254780620

254780620

iron-responsive transcriptional regulator

GeneID in NCBI database:8209620Locus tag:CLIBASIA_02535
Protein GI in NCBI database:254780620Protein Accession:YP_003065033.1
Gene range:+(651465, 651899)Protein Length:144aa
Gene description:iron-responsive transcriptional regulator
COG prediction:none
KEGG prediction:rirA; iron-responsive transcriptional regulator; K13772 Rrf2 family transcriptional regulator, iron-responsive regulator
SEED prediction:Iron-responsive repressor RirA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Rrf2 family transcriptional regulators
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGRRGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIECLVRNRSSIKKIFNAG
ccccHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHccc
cccccHHHHHHHHHHHHHccccccccHHHHHHHccccHHHHHHHHHHHHHcccEEEEEcccccEEccccHHHccHHHHHHccccccccHEcccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHccc
MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVetvrgrrggvrlcrpadqiTILDVVKATEESFFVAECFashkidcplvgscglTSVLRKALNAFFDVLTQYSIECLVRNRSSIKKIFNAG
mhltkrtdygIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIvetvrgrrggvrlcrpadqitILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIeclvrnrssikkifnag
MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETvrgrrggvrLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIECLVRNRSSIKKIFNAG
MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGRRGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIECLVRNRSSIKKIFNA*
MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGRRGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIECLVRNRSSIKKIFNAG
*HLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGRRGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIECLVRNRSSIKKIFN**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGRRGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIECLVRNRSSIKKIFNAG
MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGRRGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIECLVRNRSSIKKIFNAG
MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGRRGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIECLVRNRSSIKKIFNAG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target144 iron-responsive transcriptional regulator [Candidatus L
315121821144 iron-responsive transcriptional regulator [Candidatus L 1 1e-62
222084938162 rhizobial iron transcriptional regulator protein [Agrob 1 3e-45
15964483154 iron-responsive transcriptional regulator [Sinorhizobiu 1 8e-45
227820925154 iron-responsive transcriptional regulator [Sinorhizobiu 1 9e-45
325291641156 iron-responsive transcriptional regulator [Agrobacteriu 1 1e-44
6224919154 Aau3 protein [Sinorhizobium meliloti] Length = 154 1 1e-44
150395554154 iron-responsive transcriptional regulator [Sinorhizobiu 1 2e-44
15887554156 iron-responsive transcriptional regulator [Agrobacteriu 1 3e-44
222147641156 iron-responsive transcriptional regulator [Agrobacteriu 1 5e-43
163758625149 hypothetical protein HPDFL43_14417 [Hoeflea phototrophi 1 6e-43
>gi|315121821|ref|YP_004062310.1| iron-responsive transcriptional regulator [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 144 Back     alignment and organism information
 Score =  242 bits (618), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/143 (79%), Positives = 128/143 (89%)

Query: 1   MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGR 60
           MHLTKRTDYGIRVLMYCA++ D PNRI+QIAEACCISE FLFKILQPL KAGI+ETVRGR
Sbjct: 1   MHLTKRTDYGIRVLMYCALNQDCPNRIAQIAEACCISEFFLFKILQPLGKAGIIETVRGR 60

Query: 61  RGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFD 120
            GGVRLCRPADQIT+LDVVKATEESF++AECF  HKI CPLVG+C L+SV +KALNAFFD
Sbjct: 61  NGGVRLCRPADQITVLDVVKATEESFYMAECFGKHKISCPLVGNCNLSSVFQKALNAFFD 120

Query: 121 VLTQYSIECLVRNRSSIKKIFNA 143
           VL +YSIECLV++RS  KK+  A
Sbjct: 121 VLKRYSIECLVQDRSLYKKLLKA 143


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084938|ref|YP_002543467.1| rhizobial iron transcriptional regulator protein [Agrobacterium radiobacter K84] Length = 162 Back     alignment and organism information
>gi|15964483|ref|NP_384836.1| iron-responsive transcriptional regulator [Sinorhizobium meliloti 1021] Length = 154 Back     alignment and organism information
>gi|227820925|ref|YP_002824895.1| iron-responsive transcriptional regulator [Sinorhizobium fredii NGR234] Length = 154 Back     alignment and organism information
>gi|325291641|ref|YP_004277505.1| iron-responsive transcriptional regulator [Agrobacterium sp. H13-3] Length = 156 Back     alignment and organism information
>gi|6224919|gb|AAF06014.1|AF193764_1 Aau3 protein [Sinorhizobium meliloti] Length = 154 Back     alignment and organism information
>gi|150395554|ref|YP_001326021.1| iron-responsive transcriptional regulator [Sinorhizobium medicae WSM419] Length = 154 Back     alignment and organism information
>gi|15887554|ref|NP_353235.1| iron-responsive transcriptional regulator [Agrobacterium tumefaciens str. C58] Length = 156 Back     alignment and organism information
>gi|222147641|ref|YP_002548598.1| iron-responsive transcriptional regulator [Agrobacterium vitis S4] Length = 156 Back     alignment and organism information
>gi|163758625|ref|ZP_02165712.1| hypothetical protein HPDFL43_14417 [Hoeflea phototrophica DFL-43] Length = 149 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target144 iron-responsive transcriptional regulator [Candidatus L
PRK11920153 PRK11920, rirA, iron-responsive transcriptional regulat 4e-71
TIGR00738132 TIGR00738, rrf2_super, rrf2 family protein (putative tr 7e-28
PRK11014141 PRK11014, PRK11014, transcriptional repressor NsrR; Pro 3e-19
TIGR02944130 TIGR02944, suf_reg_Xantho, FeS assembly SUF system regu 4e-15
TIGR02010135 TIGR02010, IscR, iron-sulfur cluster assembly transcrip 4e-11
PRK10857164 PRK10857, PRK10857, DNA-binding transcriptional regulat 2e-07
COG1959150 COG1959, COG1959, Predicted transcriptional regulator [ 2e-31
pfam0208282 pfam02082, Rrf2, Transcriptional regulator 7e-23
COG4189 308 COG4189, COG4189, Predicted transcriptional regulator [ 0.003
>gnl|CDD|171344 PRK11920, rirA, iron-responsive transcriptional regulator; Reviewed Back     alignment and domain information
>gnl|CDD|129821 TIGR00738, rrf2_super, rrf2 family protein (putative transcriptional regulator) Back     alignment and domain information
>gnl|CDD|182900 PRK11014, PRK11014, transcriptional repressor NsrR; Provisional Back     alignment and domain information
>gnl|CDD|131989 TIGR02944, suf_reg_Xantho, FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information
>gnl|CDD|131065 TIGR02010, IscR, iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>gnl|CDD|182783 PRK10857, PRK10857, DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>gnl|CDD|32142 COG1959, COG1959, Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>gnl|CDD|145313 pfam02082, Rrf2, Transcriptional regulator Back     alignment and domain information
>gnl|CDD|33924 COG4189, COG4189, Predicted transcriptional regulator [Transcription] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 144 iron-responsive transcriptional regulator [Candidatus L
PRK11920153 rirA iron-responsive transcriptional regulator; Reviewe 100.0
PRK10857164 DNA-binding transcriptional regulator IscR; Provisional 100.0
TIGR00738133 rrf2_super rrf2 family protein (putative transcriptiona 100.0
PRK11014141 transcriptional repressor NsrR; Provisional 100.0
COG1959150 Predicted transcriptional regulator [Transcription] 100.0
TIGR02010140 IscR iron-sulfur cluster assembly transcription factor 100.0
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator; Inter 99.97
PRK04214411 rbn ribonuclease BN/unknown domain fusion protein; Revi 98.71
pfam0208282 Rrf2 Transcriptional regulator. This family is related 99.92
COG2524 294 Predicted transcriptional regulator, contains C-termina 98.63
pfam0344479 DUF293 Domain of unknown function. This domain is alway 98.63
PRK11886 319 biotin--protein ligase; Provisional 97.71
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and simi 97.22
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon 97.15
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulation. 97.11
COG3355126 Predicted transcriptional regulator [Transcription] 97.05
PRK10163 271 DNA-binding transcriptional repressor AllR; Provisional 96.98
PRK09834 264 DNA-binding transcriptional activator MhpR; Provisional 96.97
COG1725125 Predicted transcriptional regulators [Transcription] 96.89
pfam0827955 HTH_11 HTH domain. This family includes helix-turn-heli 96.89
COG165479 BirA Biotin operon repressor [Transcription] 96.87
PRK11569 274 transcriptional repressor IclR; Provisional 96.85
pfam0197868 TrmB Sugar-specific transcriptional regulator TrmB. One 96.79
COG1321154 TroR Mn-dependent transcriptional regulator [Transcript 96.74
PRK03902142 manganese transport transcriptional regulator; Provisio 96.74
PRK10141106 DNA-binding transcriptional repressor ArsR; Provisional 96.63
PRK09464 254 pdhR transcriptional regulator PdhR; Reviewed 96.62
PRK11050155 manganese transport regulator MntR; Provisional 96.51
COG1414 246 IclR Transcriptional regulator [Transcription] 96.41
PRK09990 251 DNA-binding transcriptional regulator GlcC; Provisional 96.38
PRK10421 253 DNA-binding transcriptional repressor LldR; Provisional 96.24
COG2378 311 Predicted transcriptional regulator [Transcription] 96.03
pfam0104759 MarR MarR family. The Mar proteins are involved in the 95.92
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resistanc 95.88
COG1378247 Predicted transcriptional regulators [Transcription] 95.82
PRK12423202 LexA repressor; Provisional 95.79
PRK10225 257 DNA-binding transcriptional repressor UxuR; Provisional 95.64
PRK11534224 DNA-binding transcriptional regulator CsiR; Provisional 95.61
pfam0039264 GntR Bacterial regulatory proteins, gntR family. This f 95.58
pfam0132558 Fe_dep_repress Iron dependent repressor, N-terminal DNA 95.57
PRK03837243 transcriptional regulator NanR; Provisional 95.54
COG2345218 Predicted transcriptional regulator [Transcription] 95.54
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcriptio 95.45
PRK11523 258 DNA-binding transcriptional repressor ExuR; Provisional 95.38
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding do 95.22
PRK00215204 LexA repressor; Validated 95.14
TIGR01884231 cas_HTH CRISPR locus-related DNA-binding protein; Inter 95.13
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory elem 95.08
pfam0172665 LexA_DNA_bind LexA DNA binding domain. This is the DNA 95.02
TIGR03338212 phnR_burk phosphonate utilization associated transcript 94.98
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 94.93
COG1420 346 HrcA Transcriptional regulator of heat shock gene [Tran 94.8
COG1802230 GntR Transcriptional regulators [Transcription] 94.71
pfam0920282 Rio2_N Rio2, N-terminal. Members of this family are fou 94.4
COG4189 308 Predicted transcriptional regulator [Transcription] 94.33
PRK11753211 cAMP-regulatory protein; Provisional 94.23
TIGR03337231 phnR transcriptional regulator protein. This family of 94.18
COG1497 260 Predicted transcriptional regulator [Transcription] 94.15
PRK10079241 putative transcriptional regulator; Provisional 94.07
PRK09764239 DNA-binding transcriptional repressor MngR; Provisional 93.96
PRK00082 339 hrcA heat-inducible transcription repressor; Provisiona 93.95
PRK11402243 DNA-binding transcriptional regulator FrlR; Provisional 93.9
PRK10430239 DNA-binding transcriptional activator DcuR; Provisional 93.87
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Provisi 93.81
pfam02002105 TFIIE_alpha TFIIE alpha subunit. The general transcript 93.8
PRK10710240 DNA-binding transcriptional regulator BaeR; Provisional 93.64
COG1846126 MarR Transcriptional regulators [Transcription] 93.58
COG4465261 CodY Pleiotropic transcriptional repressor [Transcripti 93.58
PRK06474180 hypothetical protein; Provisional 93.57
PRK04984239 fatty acid metabolism regulator; Provisional 93.5
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 93.36
pfam01475120 FUR Ferric uptake regulator family. This family include 93.34
PRK13509 251 transcriptional repressor UlaR; Provisional 93.27
COG2512258 Predicted membrane-associated trancriptional regulator 93.1
PRK10402213 DNA-binding transcriptional activator YeiL; Provisional 93.07
PRK10906 252 DNA-binding transcriptional repressor GlpR; Provisional 92.93
TIGR02431 252 pcaR_pcaU beta-ketoadipate pathway transcriptional regu 92.83
PRK11414221 putative DNA-binding transcriptional regulator; Provisi 92.78
PRK11161235 fumarate/nitrate reduction transcriptional regulator; P 92.66
PRK09954 362 hypothetical protein; Provisional 92.57
COG1349 253 GlpR Transcriptional regulators of sugar metabolism [Tr 92.47
PRK13918201 CRP/FNR family transcriptional regulator; Provisional 92.39
TIGR02325240 C_P_lyase_phnF phosphonates metabolism transcriptional 92.38
PRK11179153 DNA-binding transcriptional regulator AsnC; Provisional 92.29
cd0038395 trans_reg_C Effector domain of response regulator. Bact 92.29
PRK09213 274 purine operon repressor; Provisional 92.23
PRK03573144 transcriptional regulator SlyA; Provisional 92.22
PRK10701240 DNA-binding transcriptional regulator RstA; Provisional 92.14
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-ter 91.95
PRK13626 551 transcriptional regulator SgrR; Provisional 91.94
PRK10161229 transcriptional regulator PhoB; Provisional 91.84
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminases. He 91.82
PRK04158256 transcriptional repressor CodY; Validated 91.76
PRK10870176 transcriptional repressor MprA; Provisional 91.74
COG2188236 PhnF Transcriptional regulators [Transcription] 91.54
COG1522154 Lrp Transcriptional regulators [Transcription] 91.39
smart0086278 Trans_reg_C Transcriptional regulatory protein, C termi 91.3
PRK11169164 leucine-responsive transcriptional regulator; Provision 91.3
COG5340 269 Predicted transcriptional regulator [Transcription] 91.29
PRK11639169 zinc uptake transcriptional repressor; Provisional 91.18
TIGR02404236 trehalos_R_Bsub trehalose operon repressor; InterPro: I 91.18
PRK03911 258 heat-inducible transcription repressor; Provisional 91.16
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor 91.02
COG1339214 Transcriptional regulator of a riboflavin/FAD biosynthe 90.87
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an autogenou 90.69
pfam0918270 PuR_N Bacterial purine repressor, N-terminal. The N-ter 90.68
COG2186241 FadR Transcriptional regulators [Transcription] 90.66
TIGR02787255 codY_Gpos GTP-sensing transcriptional pleiotropic repre 90.61
PRK11512144 DNA-binding transcriptional repressor MarR; Provisional 90.61
PRK09391224 fixK transcriptional regulator FixK; Provisional 90.6
PRK09468239 ompR osmolarity response regulator; Provisional 90.55
PRK09836226 DNA-binding transcriptional activator CusR; Provisional 90.54
CHL00148240 orf27 Ycf27; Reviewed 90.51
TIGR02812 275 fadR_gamma fatty acid metabolism transcriptional regula 90.5
COG2390 321 DeoR Transcriptional regulator, contains sigma factor-r 90.49
PRK10046225 dpiA two-component response regulator DpiA; Provisional 90.44
pfam0822057 HTH_DeoR DeoR-like helix-turn-helix domain. 90.33
PRK11832207 putative DNA-binding transcriptional regulator; Provisi 90.3
cd07153116 Fur_like Ferric uptake regulator(Fur) and related metal 90.23
pfam05732165 RepL Firmicute plasmid replication protein (RepL). This 90.19
pfam0048677 Trans_reg_C Transcriptional regulatory protein, C termi 90.17
pfam0784870 PaaX PaaX-like protein. This family contains proteins t 90.11
pfam05158313 RNA_pol_Rpc34 RNA polymerase Rpc34 subunit. Subunit spe 90.09
COG1510177 Predicted transcriptional regulators [Transcription] 90.09
pfam0933952 HTH_IclR IclR helix-turn-helix domain. 96.52
pfam0102247 HTH_5 Bacterial regulatory protein, arsR family. Member 95.73
smart00531147 TFIIE Transcription initiation factor IIE. 91.1
COG1777217 Predicted transcriptional regulators [Transcription] 90.76
>PRK11920 rirA iron-responsive transcriptional regulator; Reviewed Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator); InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulphovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis strain PCC 6803 hypothetical protein slr0846 Back     alignment and domain information
>PRK11014 transcriptional repressor NsrR; Provisional Back     alignment and domain information
>COG1959 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR; InterPro: IPR010242 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator; InterPro: IPR014290 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>PRK04214 rbn ribonuclease BN/unknown domain fusion protein; Reviewed Back     alignment and domain information
>pfam02082 Rrf2 Transcriptional regulator Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>pfam03444 DUF293 Domain of unknown function Back     alignment and domain information
>PRK11886 biotin--protein ligase; Provisional Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>COG1725 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>pfam08279 HTH_11 HTH domain Back     alignment and domain information
>COG1654 BirA Biotin operon repressor [Transcription] Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>pfam01978 TrmB Sugar-specific transcriptional regulator TrmB Back     alignment and domain information
>COG1321 TroR Mn-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PRK09464 pdhR transcriptional regulator PdhR; Reviewed Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK09990 DNA-binding transcriptional regulator GlcC; Provisional Back     alignment and domain information
>PRK10421 DNA-binding transcriptional repressor LldR; Provisional Back     alignment and domain information
>COG2378 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>pfam01047 MarR MarR family Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>COG1378 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>PRK10225 DNA-binding transcriptional repressor UxuR; Provisional Back     alignment and domain information
>PRK11534 DNA-binding transcriptional regulator CsiR; Provisional Back     alignment and domain information
>pfam00392 GntR Bacterial regulatory proteins, gntR family Back     alignment and domain information
>pfam01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain Back     alignment and domain information
>PRK03837 transcriptional regulator NanR; Provisional Back     alignment and domain information
>COG2345 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PRK11523 DNA-binding transcriptional repressor ExuR; Provisional Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein; InterPro: IPR010163 Most but not all examples of this family are associated with CRISPR loci, a combination of DNA repeats and characteristic proteins encoded near the repeat cluster Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>pfam01726 LexA_DNA_bind LexA DNA binding domain Back     alignment and domain information
>TIGR03338 phnR_burk phosphonate utilization associated transcriptional regulator Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>COG1420 HrcA Transcriptional regulator of heat shock gene [Transcription] Back     alignment and domain information
>COG1802 GntR Transcriptional regulators [Transcription] Back     alignment and domain information
>pfam09202 Rio2_N Rio2, N-terminal Back     alignment and domain information
>COG4189 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11753 cAMP-regulatory protein; Provisional Back     alignment and domain information
>TIGR03337 phnR transcriptional regulator protein Back     alignment and domain information
>COG1497 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10079 putative transcriptional regulator; Provisional Back     alignment and domain information
>PRK09764 DNA-binding transcriptional repressor MngR; Provisional Back     alignment and domain information
>PRK00082 hrcA heat-inducible transcription repressor; Provisional Back     alignment and domain information
>PRK11402 DNA-binding transcriptional regulator FrlR; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>pfam02002 TFIIE_alpha TFIIE alpha subunit Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>COG4465 CodY Pleiotropic transcriptional repressor [Transcription] Back     alignment and domain information
>PRK06474 hypothetical protein; Provisional Back     alignment and domain information
>PRK04984 fatty acid metabolism regulator; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>pfam01475 FUR Ferric uptake regulator family Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>COG2512 Predicted membrane-associated trancriptional regulator [Transcription] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family; InterPro: IPR012794 Members of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism Back     alignment and domain information
>PRK11414 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PRK09954 hypothetical protein; Provisional Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02325 C_P_lyase_phnF phosphonates metabolism transcriptional regulator PhnF; InterPro: IPR012702 Members of this family are the PhnF protein associated with C-P lyase systems for utilization of phosphonates Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>cd00383 trans_reg_C Effector domain of response regulator Back     alignment and domain information
>PRK09213 purine operon repressor; Provisional Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>PRK13626 transcriptional regulator SgrR; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PRK04158 transcriptional repressor CodY; Validated Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>COG2188 PhnF Transcriptional regulators [Transcription] Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>smart00862 Trans_reg_C Transcriptional regulatory protein, C terminal Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>COG5340 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11639 zinc uptake transcriptional repressor; Provisional Back     alignment and domain information
>TIGR02404 trehalos_R_Bsub trehalose operon repressor; InterPro: IPR012770 This family consists of repressors of the GntR family typically associated with trehalose utilization operons Back     alignment and domain information
>PRK03911 heat-inducible transcription repressor; Provisional Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon [Transcription / Coenzyme metabolism] Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>pfam09182 PuR_N Bacterial purine repressor, N-terminal Back     alignment and domain information
>COG2186 FadR Transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY; InterPro: IPR014154 This entry represents pleiotropic repressors in Bacillus subtilis, CodY, and other Firmicutes (low-GC Gram-positive bacteria) that respond to intracellular levels of GTP and branched chain amino acids Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>TIGR02812 fadR_gamma fatty acid metabolism transcriptional regulator FadR; InterPro: IPR014178 Members of this entry are transcriptional regulators of fatty acid metabolism (FadR), including both biosynthesis and beta-oxidation reactions, which are found exclusively in a subset of Gammaproteobacteria with strictly one copy per genome Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>pfam08220 HTH_DeoR DeoR-like helix-turn-helix domain Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators Back     alignment and domain information
>pfam05732 RepL Firmicute plasmid replication protein (RepL) Back     alignment and domain information
>pfam00486 Trans_reg_C Transcriptional regulatory protein, C terminal Back     alignment and domain information
>pfam07848 PaaX PaaX-like protein Back     alignment and domain information
>pfam05158 RNA_pol_Rpc34 RNA polymerase Rpc34 subunit Back     alignment and domain information
>COG1510 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>pfam09339 HTH_IclR IclR helix-turn-helix domain Back     alignment and domain information
>pfam01022 HTH_5 Bacterial regulatory protein, arsR family Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>COG1777 Predicted transcriptional regulators [Transcription] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target144 iron-responsive transcriptional regulator [Candidatus L
3lwf_A159 Crystal Structure Of Putative Transcriptional Regul 2e-21
1xd7_A145 Crsytal Structure Of A Putative Dna Binding Protein 2e-11
1ylf_A149 X-Ray Crystal Structure Of Bc1842 Protein From Baci 2e-11
3k69_A162 Crystal Structure Of A Putative Transcriptional Reg 1e-06
>gi|295982422|pdb|3LWF|A Chain A, Crystal Structure Of Putative Transcriptional Regulator (Np_ From Listeria Innocua At 2.06 A Resolution Length = 159 Back     alignment and structure
 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 2   HLTKRTDYGIRVLMYCAIH-NDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGR 60
            +T +  YG+ + +  A    D P  +  IA+   +SE +L +++ PL  AGIV+++RG 
Sbjct: 21  KITTKGRYGLTITLELAKRIGDGPISLRSIAQDKNLSEHYLEQLIGPLRNAGIVKSIRGA 80

Query: 61  RGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFD 120
            GG  L    ++IT  D+++  E    + E     +             +  +  NA  D
Sbjct: 81  HGGYVLNGDPEKITAGDIIRTLEGPIVLVESXEDEEA--------AQRELWTRXRNAVRD 132

Query: 121 VLTQYSIECLVRN 133
           VL Q ++  L+++
Sbjct: 133 VLDQTTLSDLLKH 145


>gi|55670826|pdb|1XD7|A Chain A, Crsytal Structure Of A Putative Dna Binding Protein Length = 145 Back     alignment and structure
>gi|60594413|pdb|1YLF|A Chain A, X-Ray Crystal Structure Of Bc1842 Protein From Bacillus Cereus, A Member Of The Rrf2 Family Of Putative Transcription Regulators. Length = 149 Back     alignment and structure
>gi|262368151|pdb|3K69|A Chain A, Crystal Structure Of A Putative Transcriptional Regulator (Lp_0360) From Lactobacillus Plantarum At 1.95 A Resolution Length = 162 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target144 iron-responsive transcriptional regulator [Candidatus L
3lwf_A159 LIN1550 protein, putative transcriptional regulator; st 4e-30
1ylf_A149 RRF2 family protein; structural genomics, transcription 9e-22
1xd7_A145 YWNA; structural genomics, protein structure initiative 1e-21
3k69_A162 Putative transcription regulator; putative transcriptio 2e-21
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Length = 159 Back     alignment and structure
 Score =  125 bits (315), Expect = 4e-30
 Identities = 35/136 (25%), Positives = 65/136 (47%), Gaps = 9/136 (6%)

Query: 1   MHLTKRTDYGIRVLMYCAIH-NDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRG 59
           M +T +  YG+ + +  A    D P  +  IA+   +SE +L +++ PL  AGIV+++RG
Sbjct: 20  MKITTKGRYGLTITLELAKRIGDGPISLRSIAQDKNLSEHYLEQLIGPLRNAGIVKSIRG 79

Query: 60  RRGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFF 119
             GG  L    ++IT  D+++  E    + E     +             +  +  NA  
Sbjct: 80  AHGGYVLNGDPEKITAGDIIRTLEGPIVLVESMEDEE--------AAQRELWTRMRNAVR 131

Query: 120 DVLTQYSIECLVRNRS 135
           DVL Q ++  L+++ +
Sbjct: 132 DVLDQTTLSDLLKHST 147


>1ylf_A RRF2 family protein; structural genomics, transcription regulator, PSI, protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 Length = 149 Back     alignment and structure
>1xd7_A YWNA; structural genomics, protein structure initiative, winged helix DNA binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55 Length = 145 Back     alignment and structure
>3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} Length = 162 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target144 iron-responsive transcriptional regulator [Candidatus L
3lwf_A159 LIN1550 protein, putative transcriptional regulator; st 100.0
1ylf_A149 RRF2 family protein; structural genomics, transcription 100.0
1xd7_A145 YWNA; structural genomics, protein structure initiative 100.0
3k69_A162 Putative transcription regulator; putative transcriptio 100.0
3k0l_A162 Repressor protein; helix-turn-helix, structural genomic 95.28
1bia_A 321 BIRA bifunctional protein; transcription regulation; 2. 97.63
1j5y_A187 Transcriptional regulator, biotin repressor family; str 97.47
1mkm_A 249 ICLR transcriptional regulator; structural genomics, wi 97.31
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transcripti 97.22
1sfx_A109 Conserved hypothetical protein AF2008; structural genom 97.15
3cuo_A99 Uncharacterized HTH-type transcriptional regulator YGAV 97.02
3jth_A98 Transcription activator HLYU; transcription factor, RTX 97.01
1uly_A192 Hypothetical protein PH1932; helix-turn-helix, structur 96.91
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix motif, wi 96.9
2oqg_A114 Possible transcriptional regulator, ARSR family protein 96.88
2o0y_A 260 Transcriptional regulator; ICLR-family, structural geno 96.86
3by6_A126 Predicted transcriptional regulator; structural genomic 96.86
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptional r 96.86
1u2w_A122 CADC repressor, cadmium efflux system accessory protein 96.85
3bro_A141 Transcriptional regulator; helix_TURN_helix, multiple a 96.82
1fx7_A230 Iron-dependent repressor IDER; DTXR, iron-dependent reg 96.8
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, DNA-b 96.76
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A {Sul 96.75
2d1h_A109 ST1889, 109AA long hypothetical transcriptional regulat 96.75
3f6o_A118 Probable transcriptional regulator, ARSR family protein 96.73
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix-turn 96.7
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH motif, 96.7
3nqo_A189 MARR-family transcriptional regulator; structural genom 96.69
2p4w_A202 Transcriptional regulatory protein ARSR family; archaea 96.68
2kko_A108 Possible transcriptional regulatory protein (possibly A 96.67
1ku9_A152 Hypothetical protein MJ223; putative transcription fact 96.57
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, tran 96.56
2qq9_A226 Diphtheria toxin repressor; regulator, DTXR, helix-turn 96.55
2frh_A127 SARA, staphylococcal accessory regulator A; winged-heli 96.51
2ia2_A 265 Putative transcriptional regulator; SAD, PSI-2, structu 96.5
3hrs_A214 Metalloregulator SCAR; DTXR/MNTR family member, transcr 96.44
2wv0_A243 YVOA, HTH-type transcriptional repressor YVOA; DNA-bind 96.39
2hr3_A147 Probable transcriptional regulator; MCSG, structural ge 96.34
2g7u_A 257 Transcriptional regulator; ICLR family, structural geno 96.32
1y0u_A96 Arsenical resistance operon repressor, putative; struct 96.32
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, SAH, 96.24
2wte_A244 CSA3; antiviral protein, viral resistance, winged helix 96.22
2eth_A154 Transcriptional regulator, putative, MAR family; TM0816 96.19
1p4x_A250 Staphylococcal accessory regulator A homologue; winged- 96.18
2ek5_A129 Predicted transcriptional regulators; helix-turn-helix, 96.17
3eet_A272 Putative GNTR-family transcriptional regulator; structu 96.16
3neu_A125 LIN1836 protein; structural genomics, PSI-2, protein st 96.13
2h09_A155 Transcriptional regulator MNTR; transcription regulator 96.13
2r3s_A 335 Uncharacterized protein; methyltransferase domain, stru 96.1
3f6v_A151 Possible transcriptional regulator, ARSR family protein 96.09
2di3_A239 Bacterial regulatory proteins, GNTR family; helix-turn- 96.08
3cta_A230 Riboflavin kinase; structural genomics, transferase, PS 96.07
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01047, 96.03
1x19_A 359 CRTF-related protein; methyltransferase, bacteriochlloc 96.0
3dp7_A 363 SAM-dependent methyltransferase; structural genomics, p 95.95
3bdd_A142 Regulatory protein MARR; putative multiple antibiotic-r 95.93
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-helix, 95.92
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, midwes 95.87
2hs5_A239 Putative transcriptional regulator GNTR; APC6050, rhodo 95.84
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; PSI- 95.83
1hw1_A239 FADR, fatty acid metabolism regulator protein; helix-tu 95.77
2gxg_A146 146AA long hypothetical transcriptional regulator; wing 95.75
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl methioni 95.74
3ihu_A222 Transcriptional regulator, GNTR family; YP_298823.1, DN 95.68
3dbw_A226 Transcriptional regulator, GNTR family; structural geno 95.68
2qlz_A232 Transcription factor PF0095; 2.50A {Pyrococcus furiosus 95.63
2nyx_A168 Probable transcriptional regulatory protein, RV1404; al 95.62
3g3z_A145 NMB1585, transcriptional regulator, MARR family; transc 95.58
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracycline 95.54
3c7j_A237 Transcriptional regulator, GNTR family; structural geno 95.54
2fbh_A146 Transcriptional regulator PA3341; MARR, transcription r 95.53
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural genomi 95.52
3boq_A160 Transcriptional regulator, MARR family; structural geno 95.5
3k2z_A196 LEXA repressor; winged helix-turn-helix, SOS system, au 95.49
3ech_A142 MEXR, multidrug resistance operon repressor; winged hel 95.47
1p4x_A250 Staphylococcal accessory regulator A homologue; winged- 95.43
2fa5_A162 Transcriptional regulator MARR/EMRR family; multiple an 95.4
3edp_A236 LIN2111 protein; APC88337, listeria innocua CLIP11262, 95.33
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, meth 95.32
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-bindin 95.27
3bpv_A138 Transcriptional regulator; MARR, DNA binding, transcrip 95.27
2ip2_A 334 Probable phenazine-specific methyltransferase; pyocyani 95.26
2pex_A153 Transcriptional regulator OHRR; transcription regulator 95.25
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding protein 95.24
3f3x_A144 Transcriptional regulator, MARR family, putative; DNA b 95.23
1fp2_A 352 Isoflavone O-methytransferase; protein-product complex; 95.22
3bj6_A152 Transcriptional regulator, MARR family; helix-turn-heli 95.21
1z91_A147 Organic hydroperoxide resistance transcriptional regula 95.19
3bja_A139 Transcriptional regulator, MARR family, putative; NP_97 95.17
3bwg_A239 Uncharacterized HTH-type transcriptional regulator YYDK 95.17
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fold; HE 95.16
2nnn_A140 Probable transcriptional regulator; structural genomics 95.15
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB0573, st 95.13
1v4r_A102 Transcriptional repressor; helix-turn-helix, winged-hel 95.05
3lmm_A583 Uncharacterized protein; multi-domained alpha-beta prot 95.05
1jhf_A202 LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {E 95.04
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, stru 95.01
3f8m_A248 GNTR-family protein transcriptional regulator; PHNF, HU 94.99
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, trans 94.96
1s3j_A155 YUSO protein; structural genomics, MARR transcriptional 94.87
3cjn_A162 Transcriptional regulator, MARR family; structural geno 94.81
3oop_A143 LIN2960 protein; protein structure initiative, PSI-2, s 94.8
2oz6_A207 Virulence factor regulator; winged helix, helix-turn-he 94.73
2obp_A96 Putative DNA-binding protein; YP_298295.1, structural g 94.69
3cdh_A155 Transcriptional regulator, MARR family; helix-turn-hlei 94.55
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; multidru 94.44
1jgs_A138 Multiple antibiotic resistance protein MARR; transcript 94.43
2z9m_A120 Response regulator YYCF; two-component system, YYCG, he 94.37
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, haloresp 94.33
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MARR, st 94.3
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-turn-hel 94.27
2fe3_A145 Peroxide operon regulator; oxidative stress regulator, 94.24
3e6m_A161 MARR family transcriptional regulator; APC88769, silici 94.2
2hqr_A223 Putative transcriptional regulator; phosporylation-inde 94.13
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerization he 94.09
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, CAMP 94.07
2fxa_A207 Protease production regulatory protein HPR; protease po 94.04
2hwv_A121 DNA-binding response regulator VICR; essential response 93.95
1qbj_A81 Protein (double-stranded RNA specific adenosine deamina 93.84
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmethionin 93.8
1gxq_A106 PHOB, phosphate regulon transcriptional regulatory prot 93.73
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcription 93.6
1opc_A110 OMPR, OMPRC; transcription regulation, response regulat 93.58
2gwr_A238 DNA-binding response regulator MTRA; two-component regu 93.58
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, struc 93.49
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, plan 93.45
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, path 93.37
2cfx_A144 HTH-type transcriptional regulator LRPC; transcriptiona 93.37
3dv8_A220 Transcriptional regulator, CRP/FNR family; RER070207001 93.32
3ic7_A126 Putative transcriptional regulator; helix-turn-helix, s 93.25
3df8_A111 Possible HXLR family transcriptional factor; APC89000, 93.25
1kgs_A225 DRRD, DNA binding response regulator D; DNA-binding pro 93.24
2ia0_A171 Putative HTH-type transcriptional regulator PF0864; ASN 93.18
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription; HET 93.08
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_604437.1, 93.06
2jzy_A112 Transcriptional regulatory protein PCOR; two-component- 93.05
3l09_A266 Putative transcriptional regulator; structural genomics 93.04
2zdb_A195 Transcriptional regulator, CRP family; CAMP-binding dom 93.02
2gau_A232 Transcriptional regulator, CRP/FNR family; structural g 92.97
2vn2_A128 DNAD, chromosome replication initiation protein; DNA re 92.74
2hqn_A109 Putative transcriptional regulator; phosporylation-inde 92.72
3la7_A243 Global nitrogen regulator; activator, DNA-binding, tran 92.69
2fbk_A181 Transcriptional regulator, MARR family; winged-helix-tu 92.64
2v79_A135 DNA replication protein DNAD; primosome, DNA remodellin 92.61
2pn6_A150 ST1022, 150AA long hypothetical transcriptional regulat 92.49
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP family, 92.4
2fmy_A220 COOA, carbon monoxide oxidation system transcription re 92.38
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP family; st 92.18
2k4j_A115 Putative transcriptional regulator; response regulator, 91.96
3kfw_X 247 Uncharacterized protein; structural genomics, PSI-2, pr 91.95
2w25_A150 Probable transcriptional regulatory protein; transcript 91.75
2fu4_A83 Ferric uptake regulation protein; DNA binding domain, h 91.58
1ys7_A233 Transcriptional regulatory protein PRRA; response regul 91.58
2v9v_A135 Selenocysteine-specific elongation factor; transcriptio 91.54
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, LRP/A 91.39
2o03_A131 Probable zinc uptake regulation protein FURB; DNA-bindi 91.28
1qgp_A77 Protein (double stranded RNA adenosine deaminase); Z-al 91.27
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor CODY; 91.25
1hsj_A487 Fusion protein consisting of staphylococcus accessary r 91.09
2w48_A 315 Sorbitol operon regulator; SORC, activator, repressor, 90.96
1ldj_A760 Cullin homolog 1, CUL-1; cullin, ROC1, HRT1, zinc ring 90.88
2oqr_A230 Sensory transduction protein REGX3; response regulator, 90.79
1o57_A 291 PUR operon repressor; purine operon repressor, helix-tu 90.77
2ra5_A247 Putative transcriptional regulator; beta structure, UTR 90.66
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide; str 90.66
2cyy_A151 Putative HTH-type transcriptional regulator PH1519; str 90.56
3d0s_A227 Transcriptional regulatory protein; CAMP receptor prote 90.55
3i4p_A162 Transcriptional regulator, ASNC family; PSI, structural 90.47
2pmu_A110 Response regulator PHOP; winged helix-TUN-HELX, transcr 90.44
2e1c_A171 Putative HTH-type transcriptional regulator PH1519; DNA 90.37
2dbb_A151 Putative HTH-type transcriptional regulator PH0061; ASN 90.36
3lmm_A583 Uncharacterized protein; multi-domained alpha-beta prot 90.03
2qww_A154 Transcriptional regulator, MARR family; YP_013417.1, mu 95.27
3kp7_A151 Transcriptional regulator TCAR; multiple drug resistanc 93.58
1stz_A 338 Heat-inducible transcription repressor HRCA homolog; ci 92.98
1ft9_A222 Carbon monoxide oxidation system transcription regulato 92.19
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Back     alignment and structure
Probab=100.00  E-value=6.5e-37  Score=237.74  Aligned_cols=128  Identities=27%  Similarity=0.443  Sum_probs=118.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHCC-CCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCCCCCEECCCHHHCCHHHHH
Q ss_conf             976456899999999998559-8633599999981997899999999993259057315654540002372126099999
Q gi|254780620|r    1 MHLTKRTDYGIRVLMYCAIHN-DYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGRRGGVRLCRPADQITILDVV   79 (144)
Q Consensus         1 Mkis~~~~yAi~~l~~La~~~-~~~~s~~eIA~~~~i~~~~l~kil~~L~~agli~S~rG~~GGy~Lak~~~~Itl~dI~   79 (144)
                      ||||++++||||+|++||.++ ++++|+++||+++++|++||+|||+.|+++|||+|+||++|||+|+++|++|||+||+
T Consensus        20 Mkls~k~~YAlr~L~~LA~~~~~~~vs~~eIAe~~~ip~~~L~kIl~~L~kaGlv~S~rG~~GGy~Lak~p~~ItL~dI~   99 (159)
T 3lwf_A           20 MKITTKGRYGLTITLELAKRIGDGPISLRSIAQDKNLSEHYLEQLIGPLRNAGIVKSIRGAHGGYVLNGDPEKITAGDII   99 (159)
T ss_dssp             SCCCHHHHHHHHHHHHHHHTTTSCCBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEECSTTCEEEECSCTTTCBHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCEECHHHHHHHHCCCHHHHHHHHHHHHCCCEEEECCCCCCCCEECCCCCCCCHHHHH
T ss_conf             87876586999999999808899819599999878909999999999983279388368888885455693028999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHCHHH
Q ss_conf             997187631114688778887656644799999999999999841799999915898
Q gi|254780620|r   80 KATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIECLVRNRSS  136 (144)
Q Consensus        80 ~aie~~~~~~~C~~~~~~~C~~~~~c~~~~~~~~~~~~~~~~L~~~TL~dl~~~~~~  136 (144)
                      +++||+..+++|..+        ..|.++.+|.++++++.+.|+++||+||+++...
T Consensus       100 ~aveg~~~~~~c~~~--------~~c~~~~~~~~i~~~~~~~L~~~TL~dL~~~~~~  148 (159)
T 3lwf_A          100 RTLEGPIVLVESMED--------EEAAQRELWTRMRNAVRDVLDQTTLSDLLKHSTD  148 (159)
T ss_dssp             HHHSCCCCSCCCCTT--------CCHHHHHHHHHHHHHHHHHHHHCBHHHHHHCCSC
T ss_pred             HHHCCCCCCCCCCCC--------CCHHHHHHHHHHHHHHHHHHCCCCHHHHHHCHHH
T ss_conf             998587776578999--------5067999999999999999875879999708775



>1ylf_A RRF2 family protein; structural genomics, transcription regulator, PSI, protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 Back     alignment and structure
>1xd7_A YWNA; structural genomics, protein structure initiative, winged helix DNA binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55 Back     alignment and structure
>3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor family; structural genomics, TM1602, JCSG, conserved hypothetical protein, PSI; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH motif, PSI, protein structure initiative; 1.55A {Archaeoglobus fulgidus dsm 4304} SCOP: a.4.5.50 Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulator YGAV; DNA-binding transcriptional regulator, structural genomics, PSI, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii OT3} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genomics, transcription; 2.05A {Pyrococcus horikoshii OT3} SCOP: a.4.5.28 Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics; 2.20A {Oenococcus oeni psu-1} Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; zinc, LEAD, SOFT metal ION resistance, ARSR/SMTB family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MARR), structural genomics, PSI-2; HET: MSE; 2.04A {Oenococcus oeni psu-1} SCOP: a.4.5.28 Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bonds; 2.05A {Sulfolobus tokodaii str} SCOP: a.4.5.50 Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DNA-binding, plasmid, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged helix, DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, activation, DNA-binding, ferrous iron, cytoplasm; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Rhodococcus SP} Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>2wv0_A YVOA, HTH-type transcriptional repressor YVOA; DNA-binding, transcription regulation, transcriptional regulator, GNTR/HUTC family; 2.40A {Bacillus subtilis} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, MCSG, PSI, protein structure initiative, midwest center for structural genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.4.5.5 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; TM0816, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>3eet_A Putative GNTR-family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.97A {Streptomyces avermitilis} Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.15A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>2di3_A Bacterial regulatory proteins, GNTR family; helix-turn-helix, transcription; 2.05A {Corynebacterium glutamicum} Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix DNA binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, S-adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum tls} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research, nysgxrc; 2.33A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis 89} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2hs5_A Putative transcriptional regulator GNTR; APC6050, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; 2.20A {Rhodococcus SP} SCOP: a.4.5.6 a.78.1.1 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>1hw1_A FADR, fatty acid metabolism regulator protein; helix-turn-helix, helix bundle, transcription; 1.50A {Escherichia coli} SCOP: a.4.5.6 a.78.1.1 PDB: 1hw2_A 1e2x_A 1h9g_A* 1h9t_A Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3ihu_A Transcriptional regulator, GNTR family; YP_298823.1, DNA binding protein, structural genomics, joint center for structural genomics; HET: MSE; 1.92A {Ralstonia eutropha JMP134} Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV1404; alpha/beta, structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structural genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3c7j_A Transcriptional regulator, GNTR family; structural genomics, MCSG, PSI-2, protein structure initiative; HET: MSE; 2.10A {Pseudomonas syringae PV} Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, PSI, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} PDB: 1lnw_A 3mex_A Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3edp_A LIN2111 protein; APC88337, listeria innocua CLIP11262, structural genomics, PSI-2, protein structure initiative; 2.09A {Listeria innocua} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in europe; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1- carboxylic acid, PHZM; 1.80A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>1fp2_A Isoflavone O-methytransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, structural genomics, PSI-2; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional regulator; OHRR, MARR family, bacterial transcription factor, DNA binding protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, structural genomics; 2.38A {Bacillus cereus atcc 10987} Back     alignment and structure
>3bwg_A Uncharacterized HTH-type transcriptional regulator YYDK; APC85486, structural genomics, PSI-2, protein structure initiative; 2.09A {Bacillus subtilis subsp} SCOP: a.4.5.6 d.190.1.2 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structural genomics; 1.99A {Neisseria meningitidis MC58} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>3lmm_A Uncharacterized protein; multi-domained alpha-beta protein, structural genomics, PSI- 2, protein structure initiative; 3.00A {Corynebacterium diphtheriae} Back     alignment and structure
>1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 1jhc_A 1jhe_A 1lea_A 1leb_A Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomics, PSI, protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3f8m_A GNTR-family protein transcriptional regulator; PHNF, HUTC, winged helix- turn-helix, UTRA, DNA-binding, transcription regulation; 1.80A {Mycobacterium smegmatis} Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure