystem involved in SEED:DNA-replication;
Conserved gene cluster associated with Met-tRNA formyltransferase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED5 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-
MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL
ccccccccccccccEEEEEcccccccccccccccccccccccEEEEEccccEEEEEEEEEccccccccHHHcccHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHcccEEEEccccccccccccEEEEEcccHHHcccccccHHHHHHHHHHHHccccEEEEEcccccccEEEEHHHccccccccccEEEEEEccccEEEEEEccccccccHHccccccccEEEEEcccHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHccccEEEEEcHHHHcccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHccHHHHHHHHHHHHHHcccccccEEEEEEEccccHHHHHHHHHHHHHHccccccEEEEcccccHHHHHcccEEEEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEEccccccc
ccccccccccccccEEEEEcccccccccccccccccccEccEEEEEcccccEEEEEEEEEccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHccccHHHcHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHcccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHcccHHEHccccccHHHHHHHHHHHccccEEEEEccHHHEcccHcccEEEEEcccccHHcccccccccHHHHHHHHHHHccccEEEEcccHHHHHHHHHHcccEEEEEEcccccccccccEEEEEcccccccccccccHHHHHHHHHHHHcccEEEEEEcccccccEEEEcccccEcccccccEEEEEEccccEEEEcccccccccccccccccccccEEEcccHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHcccccEEEEHHHHHcccccccEEEEEEEEccHHHccccccHHHHHHHHHHHHHccccccccccEEEEEccccccHHHHHHHHccHHHHHHHHHHHHHHcccccccEEEEEEEccccHHHHHHHHHHHHHHccccccEEEEccccccHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHccccccEEEEEEcccHccc
massgssvegvVCSRVIILLLQAVsgpyiysvpSAMKVELGsivrvplrsrTVLGIVwynseekykidslklrpieyvfdcpplsrqMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQftgifprinTVARLRVLDkikdgkiwekRDLIRASQVSSHVIDGLKAQGVIKQIFEVispvvdspnlyfslpildknqQDVVEQVVPLCTKGFAVSLIsgvtgsgkTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKrfgvkpaewhsslSTSMREKIWRQVARGAISVIVGVRSalflpfkklglivideehdisykqeegilynardmsivrgkiesFPVVLvsatpsiesrvngisRRYHSVHLStryrnsalphlqvIDMRgqtiaqgkslspemIDGIRHTLARNEQTLLFLNrrgyapltlcqvcgnrlkclhcscwlvehrskkklychqcghsaiysqscvvcgssgkmiacgFGIERIAEEVCEYFPLARISILssdleggggrLQLQLSAIAKGEIDIIIGTqlvakghnfprmslvgvvdgdlgltnadlrsSERTFQLLSQVTGRAGRFGLKSLGliqayqpthPVMQALvsgdadsfyeseiraresvnlppfgRLAAVIISGTKYQEVENYAYNlkehaprssdivvfgpaesplfmvRGRYRFRLLIHgkrnsnlqgFFSQMYDntikrsnalrvqfdidpqnfl
massgssveGVVCSRVIILLLQAVSGPYIYSVPSAMKVELgsivrvplrsrtvlgivwynseekykidslklrPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEkiqftgifprintvarLRVLdkikdgkiwekrdlIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFgvkpaewhsslstSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSatpsiesrvngiSRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRaresvnlppfgRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHgkrnsnlqGFFSQMYDNTIKRSnalrvqfdidpqnfl
MAssgssvegvvcsrvIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDleggggrlqlqlSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL
*************SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA*SETEKMEEKIQFTGIFPRINTVARLRVLDKIK**************QVSSHVIDGLKAQGVIKQIFEVISP**************DKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQT*****SLS**MIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL
*********GVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL
************CSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL
MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL
MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target731 primosome assembly protein PriA [Candidatus Liberibacte
2547809471187 transcription-repair coupling factor [Candidatus L 1e-07
254780945700 ATP-dependent DNA helicase RecG [Candidatus Liberi 8e-06
254780991 805 excinuclease ABC subunit B [Candidatus Liberibacte 0.003
254780991805 excinuclease ABC subunit B [Candidatus Liberibacte 0.022
>gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Back     alignment
 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 98/234 (41%), Gaps = 20/234 (8%)

Query: 115 SETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDL---IRASQVSSHVIDGLK 171
           ++  K+   ++   +  R +T      LDK+  G  W+ R      R   ++  ++D   
Sbjct: 540 ADNAKLFVPVENIDLISRYSTEITTVTLDKL-GGSAWKTRKANLKKRLEDLAQKLVDI-- 596

Query: 172 AQGVIKQIFEVISPVVDSPNLYFSL-----PILDKNQQDVVEQVVPLCTKGFAVS-LISG 225
                K+    + P++ S +LY         +  ++Q+  ++ V+   + G  +  LI G
Sbjct: 597 ---AAKRAIHSVPPLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICG 653

Query: 226 VTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKR---FGVKPAEWHSSLS 282
             G GKTE+ L      +  G QV ++ P   L       F +R   F V+ A     + 
Sbjct: 654 DVGFGKTEIALRAAFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQ 713

Query: 283 TSMREKIWRQVARGAISVIVGVRSALF--LPFKKLGLIVIDEEHDISYKQEEGI 334
           T       + +  G + +++G  + L   + F  LGLI+IDEE     K +E +
Sbjct: 714 TKEAALHKKSITEGQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEAL 767

>gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Back     alignment
 Score = 43.9 bits (102), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 69/138 (50%), Gaps = 10/138 (7%)

Query: 201 KNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLT 259
           K+Q+  ++ ++  +  K   + ++ G  GSGKT V L  +AA +  G Q +I+ P I + 
Sbjct: 275 KSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAP-IGIL 333

Query: 260 SAILERFQKRFGVKPAEWHSSLSTSM----REKIWRQVARGAISVIVGVRSALF---LPF 312
           +     F K++          ++ +M    R K   ++A G   +I+G   ALF   + +
Sbjct: 334 AQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTH-ALFQDSIQY 392

Query: 313 KKLGLIVIDEEHDISYKQ 330
            KL L+++DE+H    +Q
Sbjct: 393 YKLILVIVDEQHRFGVQQ 410

>gi|254780991|ref|YP_003065404.1| excinuclease ABC subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Back     alignment
 Score = 35.8 bits (81), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 70/171 (40%), Gaps = 27/171 (15%)

Query: 112 SALSETEKMEEKIQFTGIFPRINTVARLRVLDK--IKDGKIWEKRDLIRASQVSSHVIDG 169
           S++S +EK   +I    + P +  +ARL   D   +K+GKIW      R+  +++H  D 
Sbjct: 82  SSISMSEKQTREISEQTMTPSVQALARLIQSDNPLLKNGKIWTPH---RSWSINNHSKDI 138

Query: 170 LKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGS 229
                   Q+     P  D P                + Q++        V L+ GVTGS
Sbjct: 139 -----TFFQMQTDYHPSGDQPA--------------AIAQLLKGIHSREKVQLLLGVTGS 179

Query: 230 GKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSS 280
           GKT    +++ A   + +  +++ P   L + +   F+  F     E+  S
Sbjct: 180 GKTFTMAKVIEA---MQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVS 227

>gi|254780991|ref|YP_003065404.1| excinuclease ABC subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Back     alignment
 Score = 32.7 bits (73), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 11/113 (9%)

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYF--PLARISILSSDLEGGGGRLQLQLSAIAKGEID 538
           +    G  I      +R+AE++ EY      R+  + S+++    R+++ +  +  G+ D
Sbjct: 577 LAAQQGLRILLTVLTKRMAEDLTEYLYERNIRVRYMHSEVKTLE-RIEI-IRDLRLGKFD 634

Query: 539 IIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGR 591
           +++G  L+ +G + P   LV ++D D       LRS       L Q  GRA R
Sbjct: 635 VLVGINLLREGLDIPECGLVAILDAD---KEGFLRSKTS----LIQTIGRAAR 680

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target731 primosome assembly protein PriA [Candidatus Liberibacte
315121820729 primosome assembly protein PriA [Candidatus Liberibacte 1 0.0
190893721738 primosomal protein N' (replication factor Y) protein [R 1 0.0
241206630738 primosome assembly protein PriA [Rhizobium leguminosaru 1 0.0
327188924809 primosomal protein N' (replication factor Y) protein [R 1 0.0
116254144738 primosome assembly protein PriA [Rhizobium leguminosaru 1 0.0
86359456738 primosome assembly protein PriA [Rhizobium etli CFN 42] 1 0.0
209551229738 primosome assembly protein PriA [Rhizobium leguminosaru 1 0.0
222087443743 primosomal protein N' [Agrobacterium radiobacter K84] L 1 0.0
319780911727 DEAD/DEAH helicase [Mesorhizobium ciceri biovar biserru 1 0.0
150398124734 primosome assembly protein PriA [Sinorhizobium medicae 1 0.0
>gi|315121820|ref|YP_004062309.1| primosome assembly protein PriA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 729 Back     alignment and organism information
 Score = 1227 bits (3174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/731 (80%), Positives = 659/731 (90%), Gaps = 2/731 (0%)

Query: 1   MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN 60
           M SS +S E  VCS V++LLLQAVS PY YSVPS M+V LGSIVRVPLRSRTVLG+VWY+
Sbjct: 1   MVSSVTSSEAEVCSSVVVLLLQAVSSPYTYSVPSDMRVGLGSIVRVPLRSRTVLGVVWYD 60

Query: 61  SEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKM 120
           S   Y  D+LKLRPIEYVFDCPPLS++MCEF+KWVA+YTFS MGLVARMVVSALSETEKM
Sbjct: 61  S--VYTGDNLKLRPIEYVFDCPPLSQEMCEFIKWVANYTFSSMGLVARMVVSALSETEKM 118

Query: 121 EEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIF 180
           EEKIQFTGI PRINT ARLRVL++IKDGKIW KR+L+ ASQVSSHVIDGLK QGV+K+IF
Sbjct: 119 EEKIQFTGILPRINTAARLRVLNEIKDGKIWGKRNLMLASQVSSHVIDGLKEQGVVKKIF 178

Query: 181 EVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVA 240
           EV SPVV+SPN  F LP LD+NQ+DVVEQ++PLC+ GF+VSLISGVTGSGKTEVYLEI++
Sbjct: 179 EVASPVVESPNPNFFLPTLDQNQKDVVEQIMPLCSTGFSVSLISGVTGSGKTEVYLEIIS 238

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
           +VL LGKQVLILLPEISL SAIL+RFQKRFGVKPAEWHSSLS  MREKIWRQ+A+G ISV
Sbjct: 239 SVLRLGKQVLILLPEISLASAILDRFQKRFGVKPAEWHSSLSAGMREKIWRQIAQGTISV 298

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           +VGVRSALFLPFKKLG+IVIDEEHDISYKQE+GILYNARDMSIVRGKIESFPV+LVSATP
Sbjct: 299 VVGVRSALFLPFKKLGIIVIDEEHDISYKQEDGILYNARDMSIVRGKIESFPVILVSATP 358

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           SIESRVNG+S RYH  HLSTRY NSALPHL+VIDMR Q + +GK LS EM++ IR+TL R
Sbjct: 359 SIESRVNGLSGRYHFFHLSTRYHNSALPHLRVIDMRDQAVERGKFLSLEMLNSIRNTLER 418

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
           +EQ LLFLNRRGYAPLTLCQVCG+R+KC +CSCWLVEHR +KKL+CHQCG+   Y QSC 
Sbjct: 419 DEQALLFLNRRGYAPLTLCQVCGHRIKCPYCSCWLVEHRFRKKLHCHQCGYVEAYPQSCA 478

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CG+SGKMIACG G+ERIAEEV +YFPLARISILSSDL+GG  +L+LQL AIAKGE DI+
Sbjct: 479 ACGTSGKMIACGPGVERIAEEVRDYFPLARISILSSDLDGGIKKLRLQLEAIAKGEFDIV 538

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLVAKGHNFPRMSLVGV+DGDLGL NADLRSSERTFQLLSQVTGRAGRFGLKS+GLI
Sbjct: 539 IGTQLVAKGHNFPRMSLVGVIDGDLGLANADLRSSERTFQLLSQVTGRAGRFGLKSIGLI 598

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           QAYQP HPVMQAL+SGDADSFYESEIRAR+ V LPPFGRLAAVI+SG K QEV+ YA NL
Sbjct: 599 QAYQPIHPVMQALISGDADSFYESEIRARKEVGLPPFGRLAAVIVSGKKCQEVKKYACNL 658

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
           KE AP SSDIVVFGPAE+PLFMVRG YRFRLLIHGKRNSNLQ FF+ MYDNT K+SN+LR
Sbjct: 659 KEKAPMSSDIVVFGPAEAPLFMVRGFYRFRLLIHGKRNSNLQKFFAYMYDNTPKKSNSLR 718

Query: 721 VQFDIDPQNFL 731
           VQFD+DPQ+FL
Sbjct: 719 VQFDMDPQSFL 729


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190893721|ref|YP_001980263.1| primosomal protein N' (replication factor Y) protein [Rhizobium etli CIAT 652] Length = 738 Back     alignment and organism information
>gi|241206630|ref|YP_002977726.1| primosome assembly protein PriA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 738 Back     alignment and organism information
>gi|327188924|gb|EGE56116.1| primosomal protein N' (replication factor Y) protein [Rhizobium etli CNPAF512] Length = 809 Back     alignment and organism information
>gi|116254144|ref|YP_769982.1| primosome assembly protein PriA [Rhizobium leguminosarum bv. viciae 3841] Length = 738 Back     alignment and organism information
>gi|86359456|ref|YP_471348.1| primosome assembly protein PriA [Rhizobium etli CFN 42] Length = 738 Back     alignment and organism information
>gi|209551229|ref|YP_002283146.1| primosome assembly protein PriA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 738 Back     alignment and organism information
>gi|222087443|ref|YP_002545980.1| primosomal protein N' [Agrobacterium radiobacter K84] Length = 743 Back     alignment and organism information
>gi|319780911|ref|YP_004140387.1| DEAD/DEAH helicase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 727 Back     alignment and organism information
>gi|150398124|ref|YP_001328591.1| primosome assembly protein PriA [Sinorhizobium medicae WSM419] Length = 734 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target731 primosome assembly protein PriA [Candidatus Liberibacte
PRK05580679 PRK05580, PRK05580, primosome assembly protein PriA; Va 0.0
COG1198730 COG1198, PriA, Primosomal protein N' (replication facto 0.0
TIGR00595505 TIGR00595, priA, primosomal protein N' 1e-156
PRK14873665 PRK14873, PRK14873, primosome assembly protein PriA; Pr 3e-24
pfam00270167 pfam00270, DEAD, DEAD/DEAH box helicase 6e-18
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-17
COG11971139 COG1197, Mfd, Transcription-repair coupling factor (sup 1e-11
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-11
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication, rec 1e-10
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 1e-09
PRK106891147 PRK10689, PRK10689, transcription-repair coupling facto 1e-07
TIGR00580926 TIGR00580, mfd, transcription-repair coupling factor (m 2e-10
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase require 5e-07
COG1204 766 COG1204, COG1204, Superfamily II helicase [General func 4e-04
KOG0952 1230 KOG0952, KOG0952, KOG0952, DNA/RNA helicase MER3/SLH1, 0.004
PRK10917681 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Pr 5e-06
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA replica 1e-04
COG1110 1187 COG1110, COG1110, Reverse gyrase [DNA replication, reco 0.003
pfam05707183 pfam05707, Zot, Zonular occludens toxin (Zot) 0.004
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily II [ 9e-05
TIGR00631655 TIGR00631, uvrb, excinuclease ABC, B subunit 1e-04
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excision rep 3e-04
smart0049082 smart00490, HELICc, helicase superfamily c-terminal dom 0.002
pfam04851103 pfam04851, ResIII, Type III restriction enzyme, res sub 4e-04
>gnl|CDD|180144 PRK05580, PRK05580, primosome assembly protein PriA; Validated Back     alignment and domain information
>gnl|CDD|31391 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|161946 TIGR00595, priA, primosomal protein N' Back     alignment and domain information
>gnl|CDD|184873 PRK14873, PRK14873, primosome assembly protein PriA; Provisional Back     alignment and domain information
>gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|31390 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|28927 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|31393 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|161975 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|182649 PRK10689, PRK10689, transcription-repair coupling factor; Provisional Back     alignment and domain information
>gnl|CDD|161938 TIGR00580, mfd, transcription-repair coupling factor (mfd) Back     alignment and domain information
>gnl|CDD|33855 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31397 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|36170 KOG0952, KOG0952, KOG0952, DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|182836 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>gnl|CDD|30860 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31307 COG1110, COG1110, Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|114433 pfam05707, Zot, Zonular occludens toxin (Zot) Back     alignment and domain information
>gnl|CDD|31261 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|161969 TIGR00631, uvrb, excinuclease ABC, B subunit Back     alignment and domain information
>gnl|CDD|30902 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|128766 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|147155 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 731 primosome assembly protein PriA [Candidatus Liberibacte
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 100.0
PRK05580699 primosome assembly protein PriA; Validated 100.0
TIGR00595524 priA primosomal protein N'; InterPro: IPR005259 All pro 100.0
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 100.0
TIGR00580997 mfd transcription-repair coupling factor; InterPro: IPR 100.0
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 100.0
COG11971139 Mfd Transcription-repair coupling factor (superfamily I 100.0
COG1200677 RecG RecG-like helicase [DNA replication, recombination 100.0
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 99.96
PRK05298657 excinuclease ABC subunit B; Provisional 99.77
COG1204 766 Superfamily II helicase [General function prediction on 99.73
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.66
PRK13767 878 ATP-dependent helicase; Provisional 99.62
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 99.54
COG1205 851 Distinct helicase family with a unique C-terminal domai 99.49
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, reco 99.44
KOG0354746 consensus 99.41
KOG0344593 consensus 99.31
KOG0333673 consensus 99.25
KOG0348708 consensus 99.22
KOG0951 1674 consensus 99.19
KOG0342543 consensus 99.12
KOG0335482 consensus 99.01
KOG0351 941 consensus 98.84
TIGR01389 607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 98.73
KOG4284 980 consensus 98.72
KOG0328400 consensus 98.71
KOG0327397 consensus 98.67
KOG0352 641 consensus 98.56
TIGR00614497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 98.4
COG4889 1518 Predicted helicase [General function prediction only] 98.26
KOG0948 1041 consensus 96.58
PRK10689 1148 transcription-repair coupling factor; Provisional 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 99.57
KOG0952 1230 consensus 99.55
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 99.52
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 99.45
KOG0345567 consensus 99.34
PRK09694878 hypothetical protein; Provisional 99.26
COG4096 875 HsdR Type I site-specific restriction-modification syst 98.98
KOG0350620 consensus 98.75
KOG0334 997 consensus 98.73
KOG0920 924 consensus 97.84
COG0610 962 Type I site-specific restriction-modification system, R 96.51
KOG0353 695 consensus 95.96
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 92.64
KOG0387 923 consensus 91.07
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 99.83
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 99.8
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.76
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.76
PRK01172 674 ski2-like helicase; Provisional 99.76
PRK02362 736 ski2-like helicase; Provisional 99.75
PRK00254 717 ski2-like helicase; Provisional 99.74
PTZ00110602 helicase; Provisional 99.7
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 99.63
KOG0343 758 consensus 98.89
KOG0347731 consensus 98.63
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 99.82
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 99.8
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 99.78
KOG0330476 consensus 99.37
KOG0346569 consensus 98.93
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 99.78
COG1197 1139 Mfd Transcription-repair coupling factor (superfamily I 96.61
TIGR00580 997 mfd transcription-repair coupling factor; InterPro: IPR 95.41
PRK13766 764 Hef nuclease; Provisional 99.77
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 99.54
smart00487201 DEXDc DEAD-like helicases superfamily. 99.53
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 99.43
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 99.14
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 98.82
KOG0947 1248 consensus 98.38
PRK04914 955 ATP-dependent helicase HepA; Validated 98.31
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 97.99
pfam05876552 Terminase_GpA Phage terminase large subunit (GpA). This 97.86
TIGR01074 677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 96.53
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 96.02
PRK00149447 dnaA chromosomal replication initiation protein; Review 95.46
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 95.23
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 95.03
PRK06526254 transposase; Provisional 94.94
PRK08181269 transposase; Validated 94.86
PRK12422455 chromosomal replication initiation protein; Provisional 94.09
KOG0949 1330 consensus 92.52
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 91.71
PRK09183258 transposase/IS protein; Provisional 91.18
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 99.69
smart0049082 HELICc helicase superfamily c-terminal domain. 98.17
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 97.9
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 94.16
KOG0331519 consensus 99.48
COG1202 830 Superfamily II helicase, archaea-specific [General func 99.35
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.16
KOG0338691 consensus 98.92
KOG0339731 consensus 98.73
KOG0336629 consensus 98.66
KOG0332477 consensus 98.35
KOG0326459 consensus 98.29
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 94.07
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 99.43
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 98.1
KOG0950 1008 consensus 97.32
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 97.15
PHA00350402 putative assembly protein 96.95
pfam07517381 SecA_DEAD SecA DEAD-like domain. SecA protein binds to 96.92
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 96.83
PRK05636507 replicative DNA helicase; Provisional 96.62
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 96.48
PRK08082453 consensus 96.39
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 96.29
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 96.25
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 96.24
PRK07263453 consensus 96.06
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 96.01
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 95.9
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 95.77
PRK08116262 hypothetical protein; Validated 95.75
TIGR02759613 TraD_Ftype type IV conjugative transfer system coupling 95.74
KOG0329387 consensus 95.69
PRK06904472 replicative DNA helicase; Validated 95.56
PRK08006471 replicative DNA helicase; Provisional 95.39
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 95.29
PRK08760476 replicative DNA helicase; Provisional 94.96
PRK08506473 replicative DNA helicase; Provisional 94.9
KOG0922674 consensus 94.89
KOG0924 1042 consensus 94.74
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 94.61
COG1435201 Tdk Thymidine kinase [Nucleotide transport and metaboli 94.6
KOG0736953 consensus 94.57
PRK05595444 replicative DNA helicase; Provisional 94.49
PRK08694468 consensus 94.38
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 94.23
PRK08840464 replicative DNA helicase; Provisional 94.19
PRK09165484 replicative DNA helicase; Provisional 94.18
PRK05748448 replicative DNA helicase; Provisional 94.05
PRK06321472 replicative DNA helicase; Provisional 93.5
PRK05973237 replicative DNA helicase; Provisional 93.25
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 92.8
COG3972660 Superfamily I DNA and RNA helicases [General function p 92.45
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 92.28
PRK04296197 thymidine kinase; Provisional 92.21
PRK07004460 replicative DNA helicase; Provisional 91.41
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 90.66
KOG0923 902 consensus 90.33
PRK09401 1176 reverse gyrase; Reviewed 99.26
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 99.17
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 98.49
KOG0340442 consensus 98.17
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 97.59
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 97.41
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 97.36
PRK07952242 DNA replication protein DnaC; Validated 97.36
KOG18051100 consensus 97.27
PRK12377248 putative replication protein; Provisional 96.73
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 95.49
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 95.1
KOG0344593 consensus 94.77
KOG1002791 consensus 94.58
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 94.54
PRK09354350 recA recombinase A; Provisional 94.47
KOG4439901 consensus 94.3
COG1484254 DnaC DNA replication protein [DNA replication, recombin 94.15
KOG0390776 consensus 93.8
TIGR00614497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 93.46
PRK08270681 anaerobic ribonucleoside triphosphate reductase; Provis 92.3
KOG1123776 consensus 92.15
PRK13826 1102 Dtr system oriT relaxase; Provisional 92.06
PRK13889992 conjugal transfer relaxase TraA; Provisional 91.82
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 99.12
pfam04851103 ResIII Type III restriction enzyme, res subunit. 99.0
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 97.41
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 96.92
PRK05580699 primosome assembly protein PriA; Validated 96.91
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 96.83
KOG1803649 consensus 96.59
PRK05642234 DNA replication initiation factor; Validated 96.56
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 96.45
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 96.42
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 96.02
COG3973747 Superfamily I DNA and RNA helicases [General function p 95.95
PRK08903227 hypothetical protein; Validated 95.92
smart00382148 AAA ATPases associated with a variety of cellular activ 95.75
PRK06835330 DNA replication protein DnaC; Validated 95.71
smart00489289 DEXDc3 DEAD-like helicases superfamily. 95.58
smart00488289 DEXDc2 DEAD-like helicases superfamily. 95.58
PRK08084235 DNA replication initiation factor; Provisional 95.56
KOG0987540 consensus 95.54
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 95.52
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 95.48
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 95.48
PRK11054684 helD DNA helicase IV; Provisional 95.47
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 95.31
PRK10416499 cell division protein FtsY; Provisional 95.1
PRK10536262 hypothetical protein; Provisional 94.98
cd01394218 radB RadB. The archaeal protein radB shares similarity 94.83
PRK08727233 hypothetical protein; Validated 94.79
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 94.52
PRK06921265 hypothetical protein; Provisional 94.24
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.11
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 94.09
PRK06893229 DNA replication initiation factor; Validated 93.96
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 93.69
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 93.68
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.66
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 93.63
pfam06745231 KaiC KaiC. This family represents a conserved region wi 93.55
PRK13700732 conjugal transfer protein TraD; Provisional 93.39
PRK08939306 primosomal protein DnaI; Reviewed 93.37
cd03115173 SRP The signal recognition particle (SRP) mediates the 93.33
PRK08769319 DNA polymerase III subunit delta'; Validated 93.25
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 93.23
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polymerase 93.18
PRK04328250 hypothetical protein; Provisional 93.14
PRK06696227 uridine kinase; Validated 92.95
cd01124187 KaiC KaiC is a circadian clock protein primarily found 92.82
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 92.67
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 92.1
PRK06067241 flagellar accessory protein FlaH; Validated 92.1
KOG1802935 consensus 91.94
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 91.94
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 91.83
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 91.8
PRK11784333 tRNA 2-selenouridine synthase; Provisional 91.77
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 91.65
PRK08533230 flagellar accessory protein FlaH; Reviewed 91.42
PRK07667190 uridine kinase; Provisional 90.76
PRK13894320 conjugal transfer ATPase TrbB; Provisional 90.51
TIGR00376709 TIGR00376 DNA helicase, putative; InterPro: IPR004483 E 90.45
TIGR01407 944 dinG_rel DnaQ family exonuclease/DinG family helicase, 90.32
TIGR01587424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 99.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.96
PRK12904 833 preprotein translocase subunit SecA; Reviewed 98.17
COG1643845 HrpA HrpA-like helicases [DNA replication, recombinatio 98.17
PRK12906 823 secA preprotein translocase subunit SecA; Reviewed 97.94
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 97.8
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 97.7
COG1200677 RecG RecG-like helicase [DNA replication, recombination 97.58
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 97.16
COG1201814 Lhr Lhr-like helicases [General function prediction onl 96.44
CHL00122 891 secA preprotein translocase subunit SecA; Validated 96.38
PRK12326 775 preprotein translocase subunit SecA; Reviewed 96.23
PRK12903 885 secA preprotein translocase subunit SecA; Reviewed 96.19
PRK13767 878 ATP-dependent helicase; Provisional 96.16
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 96.14
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 96.06
PRK13107 908 preprotein translocase subunit SecA; Reviewed 95.81
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 95.6
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 95.1
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 95.02
KOG0952 1230 consensus 94.84
PRK09200 799 preprotein translocase subunit SecA; Reviewed 94.57
PRK01172674 ski2-like helicase; Provisional 94.43
PRK12902 946 secA preprotein translocase subunit SecA; Reviewed 93.9
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 93.73
PRK12898673 secA preprotein translocase subunit SecA; Reviewed 93.72
PRK02362736 ski2-like helicase; Provisional 93.55
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, reco 93.51
PRK12900 983 secA preprotein translocase subunit SecA; Reviewed 93.38
PRK12899 969 secA preprotein translocase subunit SecA; Reviewed 93.28
COG1379403 PHP family phosphoesterase with a Zn ribbon [General fu 92.86
PRK05541176 adenylylsulfate kinase; Provisional 91.67
PRK00254717 ski2-like helicase; Provisional 91.38
PRK12901 1111 secA preprotein translocase subunit SecA; Reviewed 90.42
PRK03846198 adenylylsulfate kinase; Provisional 90.4
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 98.6
KOG0337529 consensus 98.09
PRK05298657 excinuclease ABC subunit B; Provisional 96.23
TIGR00963 904 secA preprotein translocase, SecA subunit; InterPro: IP 95.05
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 97.17
COG0846250 SIR2 NAD-dependent protein deacetylases, SIR2 family [T 92.93
PRK00481239 NAD-dependent deacetylase; Provisional 92.81
KOG0925699 consensus 91.79
cd01410206 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) 90.43
PRK09194570 prolyl-tRNA synthetase; Provisional 90.31
PRK10689 1148 transcription-repair coupling factor; Provisional 97.17
PRK13342417 recombination factor protein RarA; Reviewed 93.05
KOG0341610 consensus 97.06
KOG0953700 consensus 95.95
PRK05582692 DNA topoisomerase I; Validated 97.0
PRK08620726 DNA topoisomerase III; Provisional 96.69
PRK08938692 DNA topoisomerase I; Validated 96.48
PRK08413733 consensus 96.41
PRK07219769 DNA topoisomerase I; Validated 96.39
PRK09137761 DNA topoisomerase I; Validated 95.96
COG288861 Predicted Zn-ribbon RNA-binding protein with a function 95.37
pfam04216283 FdhE Protein involved in formate dehydrogenase formatio 95.21
PRK09137761 DNA topoisomerase I; Validated 95.2
PRK03564307 formate dehydrogenase accessory protein FdhE; Provision 95.12
PRK11788389 hypothetical protein; Provisional 94.61
PRK05582692 DNA topoisomerase I; Validated 94.31
PRK03824135 hypA hydrogenase nickel incorporation protein; Provisio 93.96
PRK07220740 DNA topoisomerase I; Validated 93.55
PRK08938692 DNA topoisomerase I; Validated 93.26
PRK04023 1128 DNA polymerase II large subunit; Validated 93.14
PRK06266178 transcription initiation factor E subunit alpha; Valida 92.76
TIGR02487655 NrdD anaerobic ribonucleoside-triphosphate reductase; I 92.61
PRK00564117 hypA hydrogenase nickel incorporation protein; Provisio 92.53
PRK05823691 consensus 92.14
pfam0719170 DUF1407 Protein of unknown function (DUF1407). This fam 91.65
COG1675176 TFA1 Transcription initiation factor IIE, alpha subunit 91.58
pfam10083158 DUF2321 Uncharacterized protein conserved in bacteria ( 91.51
pfam09332346 Mcm10 Mcm10 replication factor. Mcm10 is a eukaryotic D 91.2
COG4260345 Membrane protease subunit, stomatin/prohibitin family [ 90.96
100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. These sequences are the archaeal DNA-directed RNA polymerase, subunit M (also known as transcription factor S), a protein related in size and sequence to certain eukaryotic RNA polymerase small subunits, and in sequence and function to the much larger eukaryotic transcription factor IIS (TFIIS). Although originally suggested to be a subunit of the archaeal RNA polymerase, it elutes separately from active polymerase in gel filtration experiments and acts, like TFIIs, as an induction factor for RNA cleavage by RNA polymerase . ; GO: 0003677 DNA binding, 0003700 transcription factor activity, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01384">TIGR01384111 TFS_arch transcription factor S; InterPro: IPR006288 DN 90.96
COG1096188 Predicted RNA-binding protein (consists of S1 domain an 90.95
PRK1182760 hypothetical protein; Provisional 90.5
COG4306160 Uncharacterized protein conserved in bacteria [Function 90.44
PRK03681114 hypA hydrogenase nickel incorporation protein; Validate 90.13
COG1571421 Predicted DNA-binding protein containing a Zn-ribbon do 90.12
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 96.72
pfam00308219 Bac_DnaA Bacterial dnaA protein. 95.49
PRK11823454 DNA repair protein RadA; Provisional 92.54
TIGR00416481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 92.5
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 90.91
TIGR00373168 TIGR00373 conserved hypothetical protein TIGR00373; Int 96.72
PRK00349944 uvrA excinuclease ABC subunit A; Reviewed 95.99
PRK04023 1128 DNA polymerase II large subunit; Validated 95.12
COG335797 Predicted transcriptional regulator containing an HTH d 93.47
TIGR03676403 aRF1/eRF1 peptide chain release factor 1, archaeal and 92.8
TIGR02642270 phage_xxxx uncharacterized phage protein; InterPro: IPR 92.3
COG1592166 Rubrerythrin [Energy production and conversion] 91.17
pfam01155112 HypA Hydrogenase expression/synthesis hypA family. Four 91.13
COG1439177 Predicted nucleic acid-binding protein, consists of a P 90.84
PRK08620726 DNA topoisomerase III; Provisional 96.63
PRK08413733 consensus 94.56
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 96.3
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 95.64
COG0210655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 95.18
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 94.79
PRK11773722 uvrD DNA-dependent helicase II; Provisional 94.49
pfam02146177 SIR2 Sir2 family. This region is characteristic of Sile 90.98
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 95.99
COG3587 985 Restriction endonuclease [Defense mechanisms] 94.99
PRK04195403 replication factor C large subunit; Provisional 92.56
PRK06450336 threonine synthase; Validated 92.25
PRK06260400 threonine synthase; Validated 91.38
PRK09263711 anaerobic ribonucleoside triphosphate reductase; Provis 90.82
KOG0926 1172 consensus 95.87
KOG09511674 consensus 95.64
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 95.54
smart0049082 HELICc helicase superfamily c-terminal domain. 92.72
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 91.23
COG1199654 DinG Rad3-related DNA helicases [Transcription / DNA re 95.47
KOG0340442 consensus 93.27
KOG0949 1330 consensus 92.36
PRK09694878 hypothetical protein; Provisional 94.78
PTZ00110602 helicase; Provisional 94.18
PRK07111703 anaerobic ribonucleoside triphosphate reductase; Provis 92.44
PRK06319864 DNA topoisomerase I/SWI domain fusion protein; Validate 94.77
pfam05621302 TniB Bacterial TniB protein. This family consists of se 94.41
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 94.23
PRK06620214 hypothetical protein; Validated 91.62
PRK09087226 hypothetical protein; Validated 91.35
CHL00174305 accD acetyl-CoA carboxylase beta subunit; Reviewed 94.04
TIGR00515292 accD acetyl-CoA carboxylase, carboxyl transferase, beta 93.18
PRK05654288 acetyl-CoA carboxylase subunit beta; Validated 92.95
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabol 91.55
PRK06319864 DNA topoisomerase I/SWI domain fusion protein; Validate 93.9
cd01409260 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) 90.71
COG38571108 AddB ATP-dependent nuclease, subunit B [DNA replication 93.86
PRK07219769 DNA topoisomerase I; Validated 93.73
PRK09001869 DNA topoisomerase I; Validated 91.19
PRK00133666 metG methionyl-tRNA synthetase; Reviewed 90.43
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 93.2
PRK10246 1047 exonuclease subunit SbcC; Provisional 92.73
PRK09401 1176 reverse gyrase; Reviewed 92.64
COG0068750 HypF Hydrogenase maturation factor [Posttranslational m 92.05
TIGR00143799 hypF [NiFe] hydrogenase maturation protein HypF; InterP 91.68
PRK08665733 ribonucleotide-diphosphate reductase subunit alpha; Val 91.57
PRK08579623 anaerobic ribonucleoside triphosphate reductase; Provis 90.97
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 91.41
TIGR00354 1173 polC DNA polymerase II, large subunit DP2; InterPro: IP 91.36
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 90.2
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N'; InterPro: IPR005259 All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG; InterPro: IPR004609 The ATP-dependent DNA helicase RecG 3 Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor; InterPro: IPR004576 All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transcribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354 consensus Back     alignment and domain information
>KOG0344 consensus Back     alignment and domain information
>KOG0333 consensus Back     alignment and domain information
>KOG0348 consensus Back     alignment and domain information
>KOG0951 consensus Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>KOG0335 consensus Back     alignment and domain information
>KOG0351 consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR006293 The ATP-dependent DNA helicase RecQ (3 Back     alignment and domain information
>KOG4284 consensus Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>KOG0327 consensus Back     alignment and domain information
>KOG0352 consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family; InterPro: IPR004589 The ATP-dependent DNA helicase RecQ (3 Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0948 consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0952 consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0345 consensus Back     alignment and domain information
>PRK09694 hypothetical protein; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0350 consensus Back     alignment and domain information
>KOG0334 consensus Back     alignment and domain information