254780622

254780622

bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase

GeneID in NCBI database:8209622Locus tag:CLIBASIA_02545
Protein GI in NCBI database:254780622Protein Accession:YP_003065035.1
Gene range:+(649367, 650584)Protein Length:405aa
Gene description:bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
COG prediction:[H] Phosphopantothenoylcysteine synthetase/decarboxylase
KEGG prediction:dfp; bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase (EC:6.3.2.5); K13038 phosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase [EC:4.1.1.36 6.3.2.5]
SEED prediction:Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36) / Phosphopantothenoylcysteine synthetase (EC 6.3.2.5)
Pathway involved in KEGG:Pantothenate and CoA biosynthesis [PATH:las00770]
Subsystem involved in SEED:Coenzyme A Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-----
MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITWLLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGDTMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPDTGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIVEHLGMK
ccccccEEEEEEEcHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHccHHHHHHHHcccHHHHccccccccccccccccccccEEEEEcccHHHHHHHHHcccHHHHHHHHHccccccEEEEccccHHHHccHHHHHHHHHHHHcccEEEccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEEEEccccccccccccEEccccccHHHHHHHHHHHHcccEEEEEEcccccccccccEEEEEccHHHHHHHHHHHccccEEEEEEEHHcccccccccccccccccccccEEEEEEccHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHccccEEEEEccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHccc
ccccccEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHccHcHHHHHcccccccccccHHHHHHHcHHHHHHHHcHEEEcHHHHHHHHHHHHccHHHHHHHHHHHcccccEEEcHHHHHHHHccHHHHHHHHHHHHcccEEEccccccEEEcccccccccccHHHHHHHHHHHHcccccccccccEEEEEccccccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEEcccccccccccEEEEEccHHHHHHHHHHHccccEEEEEEEEEcccHHHHHHHHHccccccccEEEEEEccHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccccccccEEEEEEccccEccccccHHHHHHHHHHHHHHHHccc
MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLakgdqpvliapamnfmmwakpatqRNVEILQkdgcyfigpesgamaesngygvgrmsepcDIIRQITWLLYKSKELLLKGKRAlvtsgptyepldpmryianrssgqqGHAIAKSLAYFGAEVIlisgpvsiadppnvmTIHVERAEDMLQEVLKALPVDIAVMVSAvsdwrfpkiagtkikrkdigdtmridlmenpDILKIIghhqcrpsivvgFAAETQCIEQNAREKLLNkgadfivsncilpdtgfvgkewnkvsivfpdkieeypelpkaeVADRLCHLIVEHLGMK
MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVvipvmtksaqkfitplivgaisnRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITWLLYKSKELLLKGKRalvtsgptyeplDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVsavsdwrfpkiagtkikrkdigdtMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPDTGFVGKEWNKVSIVFPDKIeeypelpkaevADRLCHLIVEHLGMK
MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITWLLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGDTMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPDTGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIVEHLGMK
***SGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITWLLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIA****K****GDTMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPDTGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIVEHLG**
MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITWLLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGDTMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPDTGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIVEHLGMK
**LSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITWLLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGDTMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPDTGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIVEHLGM*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITWLLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGDTMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPDTGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIVEHLGMK
MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITWLLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGDTMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPDTGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIVEHLGMK
MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITWLLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGDTMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPDTGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIVEHLGMK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target405 bifunctional phosphopantothenoylcysteine decarboxylase/
315121823405 bifunctional phosphopantothenoylcysteine decarboxylase/ 1 0.0
190890009403 phosphopantothenate-cysteine ligase/phosphopantothenoyl 1 1e-127
222147308405 bifunctional phosphopantothenoylcysteine decarboxylase/ 1 1e-127
327192066402 phosphopantothenate-cysteine ligase/phosphopantothenoyl 1 1e-126
86355999402 bifunctional phosphopantothenoylcysteine decarboxylase/ 1 1e-125
163757778400 putative coenyzme A biosynthesis bifunctional protein [ 1 1e-124
241207303401 bifunctional phosphopantothenoylcysteine decarboxylase/ 1 1e-124
116250126401 bifunctional phosphopantothenoylcysteine decarboxylase/ 1 1e-124
209551922403 bifunctional phosphopantothenoylcysteine decarboxylase/ 1 1e-123
222084629403 phosphopantothenoylcysteine decarboxylase/phosphopantot 1 1e-122
>gi|315121823|ref|YP_004062312.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 405 Back     alignment and organism information
 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/404 (77%), Positives = 360/404 (89%), Gaps = 1/404 (0%)

Query: 1   MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRV 60
           MD+ GK+I LIMCGSVAVYKSLDLIRR+RERGAVVIPV+T SAQKF+TPL+VGAISN +V
Sbjct: 1   MDILGKRILLIMCGSVAVYKSLDLIRRMRERGAVVIPVITDSAQKFVTPLLVGAISNSQV 60

Query: 61  YTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVL 120
           YT L  ++E ++SNHIQLA++CDL +VAPA+A+FIA +AHGM  DLASA+LLAK DQPVL
Sbjct: 61  YTSLFPHEERHDSNHIQLASDCDLFLVAPATAHFIACIAHGMADDLASAVLLAKRDQPVL 120

Query: 121 IAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITW 180
           +APAMNFMMW+  ATQRNVEILQKDG YF+GPE+GAMAE+NG GVGRMSE CDII+ +  
Sbjct: 121 LAPAMNFMMWSNSATQRNVEILQKDGYYFVGPENGAMAENNGCGVGRMSESCDIIKHVAG 180

Query: 181 LLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISG 240
           LL + K+L LKG+RA+VTSGPTYEPLDPMRYIANRSSG+QGHAIA+ LA  GAEV LISG
Sbjct: 181 LLCREKKLPLKGRRAVVTSGPTYEPLDPMRYIANRSSGRQGHAIAECLACLGAEVTLISG 240

Query: 241 PVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGD 300
           PVS+ADPPNV TIHVERAE+MLQEVLK+LP DIAVMVSAVSDW+F +IA TKIKRKDIG+
Sbjct: 241 PVSLADPPNVTTIHVERAEEMLQEVLKSLPADIAVMVSAVSDWKFSEIAKTKIKRKDIGN 300

Query: 301 TMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPD 360
            MR+DL ENPDIL+IIGHHQ RPS+VVGFAAETQCIEQNAREKLL KGADFIVSNC+LP+
Sbjct: 301 FMRVDLAENPDILRIIGHHQYRPSVVVGFAAETQCIEQNAREKLLYKGADFIVSNCVLPE 360

Query: 361 TGFVGKEWNKVSIVFP-DKIEEYPELPKAEVADRLCHLIVEHLG 403
            GFVGKE NKVSIVFP D IEE+PEL K EVA+RLC LIV++L 
Sbjct: 361 VGFVGKESNKVSIVFPGDIIEEWPELLKTEVANRLCVLIVKYLN 404


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190890009|ref|YP_001976551.1| phosphopantothenate-cysteine ligase/phosphopantothenoylcysteine decarboxylase [Rhizobium etli CIAT 652] Length = 403 Back     alignment and organism information
>gi|222147308|ref|YP_002548265.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Agrobacterium vitis S4] Length = 405 Back     alignment and organism information
>gi|327192066|gb|EGE59047.1| phosphopantothenate-cysteine ligase/phosphopantothenoylcysteine decarboxylase protein [Rhizobium etli CNPAF512] Length = 402 Back     alignment and organism information
>gi|86355999|ref|YP_467891.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Rhizobium etli CFN 42] Length = 402 Back     alignment and organism information
>gi|163757778|ref|ZP_02164867.1| putative coenyzme A biosynthesis bifunctional protein [Hoeflea phototrophica DFL-43] Length = 400 Back     alignment and organism information
>gi|241207303|ref|YP_002978399.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 401 Back     alignment and organism information
>gi|116250126|ref|YP_765964.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 401 Back     alignment and organism information
>gi|209551922|ref|YP_002283839.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 403 Back     alignment and organism information
>gi|222084629|ref|YP_002543158.1| phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase [Agrobacterium radiobacter K84] Length = 403 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target405 bifunctional phosphopantothenoylcysteine decarboxylase/
PRK13982475 PRK13982, PRK13982, bifunctional SbtC-like/phosphopanto 1e-133
PRK05579399 PRK05579, PRK05579, bifunctional phosphopantothenoylcys 1e-130
TIGR00521390 TIGR00521, coaBC_dfp, phosphopantothenoylcysteine decar 1e-94
COG0452392 COG0452, Dfp, Phosphopantothenoylcysteine synthetase/de 1e-91
PRK07313182 PRK07313, PRK07313, phosphopantothenoylcysteine decarbo 2e-51
TIGR02113177 TIGR02113, coaC_strep, phosphopantothenoylcysteine deca 3e-31
KOG0672218 KOG0672, KOG0672, KOG0672, Halotolerance protein HAL3 ( 2e-14
PLN02496209 PLN02496, PLN02496, probable phosphopantothenoylcystein 9e-14
pfam04127197 pfam04127, DFP, DNA / pantothenate metabolism flavoprot 1e-32
PRK06732229 PRK06732, PRK06732, phosphopantothenate--cysteine ligas 3e-12
TIGR02114227 TIGR02114, coaB_strep, phosphopantothenate--cysteine li 5e-10
PRK09620229 PRK09620, PRK09620, hypothetical protein; Provisional 4e-08
pfam02441118 pfam02441, Flavoprotein, Flavoprotein 6e-27
PRK08305196 PRK08305, spoVFB, dipicolinate synthase subunit B; Revi 7e-06
>gnl|CDD|172484 PRK13982, PRK13982, bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>gnl|CDD|180143 PRK05579, PRK05579, bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>gnl|CDD|161911 TIGR00521, coaBC_dfp, phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>gnl|CDD|30801 COG0452, Dfp, Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|180924 PRK07313, PRK07313, phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>gnl|CDD|131168 TIGR02113, coaC_strep, phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>gnl|CDD|35891 KOG0672, KOG0672, KOG0672, Halotolerance protein HAL3 (contains flavoprotein domain) [Inorganic ion transport and metabolism, Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|166137 PLN02496, PLN02496, probable phosphopantothenoylcysteine decarboxylase Back     alignment and domain information
>gnl|CDD|146655 pfam04127, DFP, DNA / pantothenate metabolism flavoprotein Back     alignment and domain information
>gnl|CDD|180673 PRK06732, PRK06732, phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>gnl|CDD|131169 TIGR02114, coaB_strep, phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>gnl|CDD|181997 PRK09620, PRK09620, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|145534 pfam02441, Flavoprotein, Flavoprotein Back     alignment and domain information
>gnl|CDD|181370 PRK08305, spoVFB, dipicolinate synthase subunit B; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 405 bifunctional phosphopantothenoylcysteine decarboxylase/
PRK13982476 bifunctional SbtC-like/phosphopantothenoylcysteine deca 100.0
PRK05579392 bifunctional phosphopantothenoylcysteine decarboxylase/ 100.0
COG0452392 Dfp Phosphopantothenoylcysteine synthetase/decarboxylas 100.0
TIGR00521418 coaBC_dfp phosphopantothenoylcysteine decarboxylase/pho 100.0
PRK07313180 phosphopantothenoylcysteine decarboxylase; Validated 100.0
KOG0672218 consensus 100.0
PRK08305195 spoVFB dipicolinate synthase subunit B; Reviewed 100.0
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxylase; I 100.0
PRK06029187 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provision 99.9
PRK05920205 aromatic acid decarboxylase; Validated 99.84
TIGR00421181 ubiX_pad polyprenyl P-hydroxybenzoate and phenylacrylic 99.77
COG0163191 UbiX 3-polyprenyl-4-hydroxybenzoate decarboxylase [Coen 99.76
TIGR02852188 spore_dpaB dipicolinic acid synthetase, B subunit; Inte 99.74
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 94.39
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 93.5
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.03
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelat 92.88
pfam04127197 DFP DNA / pantothenate metabolism flavoprotein. The DNA 100.0
PRK09620229 hypothetical protein; Provisional 100.0
PRK06732228 phosphopantothenate--cysteine ligase; Validated 100.0
TIGR02114253 coaB_strep phosphopantothenate--cysteine ligase; InterP 100.0
KOG2728302 consensus 99.96
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.61
PRK07201663 short chain dehydrogenase; Provisional 97.53
PRK12828239 short chain dehydrogenase; Provisional 97.41
PRK05866290 short chain dehydrogenase; Provisional 97.4
PRK09242258 tropinone reductase; Provisional 97.37
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.27
PRK12746254 short chain dehydrogenase; Provisional 97.23
PRK06124259 gluconate 5-dehydrogenase; Provisional 97.16
PRK07523251 gluconate 5-dehydrogenase; Provisional 97.02
PRK07776252 consensus 97.01
PRK07097265 gluconate 5-dehydrogenase; Provisional 96.92
KOG1201300 consensus 96.83
PRK12938246 acetyacetyl-CoA reductase; Provisional 96.5
PRK06123249 short chain dehydrogenase; Provisional 96.23
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 96.11
COG2910211 Putative NADH-flavin reductase [General function predic 94.81
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 93.89
PRK07789612 acetolactate synthase 1 catalytic subunit; Validated 92.12
pfam02441118 Flavoprotein Flavoprotein. This family contains diverse 99.97
TIGR02700237 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterP 99.7
COG1036187 Archaeal flavoproteins [Energy production and conversio 99.57
pfam00582140 Usp Universal stress protein family. The universal stre 92.16
TIGR02699176 archaeo_AfpA archaeoflavoprotein AfpA; InterPro: IPR014 99.65
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.72
PRK07856254 short chain dehydrogenase; Provisional 97.69
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.6
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 97.58
PRK06398256 aldose dehydrogenase; Validated 97.51
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 97.48
PRK07831261 short chain dehydrogenase; Provisional 97.41
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 97.35
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 97.35
PRK08085254 gluconate 5-dehydrogenase; Provisional 97.35
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 97.33
PRK08936261 glucose-1-dehydrogenase; Provisional 97.29
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.22
PRK12744257 short chain dehydrogenase; Provisional 97.22
PRK06198268 short chain dehydrogenase; Provisional 97.2
PRK07067256 sorbitol dehydrogenase; Provisional 97.14
PRK05867253 short chain dehydrogenase; Provisional 97.13
PRK06841255 short chain dehydrogenase; Provisional 97.11
PRK07060245 short chain dehydrogenase; Provisional 97.09
PRK07814263 short chain dehydrogenase; Provisional 97.05
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 96.99
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 96.99
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.98
PRK12829264 short chain dehydrogenase; Provisional 96.98
PRK06701289 short chain dehydrogenase; Provisional 96.97
PRK06114262 short chain dehydrogenase; Provisional 96.97
PRK08213259 gluconate 5-dehydrogenase; Provisional 96.96
PRK12939250 short chain dehydrogenase; Provisional 96.95
PRK06138252 short chain dehydrogenase; Provisional 96.95
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.93
PRK07677254 short chain dehydrogenase; Provisional 96.91
PRK05717255 oxidoreductase; Validated 96.88
PRK12937245 short chain dehydrogenase; Provisional 96.88
PRK07062265 short chain dehydrogenase; Provisional 96.84
PRK06172253 short chain dehydrogenase; Provisional 96.81
PRK08324676 short chain dehydrogenase; Validated 96.81
PRK07063259 short chain dehydrogenase; Provisional 96.78
PRK06227256 consensus 96.76
PRK06128300 oxidoreductase; Provisional 96.67
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 96.62
PRK08643256 acetoin reductase; Validated 95.46
PRK12824245 acetoacetyl-CoA reductase; Provisional 94.77
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 92.71
TIGR02197353 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; 90.18
PRK07577234 short chain dehydrogenase; Provisional 97.71
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 97.55
PRK08945245 short chain dehydrogenase; Provisional 97.5
PRK06500249 short chain dehydrogenase; Provisional 97.42
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 97.37
PRK06196316 oxidoreductase; Provisional 97.32
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 97.32
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 97.26
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisional 97.23
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 97.19
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.17
PRK07035252 short chain dehydrogenase; Provisional 97.16
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 97.16
PRK12742237 oxidoreductase; Provisional 97.15
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 97.14
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 97.12
PRK05872296 short chain dehydrogenase; Provisional 97.12
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.12
PRK08264235 short chain dehydrogenase; Validated 97.1
PRK07774250 short chain dehydrogenase; Provisional 97.09
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 97.09
PRK09186255 flagellin modification protein A; Provisional 97.04
PRK08628258 short chain dehydrogenase; Provisional 97.04
PRK07825273 short chain dehydrogenase; Provisional 97.02
PRK07791285 short chain dehydrogenase; Provisional 97.0
PRK06346251 consensus 96.99
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.96
PRK08226263 short chain dehydrogenase; Provisional 96.94
PRK09134256 short chain dehydrogenase; Provisional 96.92
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.91
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.91
PRK06949258 short chain dehydrogenase; Provisional 96.87
PRK05876275 short chain dehydrogenase; Provisional 96.86
PRK07326235 short chain dehydrogenase; Provisional 96.85
PRK08265261 short chain dehydrogenase; Provisional 96.8
PRK12935247 acetoacetyl-CoA reductase; Provisional 96.78
PRK06057255 short chain dehydrogenase; Provisional 96.76
PRK08703239 short chain dehydrogenase; Provisional 96.7
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 96.68
PRK07478254 short chain dehydrogenase; Provisional 96.67
PRK08589272 short chain dehydrogenase; Validated 96.65
PRK12747252 short chain dehydrogenase; Provisional 96.62
PRK08277278 D-mannonate oxidoreductase; Provisional 96.55
PRK07832272 short chain dehydrogenase; Provisional 96.5
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 96.42
PRK06720169 hypothetical protein; Provisional 96.41
PRK09135249 pteridine reductase; Provisional 96.38
PRK07985294 oxidoreductase; Provisional 96.37
PRK08251248 short chain dehydrogenase; Provisional 96.34
PRK06181263 short chain dehydrogenase; Provisional 96.29
PRK12367250 short chain dehydrogenase; Provisional 96.18
PRK06483236 short chain dehydrogenase; Provisional 96.17
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 96.04
smart00822180 PKS_KR This enzymatic domain is part of bacterial polyk 96.04
PRK06947252 glucose-1-dehydrogenase; Provisional 95.85
PRK07024256 short chain dehydrogenase; Provisional 95.79
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 95.46
PRK07074256 short chain dehydrogenase; Provisional 95.11
PRK07454241 short chain dehydrogenase; Provisional 94.89
TIGR01283470 nifE nitrogenase MoFe cofactor biosynthesis protein Nif 94.42
PRK09009235 C factor cell-cell signaling protein; Provisional 93.59
PRK08219226 short chain dehydrogenase; Provisional 92.76
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 91.96
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 91.66
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 91.58
KOG4169261 consensus 91.57
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o 91.37
PRK13940414 glutamyl-tRNA reductase; Provisional 90.25
PRK06523260 short chain dehydrogenase; Provisional 97.6
PRK12827251 short chain dehydrogenase; Provisional 97.03
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewed 92.55
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 92.02
PRK07525589 sulfoacetaldehyde acetyltransferase; Validated 90.54
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 97.53
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 97.04
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 96.94
PRK08263275 short chain dehydrogenase; Provisional 96.88
PRK07890258 short chain dehydrogenase; Provisional 96.85
PRK06125259 short chain dehydrogenase; Provisional 96.81
PRK07479252 consensus 96.7
PRK08303305 short chain dehydrogenase; Provisional 96.6
PRK06182273 short chain dehydrogenase; Validated 96.45
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.38
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 96.09
PRK06914280 short chain dehydrogenase; Provisional 96.03
PRK06179270 short chain dehydrogenase; Provisional 95.78
PRK09291257 short chain dehydrogenase; Provisional 95.34
PRK08017256 short chain dehydrogenase; Provisional 95.23
PRK06180277 short chain dehydrogenase; Provisional 94.59
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 94.55
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 94.47
PRK06482276 short chain dehydrogenase; Provisional 94.47
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 94.28
PRK05993277 short chain dehydrogenase; Provisional 94.16
PRK05693274 short chain dehydrogenase; Provisional 93.96
PRK06924251 short chain dehydrogenase; Provisional 93.3
TIGR02622 361 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: I 92.72
PRK06467 472 dihydrolipoamide dehydrogenase; Reviewed 92.1
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 92.05
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 91.92
PRK06370459 mercuric reductase; Validated 91.49
KOG0725270 consensus 91.28
PTZ00079469 NADP-specific glutamate dehydrogenase; Provisional 91.25
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 97.51
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 97.42
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 97.34
PRK05854314 short chain dehydrogenase; Provisional 97.27
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 97.24
PRK09072262 short chain dehydrogenase; Provisional 97.21
PRK06197306 short chain dehydrogenase; Provisional 97.21
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 97.2
PRK10675338 UDP-galactose-4-epimerase; Provisional 96.95
PRK07041240 short chain dehydrogenase; Provisional 96.89
PRK06139324 short chain dehydrogenase; Provisional 96.88
PRK08278273 short chain dehydrogenase; Provisional 96.87
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.87
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 96.81
PRK08339263 short chain dehydrogenase; Provisional 96.78
PRK07109338 short chain dehydrogenase; Provisional 96.73
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 96.71
PRK06194301 hypothetical protein; Provisional 96.56
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 96.45
PRK06300298 enoyl-(acyl carrier protein) reductase; Provisional 96.39
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 96.08
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 95.98
PRK06484 530 short chain dehydrogenase; Validated 95.88
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 95.74
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 95.63
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 95.53
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 95.06
COG1028251 FabG Dehydrogenases with different specificities (relat 94.79
PRK06940277 short chain dehydrogenase; Provisional 94.34
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisio 94.26
KOG1502327 consensus 94.14
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 94.14
COG0623259 FabI Enoyl-[acyl-carrier-protein] 93.92
KOG1371343 consensus 93.85
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 93.65
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.45
PRK07453322 protochlorophyllide oxidoreductase; Validated 92.72
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 91.28
PRK12446352 N-acetylglucosaminyl transferase; Reviewed 90.53
PRK00726359 murG N-acetylglucosaminyl transferase; Provisional 90.4
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 90.31
PRK06953222 short chain dehydrogenase; Provisional 90.11
PRK06484530 short chain dehydrogenase; Validated 97.13
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases [Cell 97.06
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 97.02
PRK08862227 short chain dehydrogenase; Provisional 96.87
PRK07576260 short chain dehydrogenase; Provisional 96.79
PRK07806248 short chain dehydrogenase; Provisional 96.75
PRK05875277 short chain dehydrogenase; Provisional 96.7
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 96.5
PRK07775275 short chain dehydrogenase; Provisional 96.49
PRK08340259 glucose-1-dehydrogenase; Provisional 96.09
PRK07102243 short chain dehydrogenase; Provisional 95.52
PRK07707239 consensus 95.36
PRK08177225 short chain dehydrogenase; Provisional 95.24
PRK05650270 short chain dehydrogenase; Provisional 94.76
PRK06101241 short chain dehydrogenase; Provisional 94.57
PRK07904253 short chain dehydrogenase; Provisional 94.46
KOG1210331 consensus 94.15
PRK08267258 short chain dehydrogenase; Provisional 93.51
PRK07023243 short chain dehydrogenase; Provisional 92.92
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 91.9
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 91.5
PRK05855582 short chain dehydrogenase; Validated 96.41
pfam00106167 adh_short short chain dehydrogenase. This family contai 95.89
PRK12743253 acetoin dehydrogenase; Provisional 95.26
PRK09730247 hypothetical protein; Provisional 94.45
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 93.69
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 91.17
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 95.59
PRK07069251 short chain dehydrogenase; Validated 91.55
TIGR01777 307 yfcH conserved hypothetical protein TIGR01777; InterPro 90.22
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.6
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.55
KOG1205282 consensus 94.19
CHL00194319 ycf39 Ycf39; Provisional 93.54
TIGR03590280 PseG pseudaminic acid biosynthesis-associated protein P 93.05
TIGR01179341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 90.26
PRK07846453 mycothione/glutathione reductase; Reviewed 92.62
PRK01747 660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 92.53
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 90.2
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>COG0452 Dfp Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase; InterPro: IPR005252 This entry represents a bifunctional enzyme that catalyzes the second and third steps (cysteine ligation, (6 Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>KOG0672 consensus Back     alignment and domain information
>PRK08305 spoVFB dipicolinate synthase subunit B; Reviewed Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase; InterPro: IPR011847 In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis Back     alignment and domain information
>PRK06029 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provisional Back     alignment and domain information
>PRK05920 aromatic acid decarboxylase; Validated Back     alignment and domain information
>TIGR00421 ubiX_pad polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases; InterPro: IPR004507 This family contains flavoproteins, which are aromatic acid decarboxylases Back     alignment and domain information
>COG0163 UbiX 3-polyprenyl-4-hydroxybenzoate decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit; InterPro: IPR014214 Members of this entry represent the B subunit of dipicolinic acid synthetase, an enzyme that synthesizes a small molecule that appears to confer heat stability to bacterial endospores such as those of Bacillus subtilis Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>pfam00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>pfam04127 DFP DNA / pantothenate metabolism flavoprotein Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase; InterPro: IPR011848 In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis Back     alignment and domain information
>KOG2728 consensus Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07776 consensus Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>pfam02441 Flavoprotein Flavoprotein Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterPro: IPR014073 This entry describes one of two paralogous families of archaeal flavoprotein Back     alignment and domain information
>COG1036 Archaeal flavoproteins [Energy production and conversion] Back     alignment and domain information
>pfam00582 Usp Universal stress protein family Back     alignment and domain information
>TIGR02699 archaeo_AfpA archaeoflavoprotein AfpA; InterPro: IPR014072 The prototypical member of this archaeal protein family is AF1518 from Archaeoglobus fulgidus Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06227 consensus Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912 Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06346 consensus Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01283 nifE nitrogenase MoFe cofactor biosynthesis protein NifE; InterPro: IPR005973 The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>pfam02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain Back     alignment and domain information
>KOG4169 consensus Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07479 consensus Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>pfam00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: IPR013445 This entry contains CDP-glucose 4,6-dehydratases from a variety of Gram-negative and Gram-positive bacteria Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>KOG0725 consensus Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information