254780671

254780671

putative cell division protein

GeneID in NCBI database:8209675Locus tag:CLIBASIA_02790
Protein GI in NCBI database:254780671Protein Accession:YP_003065084.1
Gene range:-(597076, 597393)Protein Length:105aa
Gene description:putative cell division protein
COG prediction:[D] Septum formation initiator
KEGG prediction:putative cell division protein
SEED prediction:Septum formation initiator
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccEEEEEEccc
cccHHccccccccEHHHHHHHHHHHHHHHHHHHccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEEEEcc
mwtkyykknhFFRAIFLVIAFCCVVYftnhaivgdyglkANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARyslnlsrsdeiILFYSDF
MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSelkenrsrlerkvklmsdgslekdlldekaryslnlsrsdeiilfysdf
MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF
************RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD*
MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF
MWT***KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxSLEKDLLDEKARYSLNLSRSDEIILFYSDF
MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF
MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target105 putative cell division protein [Candidatus Liberibacter
315122218120 putative cell division protein [Candidatus Liberibacter 1 1e-37
227821845106 hypothetical protein NGR_c12810 [Sinorhizobium fredii N 1 2e-23
307309211106 Septum formation initiator [Sinorhizobium meliloti BL22 1 8e-23
218660789106 probable cell division protein (septum formation initia 1 1e-22
218461963106 probable cell division protein (septum formation initia 1 1e-22
116251996106 cell division protein [Rhizobium leguminosarum bv. vici 1 5e-22
190891626106 cell division protein (septum formation initiator prote 1 5e-22
150396295106 septum formation initiator [Sinorhizobium medicae WSM41 1 5e-22
327189240106 putative cell division protein (septum formation initia 1 7e-22
86357553106 putative septum formation initiator protein [Rhizobium 1 9e-22
>gi|315122218|ref|YP_004062707.1| putative cell division protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 120 Back     alignment and organism information
 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (85%)

Query: 1   MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60
           MWT++YKK  FFR +F VIAF  V+YF NHAI  D GL+  KSLEKSLIERERFL EL+E
Sbjct: 16  MWTRHYKKGKFFRIVFRVIAFFSVIYFINHAIKDDCGLEETKSLEKSLIERERFLFELQE 75

Query: 61  NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105
            RS+LERKVKLMSDGSLEKDLLDEKARY+LNLSRSDEIILFY +F
Sbjct: 76  VRSKLERKVKLMSDGSLEKDLLDEKARYNLNLSRSDEIILFYPNF 120


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821845|ref|YP_002825815.1| hypothetical protein NGR_c12810 [Sinorhizobium fredii NGR234] Length = 106 Back     alignment and organism information
>gi|307309211|ref|ZP_07588882.1| Septum formation initiator [Sinorhizobium meliloti BL225C] Length = 106 Back     alignment and organism information
>gi|218660789|ref|ZP_03516719.1| probable cell division protein (septum formation initiator protein) [Rhizobium etli IE4771] Length = 106 Back     alignment and organism information
>gi|218461963|ref|ZP_03502054.1| probable cell division protein (septum formation initiator protein) [Rhizobium etli Kim 5] Length = 106 Back     alignment and organism information
>gi|116251996|ref|YP_767834.1| cell division protein [Rhizobium leguminosarum bv. viciae 3841] Length = 106 Back     alignment and organism information
>gi|190891626|ref|YP_001978168.1| cell division protein (septum formation initiator protein) [Rhizobium etli CIAT 652] Length = 106 Back     alignment and organism information
>gi|150396295|ref|YP_001326762.1| septum formation initiator [Sinorhizobium medicae WSM419] Length = 106 Back     alignment and organism information
>gi|327189240|gb|EGE56419.1| putative cell division protein (septum formation initiator protein) [Rhizobium etli CNPAF512] Length = 106 Back     alignment and organism information
>gi|86357553|ref|YP_469445.1| putative septum formation initiator protein [Rhizobium etli CFN 42] Length = 106 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target105 putative cell division protein [Candidatus Liberibacter
pfam0497780 pfam04977, DivIC, Septum formation initiator 1e-06
COG2919117 COG2919, COG2919, Septum formation initiator [Cell divi 3e-08
>gnl|CDD|147248 pfam04977, DivIC, Septum formation initiator Back     alignment and domain information
>gnl|CDD|32743 COG2919, COG2919, Septum formation initiator [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 105 putative cell division protein [Candidatus Liberibacter
PRK00888105 ftsB cell division protein FtsB; Reviewed 99.78
pfam0497780 DivIC Septum formation initiator. DivIC from B. subtili 99.71
COG2919117 Septum formation initiator [Cell division and chromosom 99.7
TIGR0220985 ftsL_broad cell division protein FtsL; InterPro: IPR011 97.9
pfam0499997 FtsL Cell division protein FtsL. In Escherichia coli, n 97.06
PRK10772121 cell division protein FtsL; Provisional 95.92
COG3116105 FtsL Cell division protein [Cell division and chromosom 95.49
COG4839120 FtsL Protein required for the initiation of cell divisi 94.25
TIGR02894163 DNA_bind_RsfA transcription factor, RsfA family; InterP 91.17
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>pfam04977 DivIC Septum formation initiator Back     alignment and domain information
>COG2919 Septum formation initiator [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02209 ftsL_broad cell division protein FtsL; InterPro: IPR011922 This entry represents FtsL, both forms similar to that in Escherichia coli and similar to that in Bacillus subtilis Back     alignment and domain information
>pfam04999 FtsL Cell division protein FtsL Back     alignment and domain information
>PRK10772 cell division protein FtsL; Provisional Back     alignment and domain information
>COG3116 FtsL Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4839 FtsL Protein required for the initiation of cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family; InterPro: IPR014243 This entry represents a set of transcription factors found in some endospore-forming bacteria within the Firmicutes (low-GC Gram-positive bacteria) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00