254780621

254780621

small heat shock protein

GeneID in NCBI database:8209621Locus tag:CLIBASIA_02540
Protein GI in NCBI database:254780621Protein Accession:YP_003065034.1
Gene range:+(650820, 651293)Protein Length:157aa
Gene description:small heat shock protein
COG prediction:[O] Molecular chaperone (small heat shock protein)
KEGG prediction:small heat shock protein; K04080 molecular chaperone IbpA
SEED prediction:16 kDa heat shock protein A
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYLELLRSVPERMKPRRIEISQSPQESTKMIEEKKKSVAA
ccccccHHccccccHHHHHHHHHHHHccccccccccEEEEEEcccEEEEEEEcccccHHHEEEEEEccEEEEEEEcccccccccEEEEEEEEEEEEEEEEEcccccEEEEEEEcccEEEEEEccccccccccEEEEEcccccccccccccccccccc
ccccccHHHHHHHcHHHHHHHHHHHcccccccccccccEEEcccccEEEEEEEccccHHHcEEEEEccEEEEEcccccccHHHHHHHHHHHHHcHHHHHHcHHHEEEEcccccccccEEEEEEEcccHHccccEEEEcccccccHHHHHHHHHHHcc
MRLDVSRIYNSAVGYDTVLSmldglgapsqtsayppydiertgenaYRITIAvsgfhpseitievdssilmvrgekkseEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYLELLRSvpermkprrieisqspqeSTKMIEEKKKSVAA
MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEItievdssilmvrgekkseeketvEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYLELLRsvpermkprrieisqspqestkmieekkksvaa
MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASlengllylellRSVPERMKPRRIEISQSPQESTKMIEEKKKSVAA
MRLDVSRIYNSAVGYDTVLSMLDGL******SAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSIL******************RGIAKRAFERRFQLADFVEVMSASLENGLLYLELLRSVPERMKP*************************
MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRG********TVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYLELLRSVPERMKPRRIEISQ******************
MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYLELLRSVPERMKPRRIEISQS*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYLELLRSVPERMKPRRIEISQSPQESTKMIEEKKKSVAA
MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYLELLRSVPERMKPRRIEISQSPQESTKMIEEKKKSVAA
MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYLELLRSVPERMKPRRIEISQSPQESTKMIEEKKKSVAA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target157 small heat shock protein [Candidatus Liberibacter asiat
315121822157 small heat shock protein [Candidatus Liberibacter solan 1 3e-74
209550897156 heat shock protein Hsp20 [Rhizobium leguminosarum bv. t 1 7e-46
222149743155 small heat shock protein [Agrobacterium vitis S4] Lengt 1 8e-46
222087093154 molecular chaperone small heat shock protein [Agrobacte 1 9e-46
116253826156 heat shock protein A [Rhizobium leguminosarum bv. vicia 1 9e-46
218463809156 molecular chaperone small heat shock protein [Rhizobium 1 9e-46
15891075160 small heat shock protein [Agrobacterium tumefaciens str 1 1e-45
86359162156 molecular chaperone small heat shock protein [Rhizobium 1 1e-45
241206308156 heat shock protein Hsp20 [Rhizobium leguminosarum bv. t 1 1e-45
327189624156 molecular chaperone small heat shock protein [Rhizobium 1 2e-45
>gi|315121822|ref|YP_004062311.1| small heat shock protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 157 Back     alignment and organism information
 Score =  281 bits (718), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 149/157 (94%)

Query: 1   MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSE 60
           MR+DVSRIYNSAVGYDTVLSMLDGLGAPSQ+SAYPPYDIERTGENAY+IT+AV+GF  SE
Sbjct: 1   MRIDVSRIYNSAVGYDTVLSMLDGLGAPSQSSAYPPYDIERTGENAYKITVAVAGFSSSE 60

Query: 61  ITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYL 120
           + IEVDS IL+VRGEKKSEE+ETVEYLHRGIAKRAFERRFQLADFVEV+SASLENGLLYL
Sbjct: 61  LAIEVDSGILIVRGEKKSEEQETVEYLHRGIAKRAFERRFQLADFVEVVSASLENGLLYL 120

Query: 121 ELLRSVPERMKPRRIEISQSPQESTKMIEEKKKSVAA 157
           EL R+VPE+MKPRRIEIS SP+ES KMIE K+++VAA
Sbjct: 121 ELFRAVPEKMKPRRIEISNSPKESAKMIESKERAVAA 157


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209550897|ref|YP_002282814.1| heat shock protein Hsp20 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 156 Back     alignment and organism information
>gi|222149743|ref|YP_002550700.1| small heat shock protein [Agrobacterium vitis S4] Length = 155 Back     alignment and organism information
>gi|222087093|ref|YP_002545628.1| molecular chaperone small heat shock protein [Agrobacterium radiobacter K84] Length = 154 Back     alignment and organism information
>gi|116253826|ref|YP_769664.1| heat shock protein A [Rhizobium leguminosarum bv. viciae 3841] Length = 156 Back     alignment and organism information
>gi|218463809|ref|ZP_03503900.1| molecular chaperone small heat shock protein [Rhizobium etli Kim 5] Length = 156 Back     alignment and organism information
>gi|15891075|ref|NP_356747.1| small heat shock protein [Agrobacterium tumefaciens str. C58] Length = 160 Back     alignment and organism information
>gi|86359162|ref|YP_471054.1| molecular chaperone small heat shock protein [Rhizobium etli CFN 42] Length = 156 Back     alignment and organism information
>gi|241206308|ref|YP_002977404.1| heat shock protein Hsp20 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 156 Back     alignment and organism information
>gi|327189624|gb|EGE56774.1| molecular chaperone small heat shock protein [Rhizobium etli CNPAF512] Length = 156 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target157 small heat shock protein [Candidatus Liberibacter asiat
PRK10743137 PRK10743, PRK10743, heat shock protein IbpA; Provisiona 4e-34
PRK11597142 PRK11597, PRK11597, heat shock chaperone IbpB; Provisio 2e-28
COG0071146 COG0071, IbpA, Molecular chaperone (small heat shock pr 2e-22
KOG3591173 KOG3591, KOG3591, KOG3591, Alpha crystallins [Posttrans 3e-07
KOG0710196 KOG0710, KOG0710, KOG0710, Molecular chaperone (small h 1e-04
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) 3e-15
pfam00011102 pfam00011, HSP20, Hsp20/alpha crystallin family 9e-15
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family include 1e-09
cd0652683 cd06526, metazoan_ACD, Alpha-crystallin domain (ACD) of 1e-05
cd0647292 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD 4e-05
cd0647783 cd06477, ACD_HspB3_Like, Alpha crystallin domain (ACD) 8e-04
cd0647193 cd06471, ACD_LpsHSP_like, Group of bacterial proteins c 0.001
cd0648187 cd06481, ACD_HspB9_like, Alpha crystallin domain (ACD) 0.002
cd0647586 cd06475, ACD_HspB1_like, Alpha crystallin domain (ACD) 0.002
cd0647090 cd06470, ACD_IbpA-B_like, Alpha-crystallin domain (ACD) 3e-34
>gnl|CDD|182691 PRK10743, PRK10743, heat shock protein IbpA; Provisional Back     alignment and domain information
>gnl|CDD|183223 PRK11597, PRK11597, heat shock chaperone IbpB; Provisional Back     alignment and domain information
>gnl|CDD|30420 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|38798 KOG3591, KOG3591, KOG3591, Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35929 KOG0710, KOG0710, KOG0710, Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|109080 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|107247 cd06526, metazoan_ACD, Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>gnl|CDD|107232 cd06477, ACD_HspB3_Like, Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>gnl|CDD|107228 cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>gnl|CDD|107236 cd06481, ACD_HspB9_like, Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>gnl|CDD|107230 cd06475, ACD_HspB1_like, Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>gnl|CDD|107227 cd06470, ACD_IbpA-B_like, Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 157 small heat shock protein [Candidatus Liberibacter asiat
PRK11597142 heat shock chaperone IbpB; Provisional 100.0
PRK10743137 heat shock protein IbpA; Provisional 100.0
COG0071146 IbpA Molecular chaperone (small heat shock protein) [Po 99.97
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in 99.95
pfam00011102 HSP20 Hsp20/alpha crystallin family. 99.9
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in 99.88
cd0647193 ACD_LpsHSP_like Group of bacterial proteins containing 99.87
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan 99.72
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-c 99.69
KOG0710196 consensus 99.65
KOG3591173 consensus 99.58
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-c 99.56
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found in m 99.55
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain fou 99.53
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found in m 99.52
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain fou 99.49
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found in m 99.44
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found in m 99.4
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found in m 99.32
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found in m 99.31
cd0029880 ACD_sHsps_p23-like This domain family includes the alph 99.01
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in mamma 98.9
pfam08190325 PIH1 pre-RNA processing PIH1/Nop17. This domain is invo 96.72
pfam0496977 CS CS domain. The CS and CHORD (pfam04968) are fused in 96.26
cd0646384 p23_like Proteins containing this p23_like domain inclu 96.07
cd0646978 p23_DYX1C1_like p23_like domain found in proteins simil 96.06
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C-termi 95.22
pfam05455177 GvpH GvpH. This family consists of archaeal GvpH protei 95.16
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C-term 91.48
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear distribut 90.6
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>pfam00011 HSP20 Hsp20/alpha crystallin family Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>KOG0710 consensus Back     alignment and domain information
>KOG3591 consensus Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>pfam08190 PIH1 pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>pfam04969 CS CS domain Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>pfam05455 GvpH GvpH Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target157 small heat shock protein [Candidatus Liberibacter asiat
2klr_A175 Solid-State Nmr Structure Of The Alpha-Crystallin D 2e-05
1gme_A151 Crystal Structure And Assembly Of An Eukaryotic Sma 4e-05
3gt6_A103 Crystal Structure Of The Hspa From Xanthomonas Axon 4e-05
3gla_A100 Crystal Structure Of The Hspa From Xanthomonas Axon 6e-05
1shs_A147 Small Heat Shock Protein From Methanococcus Jannasc 2e-04
gi|300193094|pdb|2KLR|A Chain A, Solid-State Nmr Structure Of The Alpha-Crystallin Domain In Alphab- Crystallin Oligomers Length = 175 Back     alignment and structure
 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/168 (16%), Positives = 58/168 (34%), Gaps = 35/168 (20%)

Query: 2   RLDVSRIYNSAVGYDTVL-------SMLDGLGAPSQTSAYPP------------YDIERT 42
           R      ++ +  +D           +     + S     PP                R 
Sbjct: 11  RRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRL 70

Query: 43  GENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQL 102
            ++ + + + V  F P E+ ++V   ++ V G+              G   R F R++++
Sbjct: 71  EKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKH------EERQDEHGFISREFHRKYRI 124

Query: 103 ADFVE---VMSASLENGLLYLELLRSV---PERMKPRRIEISQSPQES 144
              V+   + S+   +G+L +   R     PE    R I I++  + +
Sbjct: 125 PADVDPLTITSSLSSDGVLTVNGPRKQVSGPE----RTIPITREEKPA 168


>gi|17942916|pdb|1GME|A Chain A, Crystal Structure And Assembly Of An Eukaryotic Small Heat Shock Protein Length = 151 Back     alignment and structure
>gi|323462845|pdb|3GT6|A Chain A, Crystal Structure Of The Hspa From Xanthomonas Axonopodis Length = 103 Back     alignment and structure
>gi|225734323|pdb|3GLA|A Chain A, Crystal Structure Of The Hspa From Xanthomonas Axonopodis Length = 100 Back     alignment and structure
gi|5822407|pdb|1SHS|A Chain A, Small Heat Shock Protein From Methanococcus Jannaschii Length = 147 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target157 small heat shock protein [Candidatus Liberibacter asiat
1gme_A151 Heat shock protein 16.9B; small heat shock protein, cha 6e-17
1shs_A147 Small heat shock protein; chaperone, beta-sandwich, str 4e-16
3l1e_A106 Alpha-crystallin A chain; lens transparency, polydisper 6e-15
2bol_A314 TSP36, small heat shock protein; A-crystallin, molecula 9e-15
2bol_A314 TSP36, small heat shock protein; A-crystallin, molecula 7e-12
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP, SHS 2e-13
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bond, s 2e-12
3aab_A123 Putative uncharacterized protein ST1653; alpha-crystall 3e-12
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer, het 2e-10
2wj7_A94 Alpha-crystallin B chain; desmin-related myopathy, phos 2e-09
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
 Score = 82.0 bits (202), Expect = 6e-17
 Identities = 30/128 (23%), Positives = 66/128 (51%), Gaps = 5/128 (3%)

Query: 15  YDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVD-SSILMVR 73
           + +++  + G G+ +   A    D + T   A+     + G    E+ +EV+  ++L+V 
Sbjct: 24  FRSIVPAISGGGSETAAFANARMDWKET-PEAHVFKADLPGVKKEEVKVEVEDGNVLVVS 82

Query: 74  GEKKS-EEKETVEYLHRGIAKRAFERRFQLADFVEV--MSASLENGLLYLELLRSVPERM 130
           GE+   +E +  ++     +   F RRF+L +  +V  + A LENG+L + + ++  ++ 
Sbjct: 83  GERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEVKKP 142

Query: 131 KPRRIEIS 138
           + + I+IS
Sbjct: 143 EVKAIQIS 150


>1shs_A Small heat shock protein; chaperone, beta-sandwich, structural genomics, PSI, protein structure initiative; 2.90A {Methanocaldococcus jannaschii} SCOP: b.15.1.1 Length = 147 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} Length = 100 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii str} PDB: 3aac_A Length = 123 Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} Length = 175 Back     alignment and structure
>2wj7_A Alpha-crystallin B chain; desmin-related myopathy, phosphoprotein, disease mutation, eye lens protein, methylation, polymorphism, glycoprotein; 2.63A {Homo sapiens} Length = 94 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target157 small heat shock protein [Candidatus Liberibacter asiat
1gme_A151 Heat shock protein 16.9B; small heat shock protein, cha 99.94
1shs_A147 Small heat shock protein; chaperone, beta-sandwich, str 99.93
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer, het 99.89
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP, SHS 99.87
3aab_A123 Putative uncharacterized protein ST1653; alpha-crystall 99.85
3l1e_A106 Alpha-crystallin A chain; lens transparency, polydisper 99.81
2bol_A314 TSP36, small heat shock protein; A-crystallin, molecula 99.78
2wj7_A94 Alpha-crystallin B chain; desmin-related myopathy, phos 99.78
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bond, s 99.76
2bol_A314 TSP36, small heat shock protein; A-crystallin, molecula 99.67
3igf_A374 ALL4481 protein; two-domained protein consisting of the 98.23
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90; cha 96.6
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domai 96.44
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sandwich, 95.7
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA sn 95.39
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, struct 92.14
2o30_A131 Nuclear movement protein; MCSG, structural genomics, PS 91.44
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
Probab=99.94  E-value=3.8e-26  Score=180.71  Aligned_cols=106  Identities=27%  Similarity=0.413  Sum_probs=90.2

Q ss_pred             CCCCCEEEEEECCCCEEEEEECCCCCHHHEEEEEEC-CEEEEEEEECCC-CCCCCCEEEEEEECCEEEEEEECCCCCEEE
Q ss_conf             888843689948993999997011770214999962-179999730332-355662134553023046889738661581
Q gi|254780621|r   32 SAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDS-SILMVRGEKKSE-EKETVEYLHRGIAKRAFERRFQLADFVEVM  109 (157)
Q Consensus        32 ~~~P~~dI~~~~e~~y~i~~~lPG~~kedi~V~v~~-~~LtI~g~~~~~-~~~~~~~~~~e~~~~~F~R~f~Lp~~ve~~  109 (157)
                      .++|++||+++ +++|+|+++|||++++||+|++++ +.|+|+|+++.+ +.++..|+++|+.+|+|+|+|.||++++..
T Consensus        41 ~~~p~~di~e~-~~~~~i~~~lPG~~~edi~v~v~~~~~l~i~~~~~~~~~~~~~~~~~~e~~~~~f~r~~~LP~~vd~~  119 (151)
T 1gme_A           41 FANARMDWKET-PEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVE  119 (151)
T ss_dssp             HGGGCEEEEEC-SSEEEEEEECTTCCGGGEEEEEETTTEEEEEECCCCCCCCTTCEEEECCCCCCCEEEEEECSSCCCGG
T ss_pred             CCCCCEEEEEC-CCEEEEEEECCCCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCEEEEEECCCEEEEEEECCCEEECC
T ss_conf             67883579987-99799999969997062399997897644102112445124463678777353698999888468113


Q ss_pred             --EEEEECCEEEEEEECCCCHHHCCEEEEEC
Q ss_conf             --03852885999974068601187288733
Q gi|254780621|r  110 --SASLENGLLYLELLRSVPERMKPRRIEIS  138 (157)
Q Consensus       110 --~A~~~nGiLtI~lpK~~pe~~~~r~I~I~  138 (157)
                        +|+|+||||+|+|||..++..++++|+|+
T Consensus       120 ~i~A~~~dGvL~I~lpK~~~~~~~~~~I~I~  150 (151)
T 1gme_A          120 EVKAGLENGVLTVTVPKAEVKKPEVKAIQIS  150 (151)
T ss_dssp             GCEEEEETTEEEEEEECCCCCTTCCCCCCCC
T ss_pred             CEEEEEECCEEEEEEECCCCCCCCCEEEECC
T ss_conf             1379987999999997577677886288446



>1shs_A Small heat shock protein; chaperone, beta-sandwich, structural genomics, PSI, protein structure initiative; 2.90A {Methanocaldococcus jannaschii} SCOP: b.15.1.1 Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii str} PDB: 3aac_A Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2wj7_A Alpha-crystallin B chain; desmin-related myopathy, phosphoprotein, disease mutation, eye lens protein, methylation, polymorphism, glycoprotein; 2.63A {Homo sapiens} PDB: 3l1g_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta fold and the C-terminal all beta domain., structural genomics, PSI-2; 2.00A {Nostoc SP} Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi gb-m1} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 157 small heat shock protein [Candidatus Liberibacter asiat
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum 2e-15
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon Methan 2e-15
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]
 Score = 75.6 bits (185), Expect = 2e-15
 Identities = 30/129 (23%), Positives = 66/129 (51%), Gaps = 5/129 (3%)

Query: 14  GYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDS-SILMV 72
            + +++  + G G+ +   A    D + T   A+     + G    E+ +EV+  ++L+V
Sbjct: 22  TFRSIVPAISGGGSETAAFANARMDWKET-PEAHVFKADLPGVKKEEVKVEVEDGNVLVV 80

Query: 73  RGEKKSEEKETVE-YLHRGIAKRAFERRFQLADFV--EVMSASLENGLLYLELLRSVPER 129
            GE+  E+++  + +     +   F RRF+L +    E + A LENG+L + + ++  ++
Sbjct: 81  SGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEVKK 140

Query: 130 MKPRRIEIS 138
            + + I+IS
Sbjct: 141 PEVKAIQIS 149


>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target157 small heat shock protein [Candidatus Liberibacter asiat
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum) [Ta 99.93
d1shsa_115 Small heat shock protein {Archaeon Methanococcus jannas 99.88
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Human (H 96.44
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human 96.02
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]
Probab=99.93  E-value=7.5e-26  Score=177.37  Aligned_cols=105  Identities=27%  Similarity=0.429  Sum_probs=89.5

Q ss_pred             CCCCEEEEEECCCCEEEEEECCCCCHHHEEEEEEC-CEEEEEEEECCCC-CCCCCEEEEEEECCEEEEEEECCCCCEE--
Q ss_conf             88843689948993999997011770214999962-1799997303323-5566213455302304688973866158--
Q gi|254780621|r   33 AYPPYDIERTGENAYRITIAVSGFHPSEITIEVDS-SILMVRGEKKSEE-KETVEYLHRGIAKRAFERRFQLADFVEV--  108 (157)
Q Consensus        33 ~~P~~dI~~~~e~~y~i~~~lPG~~kedi~V~v~~-~~LtI~g~~~~~~-~~~~~~~~~e~~~~~F~R~f~Lp~~ve~--  108 (157)
                      +.|++||.++ +++|+|+++|||++++||+|++++ +.|+|+|+++.+. .++..|+++|+.+|+|+|+|.||++++.  
T Consensus        41 ~~p~~dv~e~-~~~~~i~~~lPG~~~edi~v~v~~~~~l~i~~~~~~~~~~~~~~~~~~e~~~~~f~r~~~LP~~vd~~~  119 (150)
T d1gmea_          41 ANARMDWKET-PEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEE  119 (150)
T ss_dssp             GGGCEEEEEC-SSEEEEEEECTTCCGGGEEEEEETTTEEEEEECCCCCCCCTTCEEEECCCCCCCEEEEEECSSCCCGGG
T ss_pred             CCCCEEEEEC-CCEEEEEEEECCCCCCCEEEEEEECCCEEEEEEEECCCCCCCCEEEEEEECCCEEEEEEECCCCEEECE
T ss_conf             7873258987-997999999099964777999997653037888701454441225550023630889988788754031


Q ss_pred             EEEEEECCEEEEEEECCCCHHHCCEEEEEC
Q ss_conf             103852885999974068601187288733
Q gi|254780621|r  109 MSASLENGLLYLELLRSVPERMKPRRIEIS  138 (157)
Q Consensus       109 ~~A~~~nGiLtI~lpK~~pe~~~~r~I~I~  138 (157)
                      ++|+|+||||+|++||..++..+.++|+|+
T Consensus       120 i~A~~~nGvL~I~lpK~~~~~~~~~~I~I~  149 (150)
T d1gmea_         120 VKAGLENGVLTVTVPKAEVKKPEVKAIQIS  149 (150)
T ss_dssp             CEEEEETTEEEEEEECCCCCTTCCCCCCCC
T ss_pred             EEEEEECCEEEEEEECCCCCCCCCEEEECC
T ss_conf             689987999999987377678886388546



>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 157 small heat shock protein [Candidatus Liberibacter
1gme_A_37-151115 (A:37-151) Heat shock protein 16.9B; small heat sh 1e-16
3gla_A_100 (A:) Low molecular weight heat shock protein; HSPA 2e-15
2wj5_A_101 (A:) Heat shock protein beta-6; chaperone, disulfi 6e-15
1shs_A_147 (A:) Small heat shock protein; chaperone, beta-san 7e-15
2bol_A_95-19096 (A:95-190) TSP36, small heat shock protein; A-crys 3e-13
3igf_A_298-37477 (A:298-374) ALL4481 protein; two-domained protein 6e-05
>1gme_A (A:37-151) Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum}Length = 115 Back     alignment and structure
 Score = 80.1 bits (197), Expect = 1e-16
 Identities = 27/114 (23%), Positives = 56/114 (49%), Gaps = 5/114 (4%)

Query: 29  SQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVE--Y 86
           +   A    D + T   A+     + G    E+ +EV+   ++V   ++++EKE     +
Sbjct: 2   TAAFANARMDWKET-PEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKW 60

Query: 87  LHRGIAKRAFERRFQLADFVEV--MSASLENGLLYLELLRSVPERMKPRRIEIS 138
                +   F RRF+L +  +V  + A LENG+L + + ++  ++ + + I+IS
Sbjct: 61  HRVERSSGKFVRRFRLLEDAKVEEVKAGLENGVLTVTVPKAEVKKPEVKAIQIS 114


>3gla_A (A:) Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV}Length = 100 Back     alignment and structure
>2wj5_A (A:) Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus}Length = 101 Back     alignment and structure
>1shs_A (A:) Small heat shock protein; chaperone, beta-sandwich, structural genomics, PSI, protein structure initiative; 2.90A {Methanocaldococcus jannaschii}Length = 147 Back     alignment and structure
>2bol_A (A:95-190) TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata}Length = 96 Back     alignment and structure
>3igf_A (A:298-374) ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta fold and the C-terminal all beta domain., structural genomics, PSI-2; 2.00A {Nostoc SP}Length = 77 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target157 small heat shock protein [Candidatus Liberibacter asiat
1shs_A_147 Small heat shock protein; chaperone, beta-sandwich 99.92
1gme_A_37-151115 Heat shock protein 16.9B; small heat shock protein 99.86
3gla_A_100 Low molecular weight heat shock protein; HSPA, SHP 99.83
2wj5_A_101 Heat shock protein beta-6; chaperone, disulfide bo 99.82
2bol_A_95-19096 TSP36, small heat shock protein; A-crystallin, mol 99.75
3igf_A_298-37477 ALL4481 protein; two-domained protein consisting o 99.52
2jki_S_90 SGT1-like protein, cytosolic heat shock protein 90 98.23
2bol_A_60-94_191-314159 TSP36, small heat shock protein; A-crystallin, mol 97.98
1rl1_A_114 Suppressor of G2 allele of SKP1 homolog; beta sand 97.69
1wh0_A_134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 97.27
2o30_A_131 Nuclear movement protein; MCSG, structural genomic 96.89
1x5m_A_127 Calcyclin-binding protein; CS domain, structural g 96.21
3eud_A_115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 95.66
1wfi_A_131 Nuclear distribution gene C homolog; NUDC, riken s 95.03
2cr0_A_121 Nuclear migration protein NUDC; CS domain, beta sa 93.3
2k8q_A_134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 92.8
2kmw_A_150 Uncharacterized protein AT3G03773; protein structu 90.88
2wj7_A_22-6544 Alpha-crystallin B chain; desmin-related myopathy, 98.21
>1shs_A (A:) Small heat shock protein; chaperone, beta-sandwich, structural genomics, PSI, protein structure initiative; 2.90A {Methanocaldococcus jannaschii} Back     alignment and structure
Probab=99.92  E-value=2.7e-24  Score=170.20  Aligned_cols=121  Identities=16%  Similarity=0.207  Sum_probs=97.8

Q ss_pred             HHHHHHHHHHHHC--------CCCCCCCCCEEEEEECCCCEEEEEECCCCCHHHEEEEEECCEEEEEEEECCC--CCCCC
Q ss_conf             6788976454106--------6777888843689948993999997011770214999962179999730332--35566
Q gi|254780621|r   15 YDTVLSMLDGLGA--------PSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSE--EKETV   84 (157)
Q Consensus        15 fD~~f~~~~~~~~--------~~~~~~~P~~dI~~~~e~~y~i~~~lPG~~kedi~V~v~~~~LtI~g~~~~~--~~~~~   84 (157)
                      ||++++.++....        .....+.|++||+++ +++|.|.++|||++++||+|+++++.|+|+|++...  +....
T Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~di~e~-~~~~~i~~~lPG~~~edi~V~~~~~~l~i~~~~~~~~~~~~~~   93 (147)
T 1shs_A           15 FKEFFATPMTGTTMIQSSTGIQISGKGFMPISIIEG-DQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESER   93 (147)
T ss_dssp             ------------------CCCEEEEESCCCEEEEEC-SSEEEEEEECTTCCGGGEEEEEETTEEEEEEECCCCCCCTTCE
T ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEEC-CCEEEEEEECCCCCCCEEEEEECCCEEEEEEEECCCCCCCCCE
T ss_conf             887641423244333543332346678883789984-9979999988998422499998588899999962334214650


Q ss_pred             CEEEEEEECCEEEEEEECCCCCEEE--EEEEECCEEEEEEECCCCHHHCCEEEEEC
Q ss_conf             2134553023046889738661581--03852885999974068601187288733
Q gi|254780621|r   85 EYLHRGIAKRAFERRFQLADFVEVM--SASLENGLLYLELLRSVPERMKPRRIEIS  138 (157)
Q Consensus        85 ~~~~~e~~~~~F~R~f~Lp~~ve~~--~A~~~nGiLtI~lpK~~pe~~~~r~I~I~  138 (157)
                      +++++|+.+|+|.|+|.||++++..  +|+|+||||+|++||.  +..++|+|+|.
T Consensus        94 ~~~~~e~~~~~f~r~~~lP~~vd~~~i~A~~~~GiL~I~ipK~--~~~~~~~I~Iq  147 (147)
T 1shs_A           94 IIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKA--ESSIKKGINIE  147 (147)
T ss_dssp             EEEECSCCCCEEEEEEECSSCBCGGGCEEEEETTEEEEEEEBC--GGGCCEECCCC
T ss_pred             EEEEEEECCCCEEEEEECCCCCCCCCEEEEEECCEEEEEEEEC--CCCCCCEEEEC
T ss_conf             6864000257538999898881124339999899999999826--77898026609



>1gme_A (A:37-151) Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} Back     alignment and structure
>3gla_A (A:) Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} Back     alignment and structure
>2wj5_A (A:) Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>2bol_A (A:95-190) TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>3igf_A (A:298-374) ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta fold and the C-terminal all beta domain., structural genomics, PSI-2; 2.00A {Nostoc SP} Back     alignment and structure
>2jki_S (S:) SGT1-like protein, cytosolic heat shock protein 90; HSP90 SGT1, stress response, chaperone; HET: ADP; 3.3A {Arabidopsis thaliana} Back     alignment and structure
>2bol_A (A:60-94,A:191-314) TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>1rl1_A (A:) Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A (A:) Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2o30_A (A:) Nuclear movement protein; MCSG, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 1.66A {Encephalitozoon cuniculi gb-m1} Back     alignment and structure
>1x5m_A (A:) Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3eud_A (A:) Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wfi_A (A:) Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} Back     alignment and structure
>2cr0_A (A:) Nuclear migration protein NUDC; CS domain, beta sandwich, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2k8q_A (A:) Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kmw_A (A:) Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2wj7_A (A:22-65) Alpha-crystallin B chain; desmin-related myopathy, phosphoprotein, disease mutation, eye lens protein, methylation, polymorphism, glycoprotein; 2.63A {Homo sapiens} Back     alignment and structure